Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.546na 1ON54254227820.0
Suva_8.436na 1ON54554524260.0
YOR380W (RDR1)na 1ON54654624100.0
Smik_15.561na 1ON54654622840.0
Kwal_23.6537na 1ON55255315960.0
KLTH0C10516gna 1ON56155415210.0
KAFR0F014901.128ON6583411402e-08
KLTH0D07898g2.565ON6721191368e-08
Kpol_1039.112.231ON992531351e-07
Suva_2.1214.113ON971501304e-07
Smik_5.9singletonOFF56551145e-07
KNAG0I005601.128ON663461295e-07
TDEL0C044802.231ON852741297e-07
KLLA0F04609g2.231ON916371271e-06
CAGL0A00451g4.113ON1107431271e-06
TPHA0F013802.231ON890661271e-06
Suva_9.592.231ON926401252e-06
YIL130W (ASG1)2.231ON964401252e-06
Smik_9.392.231ON1012401252e-06
TBLA0G026102.231ON10001001252e-06
Skud_9.372.231ON954401252e-06
NCAS0A035804.113ON1113461242e-06
KAFR0F034104.113ON995831242e-06
TPHA0F008304.113ON1192541243e-06
KAFR0J017102.231ON848371233e-06
SAKL0E08998g2.231ON823511233e-06
NCAS0B065502.231ON906371233e-06
NDAI0B038502.231ON930581234e-06
Kwal_23.47542.231ON812371215e-06
Smik_10.251.128ON772961215e-06
KNAG0E017602.231ON902371215e-06
KLTH0G09108g2.231ON782371215e-06
SAKL0C03938g1.128ON780611216e-06
SAKL0B06732gna 2ON878391207e-06
Skud_7.2744.113ON1080531208e-06
Smik_7.2774.113ON1069521191e-05
CAGL0G08844g2.231ON847411181e-05
KAFR0C03730singletonON791551181e-05
ZYRO0E06270g2.565ON912371181e-05
Skud_10.101.128ON833451172e-05
KAFR0B028208.283ON664361162e-05
TBLA0A007302.654ON1037461172e-05
Smik_2.1154.113ON971781172e-05
Suva_7.2684.113ON1000431162e-05
YGL013C (PDR1)4.113ON1068521162e-05
Kpol_1061.424.113ON1129481162e-05
Ecym_7440na 2ON898391143e-05
YBL005W (PDR3)4.113ON976361143e-05
ZYRO0D06688g8.283ON5953661144e-05
KNAG0M021202.565ON6083451144e-05
Skud_2.1064.113ON1010361144e-05
KAFR0A021302.565ON707431134e-05
Kpol_1033.158.283ON594481134e-05
SAKL0D13464g2.565ON687511135e-05
KNAG0D035204.113ON1030471135e-05
KNAG0C059804.113ON968481136e-05
YJL206C1.128ON758451126e-05
NCAS0A127202.565ON7594051126e-05
Suva_6.2851.128ON786971126e-05
YKL015W (PUT3)2.654ON979431127e-05
AER370W2.231ON801371118e-05
Ecym_53972.231ON826371118e-05
KLLA0C03201g1.128ON6503371119e-05
NDAI0B015402.565ON803381119e-05
KLLA0A02585gna 3ON3701271091e-04
AER183Cna 2ON879391101e-04
KLLA0A09119g4.113ON1082461101e-04
ZYRO0G10252g4.113ON1036471101e-04
NDAI0D035504.113ON1118401092e-04
KLTH0B09262gsingletonON820351092e-04
NDAI0A034204.113ON1108381082e-04
Skud_13.1732.565ON920471082e-04
SAKL0D01100g4.113ON940441082e-04
Suva_13.1862.565ON894461082e-04
KNAG0H002502.654ON896381082e-04
KLLA0C14212gna 4ON1040741082e-04
SAKL0A02860g6.279ON7451881072e-04
NCAS0A03570na 5ON978661072e-04
SAKL0G19470g2.654ON831441072e-04
SAKL0B04620gna 3ON362381062e-04
KLTH0C00814g2.654ON834411073e-04
NDAI0A03410na 5ON980951073e-04
Kwal_47.175064.113ON924481073e-04
ZYRO0G22550gsingletonON724461063e-04
NCAS0A016304.113ON1043351073e-04
TDEL0F023304.113ON1086571063e-04
Ecym_72354.113ON943551063e-04
KNAG0C011601.199ON835511063e-04
Kwal_27.102328.845ON1209591063e-04
ZYRO0G14278g8.845ON1250601063e-04
KLTH0E00440gsingletonON688281063e-04
KLTH0B10076gsingletonON688281063e-04
ZYRO0C18150g1.128ON571391054e-04
NDAI0D03540na 5ON1107491064e-04
KLTH0C03762g8.845ON1206591064e-04
TDEL0B005308.845ON1301541064e-04
KLLA0D10153gsingletonON655841054e-04
KLTH0E14454gna 2ON9021181055e-04
NCAS0H034202.654ON902461055e-04
KLLA0F22990g1.380ON1253501046e-04
Smik_11.2402.654ON976371046e-04
CAGL0F09229gna 6ON835731046e-04
KLLA0E18129g2.654ON865441046e-04
TDEL0D00820na 7ON685821046e-04
Skud_5.331singletonON17041986e-04
TBLA0C040504.113ON1207501046e-04
Suva_13.4688.845ON1418371038e-04
ZYRO0B14476gna 7ON707421038e-04
Skud_11.2142.654ON981431038e-04
SAKL0D01342g8.845ON1270371030.001
Ecym_46168.845ON1577371030.001
KLTH0E07854g4.113ON938371020.001
Smik_13.4938.845ON1433371020.001
KNAG0G021308.283ON632361020.001
AFL160C6.279ON6483621020.001
Skud_13.4528.845ON1432371020.001
YMR280C (CAT8)8.845ON1433371020.001
YMR019W (STB4)2.565ON949461010.001
TBLA0G005106.60ON935601010.001
ABL121C8.845ON1285461010.001
KAFR0B039508.845ON1246371010.001
NDAI0K003908.845ON1495471010.001
KLLA0F09559gsingletonON658501010.001
KLTH0G13200g8.283ON566281000.001
KAFR0C013203.109ON1006411010.001
SAKL0C00242gna 6ON833511000.002
ZYRO0D02090g1.199ON842631000.002
KLTH0E05786gna 6ON817481000.002
NCAS0A076107.17ON1022591000.002
KLLA0D01452g8.845ON1445371000.002
NCAS0C003908.845ON1164461000.002
TPHA0L003505.525ON859102990.002
Smik_2.438na 8ON46933980.002
TBLA0C062306.60ON79540990.003
Kwal_14.9152.654ON82250980.003
CAGL0L03377g1.277ON120938990.003
Suva_11.2132.654ON98542990.003
YBR297W (MAL33)na 8ON46833980.003
TDEL0C056801.128ON69131980.003
TDEL0D00260singletonON64732970.003
Smik_12.1578.283ON64452970.003
Suva_15.773.109ON1029102980.003
Smik_13.1832.565ON91136980.003
CAGL0M03025g8.845ON125446980.004
Kpol_467.11.380ON128950970.004
NCAS0G011006.279ON935181970.004
Ecym_33922.654ON84747970.004
KLTH0C10098g6.60ON77152970.004
TBLA0E034803.109ON104651970.004
CAGL0F02519g1.128ON83240960.005
Kwal_56.226053.109ON86563960.005
KLLA0F02387g7.56ON72752960.005
KLLA0C18953gna 9ON70336950.006
ACL058Wna 10ON81755950.006
KLLA0A06039g1.199ON65750950.006
Suva_16.25singletonON14333890.007
AFR117C1.380ON115252950.007
NCAS0E023107.56ON71839950.007
Kpol_1059.268.642ON42058940.008
Suva_15.425singletonON64434940.008
NDAI0D034804.121ON70857940.008
KLTH0E08140g4.121ON632195940.008
TBLA0A012101.380ON142242950.008
NDAI0G052601.380ON158148940.009
ZYRO0E05412g1.380ON124450940.009
SAKL0D14520g7.17ON98354940.010
KLLA0C19228gsingletonON59130930.010
KLLA0F19602g8.283ON60335930.010
ZYRO0E00572g2.654ON83848930.011
TDEL0G04920singletonON69685930.011
CAGL0L09691g2.654ON82445930.012
AGR061C8.283ON61239930.012
TPHA0N002307.17ON123238930.012
TPHA0B036301.380ON142950930.013
Smik_12.3271.380ON150362930.014
TBLA0G005206.61ON87879930.014
Kpol_1061.261.380ON127442930.014
YER184Cna 6ON79437920.015
TDEL0B062601.380ON124742920.015
TPHA0I008601.260ON496255920.015
YLR256W (HAP1)1.380ON150252920.015
Kwal_47.17233na 10ON94839920.015
TBLA0E019007.56ON84036920.015
NCAS0B051108.283ON62745920.016
NDAI0B025208.283ON71045920.016
Kwal_47.175654.121ON62836920.016
TDEL0D06620singletonON559266910.016
Skud_7.638singletonON47332910.017
KAFR0I020301.380ON123345920.018
Skud_12.3351.380ON147952920.018
Suva_11.2991.199ON88932910.018
Ecym_42868.283ON62738910.018
KLLA0C17050gna 10ON95539910.018
SAKL0H24860gna 10ON97139910.019
ZYRO0C00726g7.17ON103549910.019
Smik_1.137.17ON104650910.019
KNAG0M00120singletonON88138910.021
KNAG0M006206.154ON45947900.022
NCAS0A088401.380ON147842910.022
Skud_7.627na 11ON47437900.022
SAKL0H00660gsingletonON91239910.023
KLLA0A03443g7.17ON97550900.024
ACL096W2.654ON83544900.024
CAGL0M05907g1.199ON89164900.024
AGL233Cna 12ON87259900.025
Skud_14.399na 13ON60728900.025
Suva_10.3511.380ON32452890.025
ZYRO0D14080g6.61ON92174900.026
ZYRO0G00308gsingletonON64927900.026
KAFR0A066904.113ON99737900.026
TPHA0C010808.283ON591359900.027
Ecym_2672na 14ON73953900.028
NCAS0D04860singletonON70141900.028
CAGL0B03421g1.380ON135542900.028
Skud_1.107.17ON104050900.029
KNAG0J002508.845ON123753900.030
SAKL0D07898g1.380ON124442900.031
KLTH0E06666gna 10ON94639900.031
KAFR0C039002.654ON81839890.032
KLLA0F02750g3.109ON114850900.032
TDEL0B074902.654ON86530890.032
KLTH0C07480g3.264ON77548890.033
Kwal_YGOB_0.1391.380ON124042890.033
KNAG0I014501.380ON147642890.035
Ecym_27321.380ON119852890.036
CAGL0E05434g7.56ON81650890.037
YNR063Wna 13ON60733890.037
Kwal_26.68057.17ON944102890.039
KAFR0G025406.60ON85560890.040
Ecym_8404na 10ON88539880.042
Suva_14.423na 13ON61685880.042
KLTH0H11572g1.380ON123742880.044
Kwal_56.230583.264ON77547880.046
Kwal_0.142singletonOFF62942880.046
TPHA0O006001.380ON137242880.046
YKR064W (OAF3)1.199ON86355880.048
TBLA0F029207.512ON92345880.049
TBLA0A097606.75ON153053880.049
KAFR0G005701.199ON86256880.050
TBLA0A04280singletonON89239880.052
CAGL0K05841g1.380ON137241880.053
YLR266C (PDR8)6.60ON70151870.053
SAKL0H22374g4.121ON640300870.056
Suva_1.147.17ON104557870.056
KAFR0E024107.56ON69138870.056
KAFR0G025206.61ON83856870.057
Skud_2.427na 8ON46830870.057
Kwal_23.35142.340ON57952870.058
Kwal_34.15751na 15ON62839870.062
NCAS0F010705.525ON90498870.062
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.546
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...  1076   0.0  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...   939   0.0  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...   932   0.0  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...   884   0.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...   619   0.0  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...   590   0.0  
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    59   2e-08
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    57   8e-08
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    57   1e-07
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    55   4e-07
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    49   5e-07
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    54   5e-07
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    54   7e-07
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    54   1e-06
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    54   1e-06
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   1e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    53   2e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    53   2e-06
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    53   2e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   2e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    53   2e-06
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    52   2e-06
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    52   2e-06
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    52   3e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    52   3e-06
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    52   3e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    52   3e-06
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    52   4e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    51   5e-06
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    51   5e-06
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    51   5e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    51   5e-06
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    51   6e-06
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    51   7e-06
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    51   8e-06
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    50   1e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    50   1e-05
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               50   1e-05
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    50   1e-05
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    50   2e-05
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    49   2e-05
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    50   2e-05
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    50   2e-05
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    49   2e-05
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    49   2e-05
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    49   2e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    49   3e-05
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    49   3e-05
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    49   4e-05
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    49   4e-05
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    49   4e-05
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    48   4e-05
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    48   4e-05
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    48   5e-05
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    48   5e-05
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    48   6e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    48   6e-05
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    48   6e-05
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    48   6e-05
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    48   7e-05
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    47   8e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    47   8e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    47   9e-05
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    47   9e-05
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    47   1e-04
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    47   1e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    47   1e-04
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    47   1e-04
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    47   2e-04
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    47   2e-04
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    46   2e-04
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    46   2e-04
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    46   2e-04
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    46   2e-04
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    46   2e-04
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    46   2e-04
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    46   2e-04
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    46   2e-04
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    46   2e-04
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    45   2e-04
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    46   3e-04
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    46   3e-04
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    46   3e-04
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    45   3e-04
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    46   3e-04
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    45   3e-04
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    45   3e-04
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    45   3e-04
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    45   3e-04
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    45   3e-04
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    45   3e-04
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    45   3e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    45   4e-04
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    45   4e-04
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    45   4e-04
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    45   4e-04
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    45   4e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    45   5e-04
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    45   5e-04
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    45   6e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    45   6e-04
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    45   6e-04
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    45   6e-04
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               45   6e-04
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    42   6e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   6e-04
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    44   8e-04
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    44   8e-04
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    44   8e-04
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    44   0.001
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    44   0.001
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    44   0.001
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    44   0.001
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    44   0.001
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    44   0.001
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    44   0.001
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    44   0.001
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    44   0.001
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    44   0.001
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    44   0.001
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    44   0.001
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     44   0.001
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    44   0.001
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    43   0.001
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    44   0.001
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    43   0.002
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    43   0.002
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    43   0.002
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    43   0.002
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    43   0.002
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      43   0.002
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}      43   0.002
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    42   0.002
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    43   0.003
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    42   0.003
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    43   0.003
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    43   0.003
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.003
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    42   0.003
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       42   0.003
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    42   0.003
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    42   0.003
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.003
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    42   0.004
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.004
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    42   0.004
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    42   0.004
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    42   0.004
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    42   0.004
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    42   0.005
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    42   0.005
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    42   0.005
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    41   0.006
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    41   0.006
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.006
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    39   0.007
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    41   0.007
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      41   0.007
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    41   0.008
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    41   0.008
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    41   0.008
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    41   0.008
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    41   0.008
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    41   0.009
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    41   0.009
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    41   0.010
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    40   0.010
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    40   0.010
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    40   0.011
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    40   0.011
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    40   0.012
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    40   0.012
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    40   0.012
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    40   0.013
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    40   0.014
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    40   0.014
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.014
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    40   0.015
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    40   0.015
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    40   0.015
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    40   0.015
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    40   0.015
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    40   0.015
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    40   0.016
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    40   0.016
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    40   0.016
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             40   0.016
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.017
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    40   0.018
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    40   0.018
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    40   0.018
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    40   0.018
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    40   0.018
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    40   0.019
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    40   0.019
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    40   0.019
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.021
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.022
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    40   0.022
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.022
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    40   0.023
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    39   0.024
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    39   0.024
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    39   0.024
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    39   0.025
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    39   0.025
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    39   0.025
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    39   0.026
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    39   0.026
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    39   0.026
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    39   0.027
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    39   0.028
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               39   0.028
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    39   0.028
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    39   0.029
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    39   0.030
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    39   0.031
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    39   0.031
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    39   0.032
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    39   0.032
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.032
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    39   0.033
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    39   0.033
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              39   0.035
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    39   0.036
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    39   0.037
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    39   0.037
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    39   0.039
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.040
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.042
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    39   0.042
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    39   0.044
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    39   0.046
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    39   0.046
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    39   0.046
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    39   0.048
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    39   0.049
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    39   0.049
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    39   0.050
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    39   0.052
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    39   0.053
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    38   0.053
SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON} cons...    38   0.056
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    38   0.056
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    38   0.056
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    38   0.057
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    38   0.057
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    38   0.058
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    38   0.062
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    38   0.062
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    38   0.063
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    38   0.066
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    38   0.066
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    38   0.066
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    38   0.067
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      38   0.067
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    38   0.069
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    38   0.072
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    38   0.073
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    38   0.074
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    38   0.074
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               38   0.076
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    38   0.077
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    38   0.078
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    38   0.078
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    38   0.079
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    38   0.079
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    38   0.081
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.082
TPHA0F03260 Chr6 (709472..710887) [1416 bp, 471 aa] {ON} Anc_8.6...    37   0.083
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    38   0.084
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    38   0.084
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    38   0.086
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    38   0.086
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    38   0.089
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 37   0.089
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    37   0.089
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    38   0.090
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.091
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    37   0.097
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.099
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    37   0.100
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    37   0.100
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    37   0.10 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.10 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    37   0.11 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.11 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                37   0.11 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    37   0.11 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    37   0.11 
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    37   0.11 
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    37   0.11 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    37   0.11 
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    37   0.12 
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    37   0.12 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.12 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    37   0.12 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.12 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      37   0.12 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    37   0.12 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.13 
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    37   0.13 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.13 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    37   0.13 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    37   0.13 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    37   0.13 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    37   0.13 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    37   0.13 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    37   0.14 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    37   0.14 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    37   0.14 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    37   0.15 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.15 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    37   0.16 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.16 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    37   0.16 
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    37   0.16 
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    37   0.16 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    37   0.17 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    37   0.17 
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    37   0.17 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    37   0.18 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    37   0.19 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    37   0.20 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    37   0.20 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     36   0.21 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    36   0.21 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    37   0.21 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    36   0.22 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    36   0.22 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    36   0.23 
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    36   0.24 
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    36   0.24 
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    36   0.24 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    36   0.24 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    36   0.25 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.25 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    36   0.25 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    36   0.25 
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    36   0.25 
ZYRO0F06556g Chr6 (542397..543476) [1080 bp, 359 aa] {ON} simila...    36   0.25 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    36   0.26 
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    36   0.26 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    36   0.27 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     36   0.27 
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 36   0.27 
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    36   0.27 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    36   0.28 
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    36   0.28 
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    36   0.29 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    36   0.30 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    36   0.30 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    36   0.30 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    36   0.30 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    36   0.32 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    36   0.32 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    35   0.32 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    35   0.33 
KNAG0J01530 Chr10 (281029..282111) [1083 bp, 360 aa] {ON} Anc_8....    35   0.33 
SAKL0H07370g Chr8 complement(641801..642982) [1182 bp, 393 aa] {...    35   0.33 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    36   0.34 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    36   0.34 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    36   0.35 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    36   0.35 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    36   0.35 
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    36   0.36 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    35   0.36 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    35   0.36 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    35   0.36 
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               35   0.36 
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    36   0.36 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    35   0.37 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    35   0.37 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    33   0.37 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    35   0.37 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    35   0.41 
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    35   0.42 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    35   0.43 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   0.43 
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    35   0.44 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    35   0.44 
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    35   0.44 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    35   0.45 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    35   0.46 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   0.46 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    35   0.48 
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    35   0.48 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    35   0.49 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    35   0.53 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    35   0.53 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    35   0.54 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    35   0.55 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    35   0.56 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    35   0.57 
Kwal_26.8662 s26 (888487..889554) [1068 bp, 355 aa] {ON} YPL133C...    35   0.57 
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    35   0.60 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    35   0.60 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    35   0.61 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    35   0.63 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   0.63 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   0.63 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       35   0.65 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    35   0.65 
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               35   0.66 
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   0.66 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    35   0.69 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   0.72 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.72 
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    35   0.73 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    35   0.73 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    35   0.76 
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    35   0.77 
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    35   0.77 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    35   0.77 
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...    35   0.77 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    35   0.78 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    35   0.79 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    35   0.80 
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    35   0.80 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    35   0.81 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    34   0.81 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    35   0.82 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    35   0.82 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    34   0.83 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    34   0.84 
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    34   0.84 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    34   0.85 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    34   0.88 
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    34   0.88 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   0.90 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    34   0.91 
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    34   0.91 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    34   0.91 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    34   0.92 
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   0.93 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    34   0.94 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    34   0.95 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    34   0.96 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    34   0.96 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    34   0.98 
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    34   0.99 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    34   1.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    34   1.0  
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    34   1.0  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    34   1.0  
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    34   1.0  
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    34   1.1  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    34   1.1  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    34   1.1  
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    34   1.1  
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   1.1  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    34   1.1  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    34   1.1  
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    34   1.1  
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    34   1.1  
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    34   1.1  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    34   1.1  
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    34   1.2  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    34   1.2  
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    34   1.2  
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    34   1.2  
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    34   1.2  
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     34   1.2  
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    34   1.2  
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    34   1.2  
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    34   1.2  
CAGL0K06985g Chr11 (681944..683734) [1791 bp, 596 aa] {ON} simil...    34   1.2  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    34   1.2  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   1.3  
Ecym_2265 Chr2 (521409..523064) [1656 bp, 551 aa] {ON} similar t...    34   1.3  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     34   1.3  
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    34   1.3  
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    34   1.3  
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    34   1.3  
NCAS0D00890 Chr4 (166411..168324) [1914 bp, 637 aa] {ON} Anc_2.3...    34   1.3  
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    34   1.4  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     33   1.4  
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    34   1.4  
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    34   1.4  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...    34   1.4  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    34   1.4  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    33   1.5  
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    33   1.5  
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    33   1.5  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    33   1.5  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   1.5  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    33   1.5  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    33   1.6  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    33   1.6  
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    33   1.6  
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    33   1.6  
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     33   1.6  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    33   1.6  
ACR107W Chr3 (544402..545556) [1155 bp, 384 aa] {ON} Syntenic ho...    33   1.6  
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    33   1.7  
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    33   1.7  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   1.8  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    33   1.8  
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    33   1.8  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     33   1.8  
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    33   1.9  
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    33   1.9  
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    33   1.9  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    33   1.9  
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    33   1.9  
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               33   2.0  
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    33   2.0  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               33   2.0  
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    33   2.1  
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    33   2.1  
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    33   2.1  
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    33   2.2  
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    33   2.2  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    33   2.2  
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    33   2.2  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    33   2.3  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    33   2.3  
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    33   2.3  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    33   2.3  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   2.4  
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    33   2.4  
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    33   2.5  
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    33   2.5  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    33   2.5  
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    33   2.5  
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    33   2.5  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    33   2.5  
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    33   2.6  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    33   2.6  
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       33   2.6  
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    33   2.6  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    33   2.7  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    33   2.7  
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    33   2.7  
SAKL0D05236g Chr4 complement(414228..415826) [1599 bp, 532 aa] {...    33   2.7  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    33   2.7  
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    33   2.7  
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    33   2.8  
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    32   2.8  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    33   2.8  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    33   2.8  
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    33   3.0  
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    33   3.2  
ZYRO0G10450g Chr7 (842921..844840) [1920 bp, 639 aa] {ON} conser...    32   3.2  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    33   3.2  
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    33   3.2  
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    33   3.2  
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    33   3.2  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    32   3.2  
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    32   3.3  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    33   3.3  
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    32   3.3  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    33   3.3  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    32   3.4  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...    32   3.4  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    32   3.4  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    32   3.4  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    32   3.5  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 32   3.5  
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    32   3.5  
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    32   3.5  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     32   3.6  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    32   3.7  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    32   3.9  
SAKL0B10648g Chr2 complement(917905..920103) [2199 bp, 732 aa] {...    32   3.9  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    32   4.0  
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    32   4.6  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    32   4.9  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    32   5.0  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    32   5.3  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    32   5.3  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    32   5.3  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    32   5.4  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    32   5.6  
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    32   5.6  
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    32   5.7  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     32   5.8  
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    32   5.8  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    32   5.9  
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    32   6.0  
AFL200W Chr6 (60109..61899) [1791 bp, 596 aa] {ON} Syntenic homo...    32   6.2  
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    32   6.3  
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    32   6.6  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    32   6.9  
SAKL0C13200g Chr3 (1167325..1168065) [741 bp, 246 aa] {ON} simil...    31   7.0  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    32   7.1  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    32   7.2  
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    32   7.3  
TPHA0N01110 Chr14 (232891..233982) [1092 bp, 363 aa] {ON} Anc_6....    31   7.4  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    32   7.4  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    31   7.6  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               31   7.7  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    31   8.0  
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    31   8.2  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    31   8.4  
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     31   8.5  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    31   8.7  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    31   8.7  
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    31   8.7  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               31   9.1  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    31   9.1  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    31   9.3  
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    31   9.4  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    31   9.6  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    31   9.6  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    29   9.7  
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    31   9.8  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    31   9.9  

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/542 (97%), Positives = 529/542 (97%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60
           MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60

Query: 61  DETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLEL 120
           DETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLEL
Sbjct: 61  DETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLEL 120

Query: 121 RSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVDPEQ 180
           RSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVDPEQ
Sbjct: 121 RSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVDPEQ 180

Query: 181 LAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTFCRI 240
           LAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTFCRI
Sbjct: 181 LAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTFCRI 240

Query: 241 PTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRR 300
           PTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRR
Sbjct: 241 PTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRR 300

Query: 301 TTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALAQLIP 360
           TTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALAQLIP
Sbjct: 301 TTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALAQLIP 360

Query: 361 QDCVXXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVLQIID 420
           QDCV             VHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVLQIID
Sbjct: 361 QDCVNANATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVLQIID 420

Query: 421 IGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQVLG 480
           IGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQVLG
Sbjct: 421 IGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQVLG 480

Query: 481 THIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPSDTLN 540
           THIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPSDTLN
Sbjct: 481 THIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPSDTLN 540

Query: 541 FM 542
           FM
Sbjct: 541 FM 542

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/545 (82%), Positives = 487/545 (89%), Gaps = 3/545 (0%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPR- 59
           M SSGSN QPYKRQRVRKACVPCRERKRKCNGKSPCEMC+AYGY CHYT+ DG   S R 
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60

Query: 60  --VDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLG 117
             V+E P+ T NRPY   +I+ N   S D+Q+VTN NIID  KSRYTIQHSAVAFPR LG
Sbjct: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120

Query: 118 LELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVD 177
           LELRSTNPPRLH FAWHCGIRPEE P+ H+ LS +VTKEEYYRISKVYFSVVHPIFD+VD
Sbjct: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180

Query: 178 PEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTF 237
           PEQL KNVE+YW+GD +  EYGAVIAGVIALGSFFLGSLGHPREMD++QYAKGILDDPTF
Sbjct: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240

Query: 238 CRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVP 297
            RIP+VEQ+SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLHHEIDREDL +T+NVP
Sbjct: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300

Query: 298 LRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALAQ 357
           L+RTTEVSEHTRRLFW AWSINTILSYDYGRSSVTLNRITCK VKET+GN+TV+LV+LAQ
Sbjct: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360

Query: 358 LIPQDCVXXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVLQ 417
           L+PQ+ V             VH+SP+AHPFLSLTK+DICLS YRRLRLLNHILDKSVV Q
Sbjct: 361 LVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVSQ 420

Query: 418 IIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 477
           IIDIGNTAL+AAYALVK+DQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ
Sbjct: 421 IIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 480

Query: 478 VLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPSD 537
           VLGTHIA+EAQKTAKLLLEDS+KKKRQEIQQLE+ATHQRS  ETTHLLDIDWD LLDPSD
Sbjct: 481 VLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPSD 540

Query: 538 TLNFM 542
           TL+FM
Sbjct: 541 TLSFM 545

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/546 (84%), Positives = 491/546 (89%), Gaps = 4/546 (0%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60
           M S GS + P+KRQRVRKACVPCRERKRKCNGKSPCEMC+AYGY CHY D    S SP+V
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60

Query: 61  D---ETPYGTDNRPYSLPNILRNE-ARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCL 116
               ET   T++RP+ LP I RNE  + ++ QNVT+QNI+DP KSRYTIQHSAVAFPRCL
Sbjct: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120

Query: 117 GLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVV 176
           GLELRSTNPPRLHSFAWHCGIRPEENPNSH+LLS LVTKEEYYRISKVYFSVVHPIFDVV
Sbjct: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180

Query: 177 DPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPT 236
           +PEQLAKNVE+YWDGDVK LEYGAVIAGVIALGSFF+GSLGHPREMD+VQYAKGILDDPT
Sbjct: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240

Query: 237 FCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNV 296
           F RIPTVEQVSAWVLRTIYLRATSRPHVAWLASC+TIHLSEAIGLHHEIDRED+ +++NV
Sbjct: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300

Query: 297 PLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALA 356
           P +RTT VSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCK VKET+GN T HLVALA
Sbjct: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360

Query: 357 QLIPQDCVXXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVL 416
            LIPQD V             VH+SPNAHPFLSLTK DICLSLYRRLRLLNHILDK+VVL
Sbjct: 361 HLIPQDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420

Query: 417 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 476
           QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVA AM+TLDNIT
Sbjct: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480

Query: 477 QVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPS 536
           Q+LGT IA+EAQKTAKLLLEDSMKKKRQEIQQLE+ATHQRS +ETTHLLDIDWD LLDPS
Sbjct: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540

Query: 537 DTLNFM 542
           DTLNFM
Sbjct: 541 DTLNFM 546

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/546 (79%), Positives = 470/546 (86%), Gaps = 4/546 (0%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSP-- 58
           M SS  N   YKRQRVRKACVPCRERKRKCNGKSPCEMCI+YGY CHY D D SS+S   
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 59  --RVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCL 116
             ++DE P+  +++P++  NI  NE  SVD Q VTNQ+I DP+KSRYTIQHSAVAFPRCL
Sbjct: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120

Query: 117 GLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVV 176
           GLELRS NPPRLHSFAWHCGIRPEENP+SH+LLS L+TKEEYYR+SKVYFSVVHPIFDVV
Sbjct: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180

Query: 177 DPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPT 236
           DP+QLAKNVE YW G++   EYGAVIAGV+ALGSFFLGS+GHPREMDVVQYAKGILDDPT
Sbjct: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240

Query: 237 FCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNV 296
           F RIPTVE VSAWVLRTIYLRATSRPHVAWLASC+TIHLSEAIGLH +ID+ +  MTS V
Sbjct: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300

Query: 297 PLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALA 356
            LRRT   +EHT+RLFWCAWSINTILSYDYGRSSV LNRITCK V+ETEG++T+HLVALA
Sbjct: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360

Query: 357 QLIPQDCVXXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVL 416
           Q IPQ  V             +HKSPNAHPFL LTK DICLSLYRRLRLLNH+LDKSVVL
Sbjct: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420

Query: 417 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 476
           QIIDIGN ALSAAYALVKL Q+WWNVLSTSFQYVCVLLAIDTPESLSHVAAAM+TLDNIT
Sbjct: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480

Query: 477 QVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPS 536
           +VLGTHIA EAQKTAKLLLEDSMKKKRQEIQQLE+ATH RST E T+ LDIDWD L DPS
Sbjct: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540

Query: 537 DTLNFM 542
            TL FM
Sbjct: 541 GTLGFM 546

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/553 (54%), Positives = 387/553 (69%), Gaps = 19/553 (3%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDG------S 54
           MV++G++    KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y DVDG       
Sbjct: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSFYEK 60

Query: 55  STSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPR 114
             SP+   +P     +    P++L        +   + + I DP KSRY   HSAVAFPR
Sbjct: 61  RPSPKQSTSPSTIQKKEVERPSML--------SPCSSERGIFDPSKSRYMSLHSAVAFPR 112

Query: 115 CLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFD 174
            LGLEL+S NPP LHSFAW+CGIRPEEN  SH  L+ +++K++  R + VYF VVHP+FD
Sbjct: 113 YLGLELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFD 172

Query: 175 VVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDD 234
           ++DP Q  ++++ YW G   +  + AVI GV+ALGSFF  + GH RE+D+VQYAK IL+D
Sbjct: 173 IIDPSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILED 232

Query: 235 PTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTS 294
           PTF   P++EQ+SAWVLR+IYLRAT+RPHVAWLASC+T+HL EA  LHHE+D+ +L   +
Sbjct: 233 PTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRN 292

Query: 295 NVPL-RRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLV 353
           + PL  R   V E  RRLFWCAW INTI+SY+YGRS VTLN+I+CK +KE+  N+T  +V
Sbjct: 293 DAPLPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMV 352

Query: 354 ALAQLIP--QDCV--XXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHI 409
            LA++IP    C                V+K+ + HPFLSLTK+D+C S YRRLRLLNH+
Sbjct: 353 ELARMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHV 412

Query: 410 LDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAM 469
           LD+SVVLQII+IG +ALSAA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VAAA 
Sbjct: 413 LDRSVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAK 472

Query: 470 RTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDW 529
              D+I ++L THIA EAQ TAKLLL DSMKKK++EI  LE A  +     T +  DIDW
Sbjct: 473 SIFDSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDW 532

Query: 530 DVLLDPSDTLNFM 542
           D LLDPS++LN M
Sbjct: 533 DALLDPSNSLNLM 545

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/554 (51%), Positives = 372/554 (67%), Gaps = 13/554 (2%)

Query: 2   VSSGSNSQPYK-RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSST--SP 58
           +S+G  S P+K RQR RKACVPCR+RKR+C+G +PC MC++Y Y CHY +    +T  +P
Sbjct: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60

Query: 59  RVDETPYGTDN------RPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAF 112
            + E P  T +      R  + P  +R +      Q   +Q + D  KSRY    SAVAF
Sbjct: 61  LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAF 120

Query: 113 PRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPI 172
            R LG+EL+S NPP LHSFAW+CG+R EE  N+H  L  L+TKEE +  +++YFS +HP+
Sbjct: 121 ARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV 180

Query: 173 FDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGIL 232
           FDVVDPE   K+VE YW+   K+  +GAV+ G+IALGS F G  GHPRE+++VQYAK +L
Sbjct: 181 FDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVL 240

Query: 233 DDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVM 292
           +DPTF R+P+ EQVSAWVLRT+YLRAT+RPH AWLASC+TIHL+EA  LHHE++  +L  
Sbjct: 241 EDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTA 300

Query: 293 TSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHL 352
                  RT +++E  RRLFWCAWSIN+ILSYDYGRSS +L  I+CK   +++GN+T  L
Sbjct: 301 NDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQL 360

Query: 353 VALAQLIP----QDCVXXXXXXXXXXXXXVHKSPNAHPFLSLTKSDICLSLYRRLRLLNH 408
           V LA +IP    +                V+++P+ H FLSL K+D+C S YRRLRL N+
Sbjct: 361 VDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNY 420

Query: 409 ILDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAA 468
            LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA A
Sbjct: 421 TLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKA 480

Query: 469 MRTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDID 528
               D I   L TH+A EAQ T KLLL+DS+KKKRQE+  LE A    +  E     +ID
Sbjct: 481 KNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEID 540

Query: 529 WDVLLDPSDTLNFM 542
           WDVLLDPS  L+ M
Sbjct: 541 WDVLLDPSHALHLM 554

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 136/341 (39%), Gaps = 77/341 (22%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT--------------DVDG----- 53
           R RV KAC+ CR++KR+C+GKSPC  C      C YT              DV       
Sbjct: 25  RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTARPRSHSIAFANDVSNDIHLI 84

Query: 54  -SSTSPRVDETPYGTDNRPY-SLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVA 111
            S+TS R           PY +L   L + A     QN++ + +I  + S    ++  ++
Sbjct: 85  DSTTSSRSHSPKLSDKVNPYKTLIERLYSGASLESLQNLSREQLIKTLNSEEVNKNDTIS 144

Query: 112 F-PRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVH 170
             PR + L+L       L +++  C                 V    Y+R S V   ++ 
Sbjct: 145 LPPRDIALKL------ILKTWSSAC-----------------VLFRFYHRPSLV--KILD 179

Query: 171 PIFDV-VDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLG--SLGHPREMDVVQY 227
            ++++  +P+             +K  +  ++I  V+A+G  F    +  + R ++    
Sbjct: 180 SLYELGTNPKT------------IKQRKAESLIFAVLAVGELFSQEENNSYSRGLNYFNK 227

Query: 228 AKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDR 287
           AK ++D   F  I  +  + A  + TI+L+ +      +    I + ++    LH +   
Sbjct: 228 AKTLID---FKDINDIHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHRK--- 281

Query: 288 EDLVMTSNVPLRRTTEVSEHT-RRLFWCAWSINTILSYDYG 327
                     L   T + + T +RLFW  + ++  ++   G
Sbjct: 282 --------PSLTGPTAIEDETKKRLFWSIYKVDIYMNCTLG 314

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
           R RVRKAC  C+ RK KCNG+ PC  C  +G  CHY  V+   T P       G      
Sbjct: 25  RIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHYK-VE-PVTRPASAALKAGAPGPAG 82

Query: 73  SLPNILRNEARSVDAQN---VTNQNIIDPIKSRYTIQHSAVAFPRCLGLELRSTNPPRL 128
           +LP + +  A S  A      +      P K R+  +H  +  P  LG  L S+ PP L
Sbjct: 83  TLPALSQVPAPSDFATGPAPASPWQRFSPGKYRFHRRHQNLV-PYYLGQALISSLPPAL 140

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 10/87 (11%)

Query: 242 TVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRRT 301
           + E + AW+L  +YLR   R    W A    + +   + L+           +  P + T
Sbjct: 303 SFELIQAWLLAAVYLRTCHRQVSCWQALSRAVQMCNGMSLY----------LNRFPEKHT 352

Query: 302 TEVSEHTRRLFWCAWSINTILSYDYGR 328
                  R  +W  + ++ ++S+  GR
Sbjct: 353 AYDECRARNCYWACFVLDRLISFQMGR 379

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 5  GSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTS 57
          GS+ QP KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y      S S
Sbjct: 22 GSSQQP-KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTYNQPSKRSNS 73

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYAC----HYTDVDGSSTSP 58
          R +V  AC+ CR+RK KC GK PC  CI+Y   C     Y  +DG +T P
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVFLRKYLSLDGDTTQP 57

>Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)
          [168 bp, 56 aa] {OFF} YOR380W (HSP)
          Length = 56

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD-VDGSSTSPRVDETPYGT 67
          +RV+  CV  RERK+  N +  CEMC  +GY C+Y D  + S    +V +T  GT
Sbjct: 1  ERVQNICVQIRERKKTYNDRFSCEMCFGHGYVCNYIDSYESSVPGVQVAKTLSGT 55

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 27/46 (58%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTS 57
          K QRVR AC  CR +KRKC+G+ PC  C    Y C Y +    ST+
Sbjct: 27 KEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIYKNASHGSTT 72

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY------TDVDGSSTSPRV--DET 63
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y      ++   S+ SP+    + 
Sbjct: 12 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRSNTSASTQSPQSANQQR 71

Query: 64 PYGTDNRPYSLPNI 77
          P+G  N   S  NI
Sbjct: 72 PHGPSNGSGSSLNI 85

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+GK PC  C  Y Y C Y
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTY 42

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 25/43 (58%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGS 54
          +R +V KAC  CR RK KCNG  PC  C  YG  C YTD   +
Sbjct: 23 RRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTDAKST 65

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY--------TDVDGSSTSPRVDET 63
           KR+RV +AC  CR++K KC+G++PC  C  Y Y C Y        T+ + S  S ++++T
Sbjct: 64  KRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSYDQPVKKNNTNHNTSGFSKKLNQT 123

Query: 64  PYGTDN 69
              ++N
Sbjct: 124 VTSSNN 129

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 16/100 (16%)

Query: 2   VSSGSNSQP--YKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY----TDVDGSS 55
           ++S +   P   KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y    T  + S+
Sbjct: 46  INSNTQGNPIQLKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPSTRRNNSN 105

Query: 56  TSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNI 95
           +S     TP  T    +S+ N+       +  Q+ TN NI
Sbjct: 106 SS-----TPISTMVNSHSMTNLTM-----MSNQSNTNSNI 135

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSP 58
          R++V KAC  CR RK KC G  PC  C AY   C + D+   S++P
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDLKEDSSNP 75

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 2  VSSGSNSQPYK----RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTS 57
          +++ +N Q +K    R +VR+AC  CR+RK KC GK PC  C AY   C Y++       
Sbjct: 1  MNTTNNQQEHKVTKPRIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIYSEKTTKRKK 60

Query: 58 PRVDETPYGTDNRPYSLPNILRN 80
              + P  T+  P S  N L N
Sbjct: 61 RTTKKKPSVTN--PNSFINALSN 81

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 7  NSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60
          N+   +R +V KAC  CR RK KCNG +PC  C  Y   C Y+  D +S + ++
Sbjct: 15 NTAKKQRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIYSIPDSNSQTDKL 68

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 46

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD--GSSTSPRV 60
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y      G S +P+ 
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRGGSCAPQT 57

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDN 69
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y      S        P  T+N
Sbjct: 31 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRSLQHLTTYAPSKTNN 88

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query: 4   SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDET 63
           +G+N     R R  +ACV CR+RK +C+G++PC +C    + C Y D    ++S    E 
Sbjct: 42  AGTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY-DRPPRNSSVFDREV 100

Query: 64  PYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPI 99
              + + P S+P+    + RS     +  +NI++ I
Sbjct: 101 SDDSSSYPQSIPHQEGEDKRSSTC-TINYKNIVETI 135

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD 68
          QP KR RV +AC  CR+RK +C+G+ PC  C  Y Y C Y     +    R  E+    D
Sbjct: 22 QP-KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTYNPTSRTRKRVRAKESAQPDD 80

Query: 69 N 69
          +
Sbjct: 81 D 81

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          + R+RV KAC  CR +K KCNG+  C  C+ YG  C YT
Sbjct: 7  HSRRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTYT 45

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDG 53
          M  SG   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C +T   G
Sbjct: 26 MSLSGRVRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTSRQG 76

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSS 55
          SG   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C +T   G +
Sbjct: 29 SGKVRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTTRQGGN 78

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          Q  KR++V +AC  CR++K KC+G  PC  C  Y Y C Y 
Sbjct: 9  QEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTYN 49

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 2  VSSGSNSQPY---KR--QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDV 51
          ++  S ++PY   KR   RV +AC  CR+RK KCNG  PC  CI     CHY  +
Sbjct: 1  MAGSSITKPYTYNKRSSHRVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHYDGI 55

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
           R RVRKAC  C+ RK KC+G  PC  C+ +G  C Y
Sbjct: 9  NRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKY 45

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 220 REMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAI 279
           RE  + +YA  ++   TF    + E + +W+L T Y R   R    W A    I++   +
Sbjct: 342 REEAMFKYAYSVITQLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNGM 400

Query: 280 GLHHEIDREDLVMTSNVPLRRTTEVSEHTR--RLFWCAWSINTILSYDYGR 328
            L+  ++R            RT    + +R    FW  + ++ ++S+  GR
Sbjct: 401 SLY--LNR----------FPRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
          YJL206C (REAL)
          Length = 833

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          +G+N     R R  +ACV CR+RK +C+G++PC +C    + C Y
Sbjct: 18 AGTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY 62

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          R AC+ CR+R+RKC+ + PC +CI +G  C +T  D
Sbjct: 16 RLACITCRQRRRKCDMQEPCSICIKFGTRCVFTGED 51

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 5  GSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          G++ Q  K++++ +AC+ CRER  KC G  PC+ C+   + C +++
Sbjct: 44 GNSQQLGKKRKITRACIRCRERHIKCPGNDPCQKCLEANHICKFSE 89

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
          R +V  ACV CR+RK KC GK PC  CI+Y   C +  +  + T  +    P  T   P 
Sbjct: 8  RSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVF--LKKNLTQEKDTSLPLATTTVPR 65

Query: 73 SLPNILRNEARSVDAQNV 90
          S  +   NE  S DA ++
Sbjct: 66 SSSH--HNEKVSADAHHL 81

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 26/43 (60%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSS 55
          R +V KAC  CR+RK KCNGK PC  C  Y   C +T   GS+
Sbjct: 36 RSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTFTTRHGSN 78

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSS 55
          SG   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C ++   G +
Sbjct: 32 SGKIRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFSTRQGGA 81

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV 60
          R +V +AC  CR RK KC+G  PC  CI Y   C +T  D  ++  ++
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIFTSSDSINSKKKI 80

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDV 51
          R+RV KAC  CR +K KCNG+ PC  C  +   C YT V
Sbjct: 20 RKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAYTHV 58

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
          PDR3Transcriptional activator of the pleiotropic drug
          resistance network, regulates expression of ATP-binding
          cassette (ABC) transporters through binding to
          cis-acting sites known as PDREs (PDR responsive
          elements); post-translationally up-regulated in cells
          lacking a functional mitochondrial genome
          Length = 976

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          R +V  ACV CR+RK KC GK PC  CI+Y   C +
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVF 43

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1
          Length = 595

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 142/366 (38%), Gaps = 40/366 (10%)

Query: 6   SNSQPYKRQRVRK-ACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETP 64
           S S P +    RK AC  CR+R+RKCN + PC  C+ YG  C   D D   T        
Sbjct: 4   SGSSPDEPSNSRKLACQNCRKRRRKCNSEIPCSNCVKYGIECVPVDQDLRRTRYTASYVK 63

Query: 65  YGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLELRSTN 124
              D+  + L   L+ +AR VD +N   + I+D +     +       P     E  +T+
Sbjct: 64  ELEDHVEH-LEKTLK-KAREVDDKN-EKEKILDSVPIVNAVPSPGQDSPDIQLPETSATS 120

Query: 125 PPRL--------HSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPI-FDV 175
            P +        +S +     R  E     + +  L       R   ++F  ++P  F  
Sbjct: 121 VPPVGTNSIYPTNSLSISKKKRTPEQLKILVNMRMLSRSPFILRSLSLFFKWLYPGHFMF 180

Query: 176 VDPEQLAKNVERYWDGDVKMLEY---GAVIAGVIALGSFFLGSLGH--PREMDVVQYAKG 230
           +  E         + GD     Y     ++  + ALGS    S G    +  +  Q AK 
Sbjct: 181 IHRETFLSA----FFGDESAKSYYCSEELLYAIAALGSKLSSSDGELFGKSEEYYQTAKN 236

Query: 231 I-------LDDPTFCRIPTVEQ---VSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIG 280
                   LD  +F  + +  +   +   +    Y  A     +AW  S +   ++  IG
Sbjct: 237 KALKLVFQLDGNSFAELTSSNKLAFIQTLLCLAFYDVAAGENAMAWYLSGLAFRIAHEIG 296

Query: 281 LHHEIDREDLVMTSNVPLRRTTEVSEHTR-RLFWCAWSINTILSYDYGRSSVTLNRITCK 339
           LH   +  + V    +     +++    R R++W  +  + ++S  +GRS+    R++  
Sbjct: 297 LHLNPNAWNDVYEDEL-----SDLDFEVRSRIYWGCYIADHLISVLFGRSTTL--RLSNS 349

Query: 340 SVKETE 345
           +V ET+
Sbjct: 350 TVPETD 355

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2.565
           YMR019W
          Length = 608

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/345 (20%), Positives = 121/345 (35%), Gaps = 70/345 (20%)

Query: 14  QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD-------GSSTSPRVDETPYG 66
           +RVR AC  C+ RK KC+GK PC  C      C Y  V         +S  PR +  P G
Sbjct: 7   RRVRAACAVCQRRKLKCDGKQPCSRCARTDRICRYAKVQVQTQMPARASVVPRAN-VPVG 65

Query: 67  ---------------------TDNRP-YSLPNILRNEARSVDAQNVTNQNIIDPIKSRYT 104
                                 D  P Y   ++L     SV    V  +++  P    Y 
Sbjct: 66  LGRGSPWLGFSFSKFRFHRRYQDVLPFYFCESVLAQLPESV----VAAEDLQLPSVQNYG 121

Query: 105 IQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKV 164
              +  AF     L+  +T PP          +RP                     + + 
Sbjct: 122 WNLAGGAF-LAFALQPSATRPPLRE-------LRP---------------------LVQH 152

Query: 165 YFSVVHPIFDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDV 224
           YF  V+P+F +V+        +   D +      G ++A  I    +  G      E  +
Sbjct: 153 YFDHVNPLFSIVNERVFWSQWDSAADANSLFNAIGYLMA--ITAERYRCGPPPRVDETAL 210

Query: 225 VQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHE 284
             ++  ++ + +F    +VE + +W+L   YLR   R    + A    + +   + L+ E
Sbjct: 211 FNHSYAVVSEFSF-EWESVELIQSWLLIAAYLRCCYRQTSCYAALARAVAMCRGMSLNLE 269

Query: 285 IDREDL-VMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
              E +           +T    H    FW  ++++ I S+  G+
Sbjct: 270 AKPEQVDAEGEQTGALHSTGKYYHC---FWTVYTVDKIFSHQLGK 311

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
          (REAL)
          Length = 1010

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          R +V  ACV CR+RK KC GK PC  CI+Y   C +
Sbjct: 49 RSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVF 84

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 26/43 (60%)

Query: 6  SNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          S S   +R RV+KAC  C+ RK KC+G SPC  CI +   C Y
Sbjct: 2  SKSTTKQRLRVQKACDICKRRKVKCDGLSPCSNCIRHNVDCTY 44

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 48/117 (41%), Gaps = 21/117 (17%)

Query: 218 HPREMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSE 277
           H +E  +  Y+  I+   TF    + E + +W+L T YLR   R    W A    + + +
Sbjct: 311 HDKEGKLFNYSYSIVSKLTF-EWESFELLQSWLLITFYLRTCHRQIACWSALGKAVTMCK 369

Query: 278 AIGLHHEIDREDLVMTSNVPLRRTTEVSEHTRRL-----FWCAWSINTILSYDYGRS 329
            + LH               L +  E+     R+     FW  + ++ ++S+  GR+
Sbjct: 370 GMSLH---------------LNQLPEIHSENDRIKAWNCFWAVFIMDKLISFQIGRA 411

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785
          bp, 594 aa] {ON} complement(32885..34586,34699..34781)
          [1785 nt, 595 aa]
          Length = 594

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 5  GSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          GS+S   KR   + AC  CR+R+RKCN + PC  CI +G  C   ++D
Sbjct: 17 GSDSSGLKR---KLACQGCRKRRRKCNFEVPCSNCIKFGSECVSVNLD 61

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON}
          weakly similar to uniprot|P50104 Saccharomyces
          cerevisiae YMR019W STB4 Protein that binds Sin3p in a
          two- hybrid assay
          Length = 687

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 5  GSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSS 55
          G ++   +R RVRKAC  C++RK KC+G  PC  C      C Y   D +S
Sbjct: 13 GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTAS 63

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 35/87 (40%), Gaps = 10/87 (11%)

Query: 242 TVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRRT 301
           + E + +W+L   YLR   R    W A    I + + + L+           +  P R T
Sbjct: 304 SFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALY----------LNRFPQRHT 353

Query: 302 TEVSEHTRRLFWCAWSINTILSYDYGR 328
                  +  FW  + ++ ++S+  GR
Sbjct: 354 LYEETKVKNCFWSCFIMDKVISFQMGR 380

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          ++G  ++P  R +VR+AC  CR+RK KC G  PC  C AYG  C ++
Sbjct: 20 TAGKINKP--RNKVRRACNNCRKRKIKCTGLHPCASCEAYGCPCIFS 64

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          + G     ++R++   AC  CR RK KC GK PC  C AY   C Y D
Sbjct: 11 ADGVQKPAHRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEYVD 58

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
          Putative protein of unknown function; similar to
          transcriptional regulators from the Zn[2]-Cys[6]
          binuclear cluster protein family; mRNA is weakly cell
          cycle regulated, peaking in S phase; induced rapidly
          upon MMS treatment
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          +G+N     + R  +AC+ CR+RK +C+G  PC +C    Y C Y
Sbjct: 31 AGTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKY 75

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
           Anc_2.565
          Length = 759

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 81/405 (20%), Positives = 146/405 (36%), Gaps = 101/405 (24%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD--- 68
           +R RV++AC  C+ RK KC+G  PC  CI     C Y +   ++T    ++ P   D   
Sbjct: 26  QRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYNN-SSNTTKKEPNDPPADIDAAE 84

Query: 69  NRPYSLPNILR---NEARS---------------------VDAQNVTNQNIIDP------ 98
           +   S PN+L    N+ +S                      D  ++ N + I P      
Sbjct: 85  SSTMSPPNLLHPQLNKEQSEDNMAVLLLDLAKKLKQKKNIKDTTSLGNDDTIPPRVTKDT 144

Query: 99  ---------IKSRYTIQHSAVAFPRCLGLELRSTNP-----------PRLHSFAWHCG-- 136
                     K R+  ++  V  P   G  L S  P           PR+ ++AW+    
Sbjct: 145 NSPWQSFSYDKYRFHRRYQNV-LPNKFGKSLLSALPPQLIQENNLETPRIQNYAWNMSGG 203

Query: 137 --IRPEE--NPNSHILLSGLVTKEEYYRISKV---YFSVVHPIFDVVDPEQLAKNVERYW 189
             ++ E+    NS +L            ++K+   YF  ++  + ++  E         +
Sbjct: 204 HYLKFEQMHENNSSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQFNNGF 263

Query: 190 DGDVKMLE-----YGAVIAGVIALGSFF--------LGSLGHPREMDVVQ---------- 226
               K        + +++  V+ +   F        L  L  P+E ++V           
Sbjct: 264 LQQGKQNNKSAKLFTSMLYLVLTISIRFYEGLPASSLDQLFTPQEQELVHRQRILRNEEY 323

Query: 227 ---YAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHH 283
              +A  I+   TF    + E + +W+L   YLR   R    W A    I++   + L+ 
Sbjct: 324 MFGHAYSIVSKLTF-EWESFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNGMSLY- 381

Query: 284 EIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
            ++R         P   +T         FW  + ++ ++S+  GR
Sbjct: 382 -LNR--------FPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGR 417

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 4   SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDET 63
           +G+N     R R  +AC+ CR+RK +C+G+ PC  C      C Y   D     P V   
Sbjct: 51  AGTNELKPTRGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTY---DRPPRKPPVFGR 107

Query: 64  PYGTDNRPYSLPNILRNEARSVDAQNVTN-QNIIDPI 99
               DN  YS     + + R+  +Q+  + ++I++ I
Sbjct: 108 ELSDDNSLYSQGTSQQGDVRTTSSQSTIDYRSIVEAI 144

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 7  NSQPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          N QP KRQ R   AC+ CR+R  KC G +PC+ C+     C Y
Sbjct: 20 NKQPQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEY 62

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+RV +AC  CR++K KC+ + PC  C  Y Y C Y
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTY 46

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR+R+ +AC  CR++K KC+ + PC  C  Y Y C Y
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTY 50

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 72/337 (21%), Positives = 130/337 (38%), Gaps = 55/337 (16%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNR-P 71
           R +V+ AC  C+ERK +C+G+SPC  CI     C Y           ++  P     +  
Sbjct: 29  RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYV----------MNMKPLKKKRKVS 78

Query: 72  YSLPNILRNEAR-------SVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLELRSTN 124
           +   N+ +NE +       S +AQ V  + +   +     +  S +     + +   S  
Sbjct: 79  FIRSNLSKNELKGGSSVISSQNAQGVDYKKVFHSLFPDVDLSQSNLCTESLISIVKSSNE 138

Query: 125 PPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVH-PIF-DVVDPEQLA 182
            P+    +     R    P   I L+ L++K   +  + + F   H P F  VV+     
Sbjct: 139 CPQTQVPSSR---RKLILPPKQIALT-LISKS--WDSACLLFRFYHRPTFIKVVESLYTV 192

Query: 183 KNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLG----HPREMDVVQ--------YAKG 230
           KN E Y +   + L    ++  VIA+G+ F  S      H + M+  Q         AK 
Sbjct: 193 KNFE-YSEKQKRFL---PLVYSVIAVGALFCKSYAETTDHKQMMEFFQDEGHKYFIEAKC 248

Query: 231 ILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDL 290
           +LD         VE + A  + TI+L+ ++     +    I +  +     H +   ++L
Sbjct: 249 LLDP---INSQDVESLQAIFMLTIFLQCSANLSSGYTYIGIALRTAIKQNFHRKTSLQNL 305

Query: 291 VMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYG 327
            +             E  ++LFW  +  +  ++   G
Sbjct: 306 NLLEQ----------ETIKKLFWTIYKTDIYMNCILG 332

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          +R RV++AC  C++RK KC+G  PC  CI     C YT
Sbjct: 17 QRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTYT 54

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 42/108 (38%), Gaps = 11/108 (10%)

Query: 221 EMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIG 280
           E  +  Y+  I+   TF    + E + +W+L T YLR   R   +W A    I+L   + 
Sbjct: 380 EDSMFNYSYSIISKLTF-EWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMS 438

Query: 281 LHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
           LH           +  P   +          FW  + I+  +S+  GR
Sbjct: 439 LH----------LNEFPHIHSKYEESKLFHCFWACFIIDKFISFQLGR 476

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 32/127 (25%)

Query: 10  PYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDN 69
           P  ++RV KAC  CR+ K KC+G+ PC  C+     C Y++                   
Sbjct: 12  PTIKRRVSKACDACRKSKTKCDGERPCSRCLKENKLCTYSN------------------- 52

Query: 70  RPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVA-----FPRCLGLELRSTN 124
                 NI   E++    + + NQ  +D +++R ++   A++     F RC+   L   +
Sbjct: 53  -----SNIGYAESK---CKKLYNQEYVDLLETRNSLLTKALSYLFRQFDRCVDSGLVQIH 104

Query: 125 PPRLHSF 131
           P R   F
Sbjct: 105 PERFSEF 111

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDV 51
           R+RV KAC  CR +K +CNG+ PC  C  +   C YT V
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTYTHV 112

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 13/91 (14%)

Query: 243 VEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRRTT 302
           V  + A +L ++YL  +  P   +L     I L + +GLH    RE  +           
Sbjct: 379 VGYMQAIILLSVYLENSPVPQTTYLQLSFAIRLGQTLGLHQ---RESYM--------HIK 427

Query: 303 EVSEHTRRL--FWCAWSINTILSYDYGRSSV 331
           +++E  RRL  +W  +  + +LS   GR S+
Sbjct: 428 DIAERNRRLNVWWWCYRYDKVLSVCTGRPSL 458

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          S  N     R++V +AC  CR++K KC+G  PC+ C  YG  C Y+
Sbjct: 39 SNGNGTGKPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYS 84

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          + SG   +P  R +V +AC  CR RK KC GK PC  C AY   C Y
Sbjct: 1  MESGRVRRP--RNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLY 45

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (57%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDG 53
           +V KAC  CR RK KC GK+PC  C AY   C Y+   G
Sbjct: 57 NKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQRG 96

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          +R  +AC+ CR RK KC+G+SPC  C  Y  AC Y
Sbjct: 12 ERAARACLNCRRRKVKCSGQSPCANCRNYNCACTY 46

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          R++V KAC+ CR RK KC G  PC  C AY   C + +
Sbjct: 10 RKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVFDE 47

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920
          aa] {ON} YMR019W (REAL)
          Length = 920

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          V++ S      R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 39 VAAASKENSRGRLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRY 85

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 221 EMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIG 280
           E  + +YA  I+   TF    + E + +W+L   Y R   R    W A    +++   + 
Sbjct: 460 EERMFKYAYSIISTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 518

Query: 281 LHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
           L+           +  P   +T         FWC + ++ ++S+  GR
Sbjct: 519 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 556

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSP 58
          +V +AC  CR RK KC GK PC  C AY   C Y+   G+   P
Sbjct: 23 KVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGNGIIP 66

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          ++ SN     R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 15 TAASNENSKTRLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRY 60

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query: 217 GHP--REMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIH 274
           G P   EM + +YA  I++  TF    + E + +W+L   Y R   R    W A    ++
Sbjct: 430 GKPFIEEM-MFEYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVN 487

Query: 275 LSEAIGLHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
           +   + L+           +  P   +T         FWC + ++ ++S+  GR
Sbjct: 488 MCNGMTLY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQTGR 531

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
           R R+  ACV CR R  KC G +PC  CIA    C Y +
Sbjct: 69  RSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEYIE 106

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 3   SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDE 62
           ++  N +  KR RV   C  CR RK +C+  +PC  C+A    C Y+ +   +   +V  
Sbjct: 58  NNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVYS-ISEMNNGNKVSA 116

Query: 63  TPYGTDNRPYSLPN 76
           T    +    +LPN
Sbjct: 117 TQVLAETSGTALPN 130

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 30/188 (15%)

Query: 153 VTKEEY-----YRISK---VYFSVVHPIFDVVDPEQLAKNVERYWDG--DVKMLEYGAVI 202
           + KE Y     Y  SK    YFS  H  +  +  E     + +Y D      M  +  ++
Sbjct: 189 IVKETYSLSAKYVTSKFIDAYFSQYHTTYPFIHKETF---MAQYKDQLRPSSMDIWQILL 245

Query: 203 AGVIALGSFFLGSLGHPREMDVVQY--AKGILDDPTFCRIPTVEQVSAWVLRTIYLRATS 260
             V+ALG + +   G   ++D+  Y  AK  L    F    +V  V A  L + Y++  +
Sbjct: 246 NTVLALGCWCIN--GESSDIDIYYYQNAKSYLSSVVF-ETGSVSLVVALTLLSSYVQKRN 302

Query: 261 RPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINT 320
           +P+  W    +   ++ ++GLHHE  + +  +             E  RR++W  ++++ 
Sbjct: 303 KPNSGWNYLGLATRMAISLGLHHEFPKMEETLL------------EQRRRVWWGTYTLDC 350

Query: 321 ILSYDYGR 328
            +S  YGR
Sbjct: 351 AVSITYGR 358

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 16 VRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYT 49
          V++AC  CR+RK +C+ + P C  C+ + + C Y+
Sbjct: 5  VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYS 39

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSS---TSPRVDETPYGTD 68
          K+ R  +AC  CR RK KC+G  PC  C  YG  C +  V+G +    S +  ET +   
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFEPVNGMTPMNFSSKPSETEFHHG 69

Query: 69 NRPYSL 74
          N  +S+
Sbjct: 70 NSMHSV 75

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 8  SQPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
           Q  KRQ R   ACV CR R  KC G +PC  CIA   AC Y +
Sbjct: 35 GQLRKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIE 78

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          ++RV KAC  CR+ K KC+G+ PC+ C++    C Y++
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTYSN 41

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 834

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 13 RQRVRK---ACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          ++R+++   ACV CR R  KC+G+ PC  C+A   AC Y +
Sbjct: 43 KRRIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYME 83

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {ON} 
          Length = 980

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 5/95 (5%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD--- 68
           K+ R  +AC  CR RK KC+G  PC  C  Y   C +T +   + S +  E     D   
Sbjct: 10  KKTRSSRACENCRARKIKCSGNQPCSNCEIYNCPCAFTPIKRKNLSDKGIERIANNDHLF 69

Query: 69  --NRPYSLPNILRNEARSVDAQNVTNQNIIDPIKS 101
             N   +  NI  +   + DA    + + + PI S
Sbjct: 70  QENNASTTTNIRSDFESTNDANKPASSSEVSPIDS 104

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          ++SG+     KR +V +AC  CR RK KC G  PC  C  Y   C Y+
Sbjct: 1  MNSGNRVVKKKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTYS 48

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSP 58
          + +V++AC  CR RK +C+G  PC  C++    C+Y D  G    P
Sbjct: 6  KAKVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYHDSAGIKKPP 51

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa]
          {ON} Anc_4.113
          Length = 1043

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYT 49
          +V KAC  CR+RK KC GK PC  C AY   C Y+
Sbjct: 43 KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYS 77

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDN 69
          R +V +AC  CR RK KC G  PC  C+ Y   C ++    SS       TP  ++N
Sbjct: 13 RSKVSRACENCRRRKIKCTGNQPCNNCVTYQCECIFSKGTLSSIGNISQITPASSEN 69

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRV---DETPYG 66
          ++++AC  CR RK KC G  PC  C+AY   C Y+   G +   R    + TP G
Sbjct: 11 KIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVYS--SGGAQKGRAISTETTPGG 63

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYA--CHYTDVDGSSTSPRV 60
          KR+R    C  CR RK +C+ + PC  C  +G A  C Y D   SS  P++
Sbjct: 14 KRKRPTVVCTNCRRRKSRCDRERPCNTCTRFGNADSCVYLDSSPSSNEPQI 64

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           +S  +++ P    RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 56  ISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 3   SSGSNSQPYKRQ--RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
            +GS + P   Q  RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 85  GNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPR 144

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          R+++ KAC+ C++RK+KC+G+ PC+ C+
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          R+++ KAC+ C++RK+KC+G+ PC+ C+
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          KR RV  AC  CR +K+KC+G+ PC++C      C Y+D
Sbjct: 20 KRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSD 58

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDET 63
          +V KAC  CR+RK KC GK PC  C AY   C Y     S+  PR   T
Sbjct: 39 KVSKACDNCRKRKIKCTGKMPCPTCEAYQCPCIY-----SAPKPRKKRT 82

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           +S  ++  P    RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 56  ISPTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 7   NSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           NS      RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 10 PYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD 68
          P  R +  ++C+ C+ RK+KC+ K+P C  C+  GY C Y   + +  S  VD T   + 
Sbjct: 2  PKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIY---NVNLQSQLVDGTKQLSK 58

Query: 69 NRPYSLPNILRNEARSVDAQNVTN 92
          ++  +   IL ++ R    +N  N
Sbjct: 59 SQLIAKIGILTSQLREKSDKNTGN 82

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 48/118 (40%), Gaps = 13/118 (11%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
           R+RV KAC  CR +K KC+G  PC  C      C YT V      P     P    NR  
Sbjct: 7   RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGYTYVVKKRQKP-----PTRVSNR-- 59

Query: 73  SLPNILRN-EARSVDAQNVTNQNIIDPIK-SRYTIQHSAVAFPRCLGL-ELRSTNPPR 127
               IL +   R V  + +  Q    P+     +I  S   F     L ELRS NP R
Sbjct: 60  ---KILADLSQRLVRLEGILTQIRDGPLNLDDASIAESDSKFHAAPALAELRSANPLR 114

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 6  SNSQPYKRQRVRK-ACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          +N++P  ++R +  AC+ CR+R  KC+G +PC  CI +   C Y +
Sbjct: 14 NNTEPSSKRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEYIE 59

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCI--AYGYACHYTD 50
          +G+  Q  KR RV  +C  CR+RK KC+ G+  C+ C+    G+ CHY +
Sbjct: 9  TGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYME 58

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          ++QR   AC+ CR+R  KC G +PC+ C+A    C Y
Sbjct: 26 RQQRSSIACLSCRKRHIKCPGGNPCQKCVASNAICEY 62

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
          + RV +AC  CR+RK KC+G  PC  C+     C Y  V      P V ++ Y  DN  Y
Sbjct: 14 KDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIYNGV----AFPHV-KSFYHRDNDLY 68

Query: 73 SLPNILRNEARSV 85
              +L   A+++
Sbjct: 69 RELRLLYKSAKAL 81

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 7  NSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          N +  K +R   AC  CR R  KC G +PC  C+  G AC Y +
Sbjct: 33 NDKKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEYVE 76

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKS--PCEMCIAYGYACHYTDVDGSSTS----------P 58
          Y+ ++  + CV C+ +K KC  K   PCE CI +G AC++      S +          P
Sbjct: 4  YESKKRTRPCVSCKRQKLKCQYKESLPCERCIKHGMACYFPTTQKQSATAKQSLHETVLP 63

Query: 59 RVDETPYGTDNRPYS--LPNIL 78
          R    P    N P +  +PN L
Sbjct: 64 RYQSPPPLQSNPPEASVVPNTL 85

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 12 KRQ--RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          +RQ  RV KAC  CR +K KC+ K PC  CI     C Y +
Sbjct: 8  RRQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRYKN 48

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDE 62
          R +V KAC  CR RK KC+G+ PC  C  Y   C ++    S+ +PR  +
Sbjct: 10 RSKVSKACDNCRRRKIKCSGERPCAGCKTYNCECIFS---VSAPTPRASK 56

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           R+ +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 100

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
          {ON} conserved hypothetical protein
          Length = 707

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKS--PCEMCIAYGYACHYTD 50
          Y+ +R  K C  C++R+ KC  +   PCE C+ +G AC Y D
Sbjct: 4  YESRRRTKPCASCKQRRLKCQYQETLPCERCVKHGIACFYPD 45

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 7  NSQPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          N Q  +RQ R   AC+ CR+R  KC G SPC+ CI     C Y
Sbjct: 20 NKQRQRRQPRSAVACLSCRKRHIKCPGGSPCQKCITSNAICEY 62

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           RV +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           RV +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          KR +V +AC  CR RK KC G +PC  C  Y   C Y
Sbjct: 15 KRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTY 51

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           R+ +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 101

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          R AC+ CR +++KCN KSPC  C   G  C +T  D
Sbjct: 18 RLACLHCRHKRKKCNMKSPCSNCQRAGMKCIFTHED 53

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 139/362 (38%), Gaps = 79/362 (21%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRVDETPYG----- 66
           R  V +AC  CR RK KC+   P C  C      C Y        SP++  +P       
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLY--------SPKIRRSPLTRAHLT 53

Query: 67  -TDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLE------ 119
             + R   +  +LRN    +DA  +        +K R+  Q   + F R + +       
Sbjct: 54  EVETRLGQMEQLLRNAFVDLDADTL--------LKHRHDPQLREILFGRTVDIGALSRTD 105

Query: 120 --LRSTNPP-RLHSFAWH--------CGIRPEENPNSHILLS-----GLVTKEEYY---- 159
             + S  PP R   F W+         G   +++P  H L++     GL+ +   Y    
Sbjct: 106 EYMASPLPPLRQAEFQWYERRDLLTGTGFNMKQSP-LHSLVAEAQQEGLMARPSKYERMQ 164

Query: 160 --------RISKVYFSVVHPIFDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSF 211
                   R  + YF   H ++ VVD  +     E         L  G ++  V+ALG++
Sbjct: 165 LEEQSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDACLWTG-LVNVVLALGAW 223

Query: 212 FLGSLGHPREMDVVQYAKGILDDPTFCR-IPTVEQVSAWVLRTI--YLRATSRPHVAWLA 268
             G+   P    V  Y K   +     R + T ++V A  L  +  Y   T   + AW+ 
Sbjct: 224 CAGA---PPAAHVFYYDKA--ESHVLGRMLRTGDRVLAIALLLMAHYNYMTHHRNTAWML 278

Query: 269 SCITIHLSEAIGLHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
             +   L+ ++GLH ++          +P ++ T      + L+W  +S  T ++ + GR
Sbjct: 279 LGLASQLATSLGLHRDL--------QGLPPKQRTLA----QILWWGIYSTTTQVALELGR 326

Query: 329 SS 330
            S
Sbjct: 327 PS 328

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           R+ +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 100

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           R+ +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 101

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 3   SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
           ++ S      R RV+KAC  C++RK KC+G +PC  C  +   C Y
Sbjct: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 11/108 (10%)

Query: 221 EMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIG 280
           E ++ +YA  I++  TF    + E + +W+L T Y R   R    W A    +++   + 
Sbjct: 492 EENLFKYAYLIINTLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMS 550

Query: 281 LHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
           L+           +  P   +T         FWC + ++ ++S+  GR
Sbjct: 551 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 588

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA-CHYTDVDGSSTSPRVDETPYGTDN 69
           KR+ + K C+ CRE+K KC+ + P C  CIA  +  C Y D +G   +P V +    +DN
Sbjct: 74  KRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVDANG---NPLVQDFHPSSDN 130

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR280C
           (CAT8)
          Length = 1285

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15 RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
          RV +AC  CR +K +C+G+ P C  C A G+ C  +D
Sbjct: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSD 63

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 14  QRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           +R+ +AC  CR +K +C+GK P C  C   G+ C  +D     + PR
Sbjct: 102 KRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPR 148

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 3   SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA-CHYTD 50
           +S SN +  KR++V K+C  CR+RK KC+ K P C  C   G + C YTD
Sbjct: 73  ASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp,
          566 aa] {ON} highly similar to uniprot|Q04176
          Saccharomyces cerevisiae YDR397C NCB2 Beta subunit of
          the NC2 dimeric histone-fold complex represses RNA
          polymerase II transcription through binding to TBP and
          inhibition of TFIIA and TFIIB homologous to the Dr1
          subunit of the mammalian NC2 (negative
          cofactor2)[INTRON]
          Length = 566

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 19 ACVPCRERKRKCNGKSPCEMCIAYGYAC 46
          AC  CR+R+RKCN +SPC  C  YG  C
Sbjct: 17 ACQSCRKRRRKCNLESPCSNCQKYGVEC 44

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 4/41 (9%)

Query: 13  RQRVRKACVPCRERKRKCN----GKSPCEMCIAYGYACHYT 49
           ++RV KAC  CR+RK KC      K+ C+ CI Y  AC +T
Sbjct: 96  KRRVSKACDHCRKRKIKCGPINPAKNKCDNCIKYSSACTFT 136

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 3  SSGSNSQPYKRQR-----VRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          S+ ++S+  KRQ+     V +AC  CR+RK KC+G  PC  C  Y   C Y
Sbjct: 4  SAPTSSKVLKRQKKQPDKVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEY 54

>ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa]
          {ON} similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W Hypothetical ORF
          Length = 842

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 10/63 (15%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGY--ACHYTDVDGSSTSPRVDETPYG--T 67
          +R R    C  C+ RK KC+ ++PC  C+ +G    CHY        +P+  E+ +G  T
Sbjct: 14 RRNRPTVVCTNCKRRKSKCDRQNPCSNCVRFGNKDTCHYVQ------NPKNTESQHGEDT 67

Query: 68 DNR 70
          DN+
Sbjct: 68 DNK 70

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          M +     + Y  ++  +AC+ CR RK KCNG  PC  C   G  C Y
Sbjct: 32 MATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRPCSSCKTNGLECAY 79

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
          + GSN Q  KR R+   C  CR+ K KC+ + P C  C+    AC Y DV      PR+
Sbjct: 29 AGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVY-DV-AKQPPPRI 85

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
           RV +AC  CR +K +C+GK P C  C A G+ C  +D
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISD 214

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           R+ +AC  CR +K +C+GK P C  C   G+ C  +D     + PR
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPR 121

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMCIAYGYACHYTDVDG 53
           M S  + +   K +R  +AC  CRERK KCN        K PCE C      C + +   
Sbjct: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 54  SSTSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNI 95
            S S    +  YG D     L  I   +  +  A N   QN+
Sbjct: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNM 102

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          V+ AC  CR R+ KC+GK PC  CI + + C Y
Sbjct: 4  VKYACDFCRVRRVKCDGKKPCSRCIQHDFECTY 36

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTD 50
          KR+++ KACV CR+RK KC+   P C+ C +    C YT+
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTN 45

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
          (PUT3) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
          FULL
          Length = 822

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          M   GS       +R   ACV CR R  KC+G +PC  C A   AC Y +
Sbjct: 30 MEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEYLE 79

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          ++R  +AC  CR +K KC+G  PC  C   GY C  +D
Sbjct: 22 KKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNCVTSD 59

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 13 RQRVRK------ACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          +QR RK      AC+ CR+R  KC G +PC+ CI     C Y
Sbjct: 21 KQRQRKQPRSAVACLSCRKRHIKCPGGNPCQKCITSNAICEY 62

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          V+ AC  CR R+ KC+GK PC  CI + + C Y
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTY 36

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYG 43
           + RV +AC  CR +K+KC+G+ PC++C   G
Sbjct: 123 KGRVSRACEFCRSKKKKCDGQQPCDLCKLVG 153

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYG 43
          K +RV KAC  C+ RK++C G+ PC+ C   G
Sbjct: 2  KEKRVSKACDVCKHRKKRCTGELPCDYCTRIG 33

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          M ++  N+    R+R + AC  CR R+RKC+ + PC  CI +   C +   D
Sbjct: 26 MANNEENNDNVPRKR-KLACQSCRRRRRKCDMEKPCSNCIKFQTDCVFAQQD 76

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 6/102 (5%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP----CEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD 68
           ++RV KAC  CR+RK +C+   P    C  C+ +  AC +   D      R  ET   +D
Sbjct: 126 KKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRKKRKLETKQNSD 185

Query: 69  NRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAV 110
             P +  N   N   S    N  N+   +P  S  +++   V
Sbjct: 186 KSPQAQSNG-SNHVISSMPNNTANE-TFEPFNSNSSLESDIV 225

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          R RV+KAC  C+ RK KC+G  PC  C  +   C Y
Sbjct: 39 RLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRY 74

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/108 (20%), Positives = 44/108 (40%), Gaps = 11/108 (10%)

Query: 221 EMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIG 280
           E  + +YA  I++  TF    + E + +W+L   Y R   R    W A    +++   + 
Sbjct: 453 EEKMFKYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 511

Query: 281 LHHEIDREDLVMTSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGR 328
           L+           +  P   ++         FWC + ++ ++S+  GR
Sbjct: 512 LY----------LNKFPEIHSSYDESKAWHCFWCCFIMDKLISFQMGR 549

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           RV +AC  CR +K KC+GK P C  C   G+ C  +D     + PR
Sbjct: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          S SN    KR R+  +C  CR+RK KC+   P C  C   G A  CHY +
Sbjct: 11 SASNKVKRKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 60

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 76/181 (41%), Gaps = 17/181 (9%)

Query: 151 GLVTKEEYYRISKVYFSVVHPIFDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGS 210
            L ++    R    YF   HP F ++  E L        +  V   ++  +   V+A+G+
Sbjct: 259 SLSSRATTSRFIDSYFQNFHPFFPLLHSETLLMLYNNQINS-VAKDQWQILFNTVLAIGA 317

Query: 211 FFLGSLGHPREMDVVQY--AKGILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLA 268
           + L   G   ++D+  Y  AK  L         +V  V A  L + Y +   +P+ ++  
Sbjct: 318 WCLE--GDSTDIDLFYYQNAKSHLTGAKIFETGSVTLVIALHLLSQYTQWRQKPNTSFNF 375

Query: 269 SCITIHLSEAIGLHHEIDREDLVMTSNVPLR-RTTEVSEHTRRLFWCAWSINTILSYDYG 327
              +I ++ ++GLH E+           PL  +   V E  RR++W  +S    L+  YG
Sbjct: 376 HGHSIRMAISLGLHKEL-----------PLNFKDNSVKEQRRRIWWYIYSQEFHLALSYG 424

Query: 328 R 328
           R
Sbjct: 425 R 425

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
           G N +  +++R   AC+ CR+R  +C G +PC  C++   AC Y +
Sbjct: 43 GGGNKE--RKKRAPLACLRCRKRHVRCPGGNPCSKCVSANIACEYLE 87

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 4   SGSNSQPYKRQRVRK---ACVPCRERKRKCNGKSP-CEMCIAYGYA-CHYTD 50
           SG++S+P  R+R RK   +C  CR+RK KC+ + P C  C+    + C YTD
Sbjct: 49  SGASSKPSTRRRRRKVIKSCTFCRQRKMKCDQQKPMCGSCVERKLSECIYTD 100

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 10  PYKRQRVRKACVPCRERKRKCNG----KSPCEMCIAYGYACHYTDVDGSST 56
           PYKR RV KAC  CR RK KC+     K+ C  C+     C +++ D  +T
Sbjct: 154 PYKR-RVVKACYNCRRRKIKCDAIDPSKNKCSNCLKLNKICSFSENDEINT 203

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDV 51
          + QR+ +AC  C++RK KC G +PC+ C      C Y ++
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYREI 67

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP----CEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD 68
          R+RV KAC  CR+RK KC   +P    CE C  +  +C +   D  S   +  +    +D
Sbjct: 22 RKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTFRHHDEISRHRKFTDLKRASD 81

Query: 69 NRP 71
          N P
Sbjct: 82 NEP 84

>KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 727

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          M S  S+  P KR     AC  CR R++KC+ + PC  C   G  C+   VD
Sbjct: 26 MDSEASSEPPAKRL----ACANCRRRRKKCDLEYPCGRCQELGLGCNINKVD 73

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 703

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYG--YACHY 48
          + ++AC  C+ RK++C+G  PCE C+  G    C Y
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCVKIGNPQGCEY 48

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
          homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVD-----GSSTSPR 59
          +KRQR    C+PC +RK KCN   P C+ C    YAC Y   D     G +  PR
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRVSRGGQNKVPR 83

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 12 KRQRVRKACVPCRERKRKCN-GKSPCEMCIAYGYACHYTDVDGSSTSPRV 60
          KR R    C+ CR RK KC+ GK  C  C+  G  C Y++    + S +V
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENASKKV 62

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 38.9 bits (89), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          V++AC  CR R+ KC+GK PC  C+     C Y
Sbjct: 37 VKQACDCCRVRRVKCDGKGPCGRCLQRDLNCTY 69

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          +SS + S   KR RV  +C  CR+RK KC+   P C  C   G A  CHY +
Sbjct: 1  MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 52

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          +R R AC  CR R++KC+   PC  CI  G  C+  + D
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLNCNVNEED 69

>Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa]
          {ON} complement(57391..58653) [1263 nt, 421 aa]
          Length = 420

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 1  MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIA--YGYACHYTDVDGSST 56
          MV SG      +R++  KACV CR     CNG+ PCE CI     + C+Y +   S++
Sbjct: 1  MVESGK-----ERRKSYKACVFCRRSHLVCNGQRPCERCIKRDISHLCNYEERGNSAS 53

>Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098C
          (REAL)
          Length = 644

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 4/34 (11%)

Query: 6  SNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMC 39
          SN  PY    V  AC  CR+RKRKC+G+ PC  C
Sbjct: 2  SNRSPY----VTLACNTCRKRKRKCDGRKPCYYC 31

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa]
          {ON} Anc_4.121
          Length = 708

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 15/57 (26%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTD 68
          KR+R+ K+C  C   K KCN + PC  CIA G                +DE  YG D
Sbjct: 13 KRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVGL---------------IDECIYGFD 54

>KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conserved
           hypothetical protein
          Length = 632

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 73/195 (37%), Gaps = 45/195 (23%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCIAYG------YACHYTDVDGSSTS------PR 59
           KR+R  K+C  C E K KCN +SPC  C   G      Y     +VD    S      P+
Sbjct: 5   KRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGFKKDEVDAKPLSSTETFKPK 64

Query: 60  VDETPYGTDNRPYSLPNIL----RNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRC 115
            D+    +   P + P        N    +  ++  ++N  D    R  + +      +C
Sbjct: 65  -DQVLKTSSTHPKTKPYYPYLSGANAEEVLSNRHQAHKNPTDACMKRNEVTNFNKFDVKC 123

Query: 116 LGL-ELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFD 174
           + + E+ S  PP                           ++   + +  VYF  +HPI  
Sbjct: 124 MSVEEVASLIPP---------------------------SQASTFLVVDVYFHKIHPIIP 156

Query: 175 VVDPEQLAKNVERYW 189
           V+D E++ + +E  +
Sbjct: 157 VLDREEVFRQIEEVY 171

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYG--YACHYTD 50
           KR R+  +C  CR+RK KC+ K P C  C   G  + CHY +
Sbjct: 110 KRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHYME 151

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1581

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 6  SNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          SN    KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 52 SNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYME 99

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          + +N    KR R+  +C  CR+RK KC+   P CE C   G A  CHY +
Sbjct: 19 AAANKMKRKRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTGVAHLCHYME 68

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 7  NSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
          NS   KR R+   C  CR+ K KC+ + P C  CI  G  C Y D++   T PR
Sbjct: 15 NSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIECVY-DIE-QQTQPR 66

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 19 ACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          AC+ C++RK+KC+G+ PC  C      C Y
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIY 31

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYAC 46
          ++++   AC  CR ++RKC+ + PC  C+ YG  C
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIEC 43

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 4  SGSNSQPYKRQRVRK---ACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          S S S  Y R+  R+   ACV CR +  KC G  PC  C A   AC Y
Sbjct: 23 SSSGSAGYVRKPPRRSTLACVRCRRKHVKCPGGDPCSKCSAARIACEY 70

>TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {ON} 
          Length = 696

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYAC-HYTDVDGSSTSPRVDETPYGTDNR 70
           K  R  KAC  CR RK KC+  SPC  C+A    C H  +    +TS    E+P+  ++ 
Sbjct: 20  KAPRTPKACDNCRRRKIKCSNISPCLNCVASALKCVHSQEPKRLNTS--FFESPFKLNHD 77

Query: 71  PYSLPNI---LRNEARSVDAQNVTN 92
             SL +    L N   S ++Q V N
Sbjct: 78  LSSLKDSLAGLSNRLLSANSQEVKN 102

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          S ++S P   +RV  AC+ CR++  KC G +PC  C+     C Y
Sbjct: 14 SSTSSDPPTEKRV--ACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          ++++ AC  CR+R+RKC+ + PC  C  +G  C   D D
Sbjct: 8  KKLKLACQTCRKRRRKCDLQVPCVNCQKFGVECLPVDQD 46

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          KR R+   C  CR+ K KC+ K P C  CI +G  C Y
Sbjct: 44 KRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVY 81

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 4  SGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYG--YACHYTD 50
          S  N    KR R+  +C  CR+RK KC+   P C  C+  G  + CHY +
Sbjct: 29 SAKNKIKRKRNRIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYME 78

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON}
          YLR256W (REAL)
          Length = 1503

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 14/62 (22%)

Query: 3  SSGSNSQPY-----------KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHY 48
          ++GSNS P            KR R+  +C  CR+RK KC+   P C+ C   G A  CHY
Sbjct: 35 TNGSNSPPLHMSSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHY 94

Query: 49 TD 50
           +
Sbjct: 95 ME 96

>TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.61
          YOR172W
          Length = 878

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 5  GSNSQPYKRQR--VRKACVPCRERKRKCNGKSP-CEMCIAYGY-ACHYTDVDGS-STSPR 59
          G+ + P K++R  + K C  CR+RK KC+ + P C  C+      C Y D  GS +TSP 
Sbjct: 9  GNENPPLKKKRRTIIKTCTFCRKRKLKCDKRKPRCSSCVTRNLPECVYIDGTGSGATSPD 68

Query: 60 VDETPYGTDNRPYSLPNIL 78
             +  G + + YS   IL
Sbjct: 69 TPSSSTG-NAKNYSTGVIL 86

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
          (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYG--YACHYTD 50
          KR R+  +C  CR+RK KC+   P C  CI  G  + CHY +
Sbjct: 12 KRNRIPLSCTICRKRKVKCDKTHPHCNQCIKTGVHHLCHYME 53

>YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON}
          Putative zinc cluster protein; deletion confers
          sensitivity to Calcufluor white, and prevents growth on
          glycerol or lactate as sole carbon source
          Length = 794

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          ++ RV KAC  C  +K KCN K PC  CI     C Y
Sbjct: 10 QKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTY 46

>TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1247

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR R+  +C  CR+RK KC+   P C+ C+  G A  CHY +
Sbjct: 24 KRNRIPLSCTICRKRKVKCDKTRPHCDQCVKTGVAHLCHYME 65

>TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {ON}
           Anc_1.260 YJL103C
          Length = 496

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 100/255 (39%), Gaps = 39/255 (15%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
           R+   KAC  C ++  +C+   PC+ CI     CH  D++  STS  +       +    
Sbjct: 13  RRPTVKACQMCHDKHIQCDKGRPCKNCIKRRTECHCKDIERKSTSSNLRHQINYKNASEM 72

Query: 73  SLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLELRSTNPPRLHSFA 132
           SL + +     ++  Q+ T   I+D  K    I+H        L   L STN    +S++
Sbjct: 73  SLNSTVEVAVNNLQGQSST--AIVDINK----IKHQPTDTNNALEALLNSTNSFLYNSYS 126

Query: 133 WHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVDPEQLAKNVERYWDGD 192
             C  RP + PN   + S   T+  +                   P   +    R+   +
Sbjct: 127 -DCD-RPPKLPNVPYIESSSSTETAF-------------------PNSESNFDSRWAKDE 165

Query: 193 VKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTFCRIPTVEQVSAWVLR 252
            K L    +I    A G+  L S  + RE D++   K +LD  +        ++   +  
Sbjct: 166 YKSL--NNLITLQSASGNLILNSENN-REKDILN-DKNLLDKES--------ELKTDMET 213

Query: 253 TIYLRATSRPHVAWL 267
           TI  ++  RPH++ +
Sbjct: 214 TIINKSFPRPHISLI 228

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          +SS S+    KR R+  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 46 MSSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYME 97

>Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [contig
          211] FULL
          Length = 948

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          ++RQR   +CVPC +RK KC  ++P C  C+   + C Y
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSY 64

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 17  RKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
           R AC  CR R++KC+ + PC  C+ Y  +C+  + D
Sbjct: 91  RLACSSCRRRRKKCDMQYPCGNCVHYKDSCNINEED 126

>NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884
          bp, 627 aa] {ON} Anc_7.56 YOR337W
          Length = 627

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 13 RQRVRK-----ACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          ++R+RK     AC  CR+ +RKC+  SPC  C+ +   C YT  D
Sbjct: 17 QKRLRKILKKLACQHCRKIRRKCDTGSPCANCMKFETECVYTGHD 61

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa]
          {ON} Anc_8.283
          Length = 710

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSST 56
          K QR + AC  CR+ +RKC+  +PC  CI +   C Y + D  +T
Sbjct: 38 KSQR-KIACQHCRKIRRKCDMINPCSNCIKFDTTCVYAEKDMRTT 81

>Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [contig
          206] FULL
          Length = 628

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACH 47
          KR R  K C  C E K KCN +SPC+ C   G   H
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSH 40

>TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 106/266 (39%), Gaps = 46/266 (17%)

Query: 19  ACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPYSLPNI 77
           +C  CR+RK KC  + P C+ C+   Y C+Y D     TS ++ ++    + R Y     
Sbjct: 15  SCRQCRQRKIKCGRQFPGCDNCVKRSYECNYPDTH-RKTSTKLVKSRKHANARYYG---- 69

Query: 78  LRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLGLELRSTNPPRLHSFAWHCGI 137
            R+  RS+    +   N+   ++ +Y                  S+    L+S  +   I
Sbjct: 70  FRSVNRSLFEAGMPFCNVDFELEGKYA----------------SSSMKRFLNSKVYKKYI 113

Query: 138 RPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFD-VVDPEQLAKNVERYWDGDVKML 196
              E P S+IL +  + K           S  +  F+ +VD   L  +++    G  + L
Sbjct: 114 ---EEP-SYILQAMKLVKN----------SASYSFFEHIVDVNALETSLKLKKGGGFQTL 159

Query: 197 EYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTFCRIPTVEQVSAWVLRTIYL 256
               ++  V  L   F  S   P   D+++    +LDD   C     E+VS+++L   Y 
Sbjct: 160 ---LLLYAVTILSERFFDS--PPDVQDLIEELHLLLDDCPDCP----EKVSSYILLADYY 210

Query: 257 RATSRPHVAWLASCITIHLSEAIGLH 282
               +   AW    +   +  A+GLH
Sbjct: 211 HCNFKIEAAWKRIYLATSIGYALGLH 236

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          ++AC  CR R+ KC+GK PC  C+ +   C Y
Sbjct: 10 KQACDCCRVRRVKCDGKKPCNRCLQHDLKCTY 41

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          Q  KR R+  +C  CR+RK KC+   P C  C   G A  CHY +
Sbjct: 27 QKRKRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTGVAHLCHYME 71

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON}
          YLR256W (REAL)
          Length = 1479

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          +SS S+    KR R+  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 47 MSSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYME 98

>Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064W
          (REAL)
          Length = 889

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYG 43
          KR R+   C  C++RK KCN   PC  CI  G
Sbjct: 36 KRHRITLVCTNCKKRKSKCNRTKPCGTCIRLG 67

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
          Ashbya gossypii AGR061C
          Length = 627

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          +++ AC  CR+R+RKC+ + PC  C  +G  C   D D
Sbjct: 9  KLKLACQSCRKRRRKCDLQMPCLNCQKFGVECLPIDQD 46

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          +KRQR   +CV C +RK KC+   P CE C   G+ C Y
Sbjct: 37 HKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLY 75

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
          {ON} conserved hypothetical protein
          Length = 971

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          +KRQR   +CVPC +RK KC+   P C  C+   + C Y
Sbjct: 26 HKRQRKILSCVPCHQRKIKCSRDQPACSNCLKNNWDCVY 64

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar
          to uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate-activated transcription factor acts alone and as
          a heterodimer with Pip2p activates genes involved in
          beta-oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 1035

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
          KR R+   C  CR  K KC+ + P C  C+ +G AC Y DV+  + +PR
Sbjct: 52 KRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVY-DVEKQA-APR 98

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
           KR R+   C  CR+ K KC+ + P C  CI +G  C Y DV     +PR+
Sbjct: 58  KRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVY-DV-SKQPAPRI 105

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          K +R    C+PC+ +K +CN   P C  C   G  CHY
Sbjct: 27 KSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCHY 64

>KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON}
          Anc_6.154 YBR240C
          Length = 459

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          SS ++ +   R R    C  CR +KR+CN + P C +C+ +G  C Y
Sbjct: 9  SSTTDMKKASRARTFTGCWACRLKKRRCNLEKPICSLCVRHGDHCSY 55

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 35 KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYME 76

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          K+   ++AC  CR R+ KC+GK PC  C+ +   C Y
Sbjct: 5  KQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTY 41

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          +KR R    C  CR+RK KC+   P C  C+  G  C Y
Sbjct: 9  HKRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVY 47

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
          to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
          weakly similar to YAL051W uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 975

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
          KRQR+   C  CR+ K KC+ + P C  C+ Y   C Y DV+     PRV
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVY-DVE-QQKPPRV 74

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 7  NSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          N +P KR  +  AC+ CR R  +C G +PC  C     AC Y +
Sbjct: 50 NKRPAKRAPL--ACLRCRRRHVRCPGGTPCAKCAVANIACEYLE 91

>CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON}
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064w
          Length = 891

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 12/64 (18%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPY 72
          R+R    CV CR+RK KC+ + PC  CI +G      D D   T   +++ P G  N   
Sbjct: 11 RRRPMLVCVNCRKRKSKCDRQLPCSKCIQHG------DTD---TCTYLNDVPIGKKN--- 58

Query: 73 SLPN 76
          ++PN
Sbjct: 59 NVPN 62

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YKL222C and YOR172W (YRM1)
          Length = 872

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 10/59 (16%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCIAYG-----YACHYT-DVDGS---STSPRVD 61
          R++V K+CV CR+R+ KCN   P C  CI  G     Y   +T DV+     S++P V+
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVYLSEFTHDVNSRELFSSTPNVE 70

>Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063W
          (REAL)
          Length = 607

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCI 40
          ++ V  AC  CR RK KC+G  PCE CI
Sbjct: 9  KKTVSLACTVCRTRKLKCDGNKPCERCI 36

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
          (REAL)
          Length = 324

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          +SS S+    KR R+  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 47 MSSESSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYME 98

>ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weakly
           similar to uniprot|Q12172 Saccharomyces cerevisiae
           YOR162C YRR1 Zn2-Cys6 zinc-finger transcription factor
           that activates genes involved in multidrug resistance
           paralog of Yrm1p acting on an overlapping set of target
           genes
          Length = 921

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 5   GSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGY-ACHYTDVDGSSTSPRVDE 62
           GS +   KR +  K+C  CR RK +C+ + P C  CIA     C Y +   SS++PR   
Sbjct: 38  GSVTVKKKRMKPIKSCTFCRRRKLRCDQQKPMCSTCIARELPECVYME---SSSTPRTVA 94

Query: 63  TPYGTDNRPYSLPN 76
              G  +   S+PN
Sbjct: 95  GKRGNIDSIGSMPN 108

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar
          to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
          KLLA0C18953g and some similarites with YKL015W
          uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc- finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 649

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCI 40
          ++ +KAC  C+ RK++C+G  PCE C+
Sbjct: 4  KKSKKACEICKRRKKRCSGGLPCEYCV 30

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
          +R++V +AC  CR+RK KC+  +PC  C  Y   C +
Sbjct: 15 RRRKVNRACDNCRKRKIKCSETTPCTNCQIYQCKCVF 51

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 71/359 (19%), Positives = 137/359 (38%), Gaps = 49/359 (13%)

Query: 19  ACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDNRPYSLPNIL 78
           AC  CR+R+RKCN   PC  CI +   C   + D   T           +   Y   N+ 
Sbjct: 16  ACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTASYVKSLEEKIAYLESNLT 75

Query: 79  RNEA--RSVDAQNVTNQNIIDPIKSRYTI-------------QHSAVAFPRCLGLELRST 123
            ++   +++D   + N +I     S  ++             +++ V  P      LRS+
Sbjct: 76  ESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKNEYNLVENP------LRSS 129

Query: 124 NPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPI-FDVVDPEQLA 182
           +   +HS +        E   +   L  L       R    +F  ++P  +  +  E   
Sbjct: 130 SIYPMHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFFFKWLYPAHYFFIHRETFL 189

Query: 183 KNVERYWDGDVKMLEY---GAVIAGVIALGSFFLGSLG--HPREMDVVQYAKGI------ 231
            +    + GD     Y     ++  + ALG+  + S    + R  +  Q +K I      
Sbjct: 190 SS----FFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYGRSTEFYQTSKSIVLKKVF 245

Query: 232 -LDDPTFC-RIPT--VEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDR 287
            L+D +F    P+  +  +   +    Y        +AW  S +   ++  IGL  + D 
Sbjct: 246 QLEDSSFADSTPSSKLAIIQTLLCLAFYDIGNGENPMAWYLSGLAFRIAHEIGLQLDPD- 304

Query: 288 EDLVMTSNVPLRRTTEVSEHTR-RLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETE 345
                 SNV     +++    R R++W  +  + ++S  +GR++    +++  +V ET+
Sbjct: 305 ----AWSNVYENDLSKIDFEVRSRIYWGCYIADHMISILFGRTTTL--KLSNSTVPETD 357

>Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar
          to Ashbya gossypii AGL206C
          Length = 739

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSS--TSPRVDE 62
           +R R  C+ CR R++KC+   P C  C      C ++D +G S  TSP  DE
Sbjct: 44 EKRSRNGCLTCRARRKKCDETKPKCIGCQRNLLLCRWSDKEGGSTETSPNGDE 96

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA-CHYTD 50
          KR RV K+C  CR RK KC+   P C  C+ +G   C Y D
Sbjct: 18 KRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDD 58

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR R+  +C  CR+RK KC+   P C  C   G A  CHY +
Sbjct: 15 KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 56

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
           KR R+   C  CR+ K KC+ + P C  CI +G  C Y DV     +PR+
Sbjct: 58  KRNRISFVCQACRKSKTKCDREKPECGRCIKHGLKCVY-DV-SKQPAPRI 105

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
           YMR280C
          Length = 1237

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 8   SQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59
           S+P    R  +AC  CR +K KC+ K P C  C + G+ C  +D    ++ PR
Sbjct: 164 SRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON}
          conserved hypothetical protein
          Length = 946

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          ++RQR   +CVPC +RK KC  + P C  C+   + C Y
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSY 64

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTD 50
          K++R + AC+ CR+R  KC   +PC  C+     C Y +
Sbjct: 26 KQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEYIE 64

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 3  SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP----CEMCIAYGYACHY 48
          + G  ++P K+ RV KAC  CR RK KC+   P    C  CI Y   C +
Sbjct: 18 AEGVTTKPAKK-RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTF 66

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 16/30 (53%)

Query: 19  ACVPCRERKRKCNGKSPCEMCIAYGYACHY 48
           ACV CR R  KC G  PC  C +   AC Y
Sbjct: 75  ACVRCRRRHVKCPGGQPCAKCASANIACEY 104

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCIAYGYACHY 48
            SS SN +  KR+  R  C  C+ R+ KC+ GK  C  C      C Y
Sbjct: 131 ASSNSNGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVY 178

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR R+  +C  CR+RK KC+   P C  C   G A  CHY +
Sbjct: 44 KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYME 85

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYG--YACHYTD 50
          +SS   +   KR R+  +C  CR+RK +C+   P C  C+  G  + CHY +
Sbjct: 1  MSSPGGTAKRKRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTGVVHLCHYME 52

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 3   SSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
           S+   S+P K+   R AC  CR R++KC+ + PC  C   G  C+  + D
Sbjct: 62  SANVTSRPTKK---RLACSNCRRRRKKCDLQYPCFTCDKLGLECNINEED 108

>YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative
          zinc-cluster protein of unknown function
          Length = 607

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 8  SQPYKRQRVRKACVPCRERKRKCNGKSPCEMCI 40
          S+  +++ +  AC  CR+RK KC+G  PC  CI
Sbjct: 4  SKDARKRSISLACTVCRKRKLKCDGNKPCGRCI 36

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
           (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 14/102 (13%)

Query: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
           V +  ++   +R R+   C  CR+ K KC+   P C  C+ +G  C Y DVD        
Sbjct: 11  VKTTQSAHSGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVY-DVD-------- 61

Query: 61  DETPYGTDNRPYSLPNILRN----EARSVDAQNVTNQNIIDP 98
            +TP  T N+  ++  + R     +AR++    VT      P
Sbjct: 62  RQTPPKTPNKDATIARLKREVEYWQARALAIDTVTQPGQAKP 103

>KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa]
          {ON} Anc_6.60 YLR266C possible pseudogene; N added to
          avoid frameshift
          Length = 855

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGY-ACHYTDVDGSSTSPRVDE--TPYGT 67
          K+++  K+C  CR RK KC+ + P C  C +  +  C YTD   +S      E  +PYG+
Sbjct: 37 KKRKPIKSCAFCRRRKLKCDQRKPICSSCKSRNFQVCMYTDESLNSNDNDAVEFSSPYGS 96

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
          similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHY 48
          +KRQR    C+PC +RK KC+ + P C+ C+   + C Y
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCSRERPSCDNCLRNSFECVY 67

>Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063W
          (REAL)
          Length = 616

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 19/85 (22%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMC--IAYGYACHYTDVDGSSTSPRVDETPYGTDN 69
          K++ V  AC  C++RK KC+G +PC  C  +     C Y       T  R D+      +
Sbjct: 8  KKKAVSLACTVCKKRKLKCDGNNPCSRCNKLKTPEKCSYC------TDRRKDKRTVQNGS 61

Query: 70 RPYSLPNILRNEARSVDAQNVTNQN 94
          R +   N           QN++N+N
Sbjct: 62 RIFVFKN-----------QNISNEN 75

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 3   SSGSNSQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCIAYGYACHY 48
           SSG++ +  KR+  R  C  C+ R+ KC+ GK  C  C      C Y
Sbjct: 132 SSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVY 178

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
          YLR256W (HAP1) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          78] PARTIAL
          Length = 629

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
          KR RV  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYME 49

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
           KR R+  +C  CR+RK KC+   P C+ C   G A  CHY +
Sbjct: 74  KRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTGVAHLCHYME 115

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYG--YACHY-TDVDGS-STSPRVDE 62
          KR R+   C  C++RK KC+   PC  C+  G   +C Y TD  G   +SP +++
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSPSLND 65

>TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON}
          Anc_7.512 YLR451W
          Length = 923

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 6  SNSQPYKRQRVRKACVPCRERKRKCN----GKSPCEMCIAYGYAC 46
          SNS+     R + ACV CR++K KC+       PC  C+  G  C
Sbjct: 24 SNSETTTHGRKKVACVECRQQKSKCDAYDRAPEPCTRCMKRGLTC 68

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
          {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 18 KACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRVDETPYGTDN 69
          K+C+ CR RK++C+ K P C  C+  G  C       ++ +P   ETP   +N
Sbjct: 39 KSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAPIKQETPLSDNN 91

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa]
          {ON} Anc_1.199 YKR064W
          Length = 862

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYA--CHYTD-VDGSSTSPRVDETP 64
          +R+R    C  CR+RK +C+ + PC  C+  G +  C Y + ++ +++S RV   P
Sbjct: 10 RRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNPNTSSIRVSFAP 65

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYT 49
          K+ R  K C+ CR RK KC+ + P C  CI     C YT
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQQHPSCMRCIKSSTLCTYT 45

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYA--CHYTD 50
           R RV  +C  CR RK KC+   P C  C+  G A  CHY +
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYME 104

>YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON}
          PDR8Transcription factor; targets include ATP-binding
          cassette (ABC) transporters, major facilitator
          superfamily transporters, and other genes involved in
          the pleiotropic drug resistance (PDR) phenomenon
          Length = 701

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 2  VSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGY-ACHYTD 50
          VSSG      KR++V K+C  CR+RK KC+   P C+ C+      C YT+
Sbjct: 16 VSSGKKG---KRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCVYTE 63

>SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON}
           conserved hypothetical protein
          Length = 640

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 114/300 (38%), Gaps = 61/300 (20%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMC--------IAYGY---------ACHYTDVDGS 54
           KR+RV K C  C   K KC+   PC  C          YG+           +   +DG 
Sbjct: 8   KRRRVIKTCKYCYLHKLKCDKNMPCSTCSRLQVVDQCIYGFQESDENEWRGNNEKGIDGK 67

Query: 55  STSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPR 114
             + R+D +   T  +  S      N          T  N +   K  +T Q  +  F R
Sbjct: 68  --TQRIDLSSEATVFKSRSFFPFFTN----------TINNRLLTSKDGHTAQLDSTVFKR 115

Query: 115 CLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFD 174
                 + TN  +         + P +  N   LL    TK     +  VYF+ VHP+  
Sbjct: 116 N-----QLTNFDKF-------TVEPLQLENIFKLLPD--TKTSMLLLLDVYFNQVHPVIP 161

Query: 175 VVDPEQLAKNVERYWDG-------DV-KMLEYGAVIAGVIALGSFFLGSLGHPREMDVV- 225
           +++  +++ ++ R +D        D+ K+L   A++  V    S+   S G    + +  
Sbjct: 162 LLNQSKISSSIVRIYDDLEEFRPLDISKLLLIFAILFSV----SYSNMSAGKSSSLTLCK 217

Query: 226 QYAKG---ILDDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLH 282
           +Y      ++D   F  +P++E +  + +    +        A   S + + +++ +GLH
Sbjct: 218 KYYSAFSVLMDKFRFPTVPSLESLQGFTIVNFVMDPNMVDATA--HSVMLLKIAQQLGLH 275

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 5   GSNSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPRV 60
            S  Q  KR R+   C  CR+ K KC+ + P C  C  +G  C Y DV     +PR+
Sbjct: 51  NSEMQNRKRNRISFVCQACRKSKTKCDREKPECGRCTKHGLKCVY-DV-SKQPAPRI 105

>KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.56
          YOR337W
          Length = 691

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVD 52
          + R AC  CR+R++KCN   PC+ C+     C+  + D
Sbjct: 42 KKRLACNNCRKRRKKCNLAYPCDGCVRLKLKCNINEED 79

>KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa]
          {ON} Anc_6.61 YOR172W
          Length = 838

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGY-ACHYTDVDGSSTSPRVDETPY 65
          +R++  K+C  CR+RK KC+ K P C  C++  + +C Y D   ++   R D T Y
Sbjct: 24 RRRKPPKSCSFCRKRKLKCDQKKPICSNCLSRKFDSCLYPDSFLNNDVSRPDNTIY 79

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
          (REAL)
          Length = 468

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCIAYGYAC 46
          + AC  CR R+ KC+GK PC  C+ + + C
Sbjct: 5  KYACDYCRVRRVKCDGKKPCRRCLQHNFEC 34

>Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C
          (CEP3) - contains an N-terminal Zn2Cys6 type zinc
          finger domain, a C-terminal acidic domain and a
          putative coiled coil dimerization domain [contig 252]
          FULL
          Length = 579

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCIAYG-----YACHYTDVDGSSTSPRVD 61
          + R  CV C +RK KC+   PC  C+  G      A   T +D SS SP ++
Sbjct: 7  KTRTPCVVCTKRKVKCDRNIPCSNCVKRGQQELCIASERTKLDRSSRSPPLE 58

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYT 49
          K+ R+   C  CR RK KCN + P C  C+ +   C YT
Sbjct: 7  KKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQCVYT 45

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 11/98 (11%)

Query: 2   VSSGSNSQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMCIAYGYACHYTDVDGS 54
            +S  +S+  K QR  +AC+ CR RK KC+        K PC  C   G  C ++   G+
Sbjct: 16  TASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS-GGN 74

Query: 55  STSPRVDETPYGTDNRPYSLPNILRNEARSVDAQNVTN 92
             S     T  G +N+  +   I R  A SVDA +  N
Sbjct: 75  GMSSANLSTMNGKNNQA-TFTGIKR--ALSVDANSTLN 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,157,029
Number of extensions: 2259526
Number of successful extensions: 7078
Number of sequences better than 10.0: 654
Number of HSP's gapped: 7205
Number of HSP's successfully gapped: 673
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)