Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.545na 1ON51651626340.0
YOR378Wna 1ON51551624200.0
Smik_15.560na 1ON51651624050.0
Suva_8.435na 1ON51550723130.0
KLTH0C10560gna 1ON51551218980.0
Kwal_23.6547na 1ON51150318390.0
KLLA0B00352gna 1ON49849317420.0
TDEL0B005508.843ON5375089301e-119
SAKL0D01386g8.843ON5215139281e-119
Kpol_541.168.843ON5285249011e-115
Skud_13.4518.843ON5395378971e-114
YML116W (ATR1)8.843ON5425228841e-112
Skud_13.258.843ON5375148701e-110
KAFR0B03930singletonON5554738681e-110
NDAI0K004008.843ON5535248641e-109
Suva_13.278.843ON5535118641e-109
Suva_13.4678.843ON5435428621e-109
YMR279C8.843ON5404788581e-108
Smik_13.4928.843ON5435388551e-108
KNAG0J002608.843ON5504828541e-108
TPHA0C047908.843ON5564848521e-107
TBLA0D03280singletonON5805228541e-107
NDAI0E002808.843ON5495198471e-106
Kwal_27.102458.843ON5155228391e-106
Smik_13.188.843ON5454998411e-106
KNAG0G034308.843ON5424918411e-106
TBLA0D032708.843ON5504718421e-106
NCAS0A02540singletonON5395218391e-105
KNAG0D00130na 1ON5655238391e-105
NCAS0C004008.843ON5174798211e-103
CAGL0B02343g8.843ON5375108221e-103
NCAS0B002908.843ON5424718101e-101
KLTH0C03806g8.843ON5255248041e-100
KAFR0B039408.843ON5475237885e-98
KAFR0C04860na 1ON5344937651e-94
KAFR0A028408.843ON5204827362e-90
CAGL0L02519gna 1ON5294967258e-89
CAGL0M03003g8.843ON5584777233e-88
TBLA0C01160singletonON6005196977e-84
NCAS0A05720na 1ON5635016485e-77
NDAI0K02730singletonON6045376358e-75
TDEL0G04950singletonON5124644383e-47
SAKL0C06116gsingletonON1851262171e-19
Skud_6.16na 2ON5494511911e-14
Smik_6.24na 2ON5444481874e-14
Suva_10.11singletonON5404501857e-14
SAKL0F00440gsingletonON5444281768e-13
KLTH0H16214gsingletonON5514791634e-11
KLLA0C18931gna 3ON5532131562e-10
Kwal_34.15746na 3ON5184571501e-09
TDEL0D06610singletonON4974171402e-08
SAKL0C02178gsingletonON5651941261e-06
KLTH0G13464g8.272ON5934071206e-06
Suva_13.2652.473ON5611891133e-05
Skud_13.2442.473ON5621891133e-05
NDAI0H022002.473ON5711891134e-05
Smik_13.2722.473ON5611901081e-04
YMR088C (VBA1)2.473ON5621901082e-04
Kwal_56.237548.272ON5893161062e-04
ZYRO0A00330gsingletonON5762361054e-04
TDEL0C00120singletonON5693871044e-04
SAKL0E04246gna 4ON5651991045e-04
SAKL0H16808g8.272ON6574031045e-04
YNL065W (AQR1)2.242ON5862331028e-04
KNAG0E025602.473ON5782281010.001
AGR076C8.272ON6862141000.002
KLTH0C10120gsingletonON651157970.003
YKR105C (VBA5)singletonON582258960.004
KLLA0F17776gna 4ON553194960.004
Skud_14.2672.242ON562231940.007
Suva_14.2762.242ON562232930.009
NCAS0G029902.242ON581165930.010
YBR293W (VBA2)na 5ON474310900.020
Smik_14.2622.242ON561145900.026
SAKL0E08756g2.242ON565134890.030
KLLA0A04631g8.272ON57950890.033
Ecym_73992.473ON563181890.034
NCAS0A078102.473ON568197880.038
TPHA0F012902.242ON562132880.041
ZYRO0C01430g8.272ON59050880.043
NDAI0D048404.30ON639116880.045
Kpol_543.448.272ON64350860.071
KLTH0C10142gsingletonON573239860.075
KAFR0J009302.242ON566142840.11
Suva_4.553na 5ON562218840.12
Kwal_33.150205.180ON59786840.14
Kpol_478.34.30ON580151830.14
KLTH0G09372g2.242ON551256830.17
ZYRO0F02178gsingletonON59547830.18
TDEL0F039908.272ON631403820.19
Ecym_42988.272ON678170820.22
KLLA0E09879gsingletonON630212820.22
TBLA0G025502.242ON613134820.24
NCAS0C03460na 6ON630142810.26
Kwal_23.48242.242ON553189810.28
KLLA0D19941gsingletonON611167810.29
CAGL0J09944g2.242ON592219810.29
TPHA0G031502.473ON60064810.30
KLTH0B00132gsingletonON568397800.35
NDAI0D010202.242ON592165800.38
TBLA0F030408.272ON906188800.39
Kpol_1039.192.242ON573143800.39
KLLA0F03311g2.242ON542239790.41
KLTH0B10142gsingletonON568411790.43
YPR198W (SGE1)singletonON543236790.45
Smik_2.434na 5ON474372790.48
Suva_12.245na 7ON591113790.49
Skud_16.503singletonON543245790.52
SAKL0D15290gsingletonON20476760.53
SAKL0E08778g2.241ON600196780.63
Kwal_26.6697singletonON577239780.66
TBLA0A08520singletonON632110770.75
ZYRO0G21890gsingletonON57649770.83
TBLA0A08510singletonON633147770.85
SAKL0G13376g5.180ON62176770.90
KLTH0B03894g5.180ON60661761.2
ZYRO0G21868gna 8ON620229751.3
Kwal_26.6686singletonON56988751.3
Kwal_33.137131.155ON500134751.4
TBLA0A085304.30ON615142751.5
TPHA0A017508.272ON63630751.6
CAGL0J01375g2.473ON564189741.6
TPHA0K021604.30ON608147741.8
TDEL0G03260singletonON612142742.1
SAKL0C05588gsingletonON677143742.1
ZYRO0G15422gsingletonON54244732.3
NCAS0D04970na 7ON582113732.5
TBLA0E037902.241ON550242732.6
KNAG0I019102.242ON598155723.0
Skud_18.3singletonON590203713.9
Smik_16.81na 6ON625216714.1
KLLA0F13684g2.473ON571223714.7
ABL040W2.473ON567204705.0
Smik_17.11singletonON54451705.1
TDEL0A024902.473ON554188705.7
KNAG0E01160singletonON572208706.2
Kwal_55.19582singletonON56777706.2
TBLA0F01600singletonON567112706.4
TDEL0D06570singletonON56643696.7
Suva_10.434.30ON587132697.7
TPHA0C048308.858ON598211698.0
KLTH0E16720gsingletonON574308698.1
TPHA0F003304.30ON584116698.1
SAKL0A08228gsingletonON569129688.6
TBLA0A014201.451ON572127688.8
YLL028W (TPO1)4.30ON586132688.8
Skud_7.560na 6ON642163689.3
Smik_11.368singletonON580258689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.545
         (516 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...  1019   0.0  
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   936   0.0  
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   931   0.0  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   895   0.0  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   735   0.0  
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   712   0.0  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   675   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   362   e-119
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   362   e-119
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   351   e-115
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   350   e-114
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   345   e-112
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   339   e-110
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   338   e-110
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               337   e-109
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   337   e-109
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   336   e-109
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   335   e-108
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   333   e-108
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   333   e-108
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   332   e-107
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   333   e-107
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      330   e-106
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   327   e-106
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   328   e-106
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   328   e-106
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   328   e-106
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   327   e-105
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   327   e-105
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      320   e-103
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   321   e-103
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      316   e-101
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   314   e-100
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   308   5e-98
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     299   1e-94
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   288   2e-90
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   283   8e-89
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   283   3e-88
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   273   7e-84
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            254   5e-77
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   249   8e-75
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   173   3e-47
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...    88   1e-19
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    78   1e-14
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    77   4e-14
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    76   7e-14
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    72   8e-13
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    67   4e-11
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    65   2e-10
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    62   1e-09
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    59   2e-08
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    53   1e-06
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    51   6e-06
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    48   3e-05
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    48   3e-05
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    48   4e-05
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    46   1e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    46   2e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    45   2e-04
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    45   4e-04
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         45   4e-04
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    45   5e-04
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    45   5e-04
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    44   8e-04
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    44   0.001
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    43   0.002
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    42   0.003
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    42   0.004
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    42   0.004
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    41   0.007
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    40   0.009
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    40   0.010
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    39   0.020
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    39   0.026
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    39   0.030
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.033
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    39   0.034
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    39   0.038
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    39   0.041
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    39   0.043
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    39   0.045
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    38   0.071
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    38   0.075
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    37   0.11 
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    37   0.12 
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    37   0.14 
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    37   0.14 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    37   0.17 
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    37   0.18 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    36   0.19 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    36   0.22 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    36   0.22 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.24 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    36   0.26 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    36   0.28 
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    36   0.29 
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    36   0.29 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    36   0.30 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    35   0.35 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    35   0.38 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    35   0.39 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    35   0.39 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    35   0.41 
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    35   0.43 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    35   0.45 
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    35   0.48 
Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067...    35   0.49 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    35   0.52 
SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some ...    34   0.53 
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    35   0.63 
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    35   0.66 
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             34   0.75 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    34   0.83 
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             34   0.85 
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    34   0.90 
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    34   1.2  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    33   1.3  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    33   1.3  
Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028...    33   1.4  
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    33   1.5  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   1.6  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    33   1.6  
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    33   1.8  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               33   2.1  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    33   2.1  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    33   2.3  
NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON}               33   2.5  
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    33   2.6  
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    32   3.0  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    32   3.9  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   4.1  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    32   4.7  
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    32   5.0  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    32   5.1  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    32   5.7  
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               32   6.2  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    32   6.2  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    32   6.4  
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    31   6.7  
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    31   7.7  
TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON} Anc_8...    31   8.0  
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    31   8.1  
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    31   8.1  
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    31   8.6  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    31   8.8  
YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyami...    31   8.8  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    31   9.3  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    31   9.7  

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/516 (97%), Positives = 505/516 (97%)

Query: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60
           MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG
Sbjct: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60

Query: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180
           YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180

Query: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240
           CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL
Sbjct: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240

Query: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXX 300
           ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR     
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRAAFPL 300

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360

Query: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480

Query: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516
           MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE
Sbjct: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/516 (89%), Positives = 477/516 (92%), Gaps = 1/516 (0%)

Query: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60
           MS SS V QK+ DTN   LKK+D+V L EFDIQDE P SLLWE+AFVGVLCSAQLMTQAG
Sbjct: 1   MSTSSSVTQKNLDTNAEALKKEDKV-LSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAG 59

Query: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIG SFGTTN GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 60  LGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 119

Query: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYK G+RKNMVFSLFGA
Sbjct: 120 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 179

Query: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240
            APGGF LGAVFSS+LGQLAWWPWAYWIMGIACF LA+AGYF+IPHT MPSR ASSFKLL
Sbjct: 180 SAPGGFFLGAVFSSMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLL 239

Query: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXX 300
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGWQTPYTY LLIVGT FL IFA+IESR     
Sbjct: 240 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESRAAFPL 299

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA+SGFCA
Sbjct: 300 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359

Query: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           A+TTG+LLS TPPSTVMLFAMTAFT GTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGAKPLKGYRCSWY
Sbjct: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479

Query: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516
           MGIGLSGLGIFVAA YAWSTF KSKKR SEKQHFIE
Sbjct: 480 MGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/516 (87%), Positives = 476/516 (92%)

Query: 1   MSISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAG 60
           M++SSPV +++ D N  TLKKDDEV+ DEFD+Q+E P SLLWE+AFVGVLCSAQLMTQAG
Sbjct: 1   MTLSSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAG 60

Query: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
           LGQSLAPLHIIG SFGT NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW
Sbjct: 61  LGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120

Query: 121 YALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180
           YALWSLLAGFSVYSN+IFFDCCRAFQGMGPAFLLPNAIAILGRTYK G+RKNMVFSLFGA
Sbjct: 121 YALWSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGA 180

Query: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240
            APGGFVLGAVFSS+LGQLAWWPWAYW+MGIACF LA+AGY++IPHT MP+R  +SFKLL
Sbjct: 181 SAPGGFVLGAVFSSMLGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLL 240

Query: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXX 300
           ER+DFAGSVTGV+GLILFNFAWNQGPVVGWQTPYTY LLIVGTVFL IFAFIESR     
Sbjct: 241 ERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESRAAFPL 300

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360
                 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA+SGFCA
Sbjct: 301 LPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360

Query: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           AL TG+LLS TPPSTVM FAMTAFT GTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP
Sbjct: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480
           AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGA  LKGYRCSWY
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480

Query: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516
           +GIGLSG GIFVAA YA STF KSKKR SEKQHFIE
Sbjct: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/507 (85%), Positives = 465/507 (91%)

Query: 7   VMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLA 66
           V QK+ +T+  T K DDEV+L++F++QDETPGSL+WE AFVGVLCSAQLMTQAGLGQS+A
Sbjct: 7   VTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSIA 66

Query: 67  PLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 126
           PLHIIG SFGTTNPGQLSWFAS+YSLTVGTFILIAGRLGDIFGH+KFF+LGFFWYALWSL
Sbjct: 67  PLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSL 126

Query: 127 LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGF 186
           LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYK GKRKNMVFSLFGA APGGF
Sbjct: 127 LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGKRKNMVFSLFGASAPGGF 186

Query: 187 VLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFA 246
           VLGAVFSS+LGQLAWWPWAYWIMGIACF LA+AGYF+IPH  MPSR + SF +LERVDFA
Sbjct: 187 VLGAVFSSMLGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFA 246

Query: 247 GSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXX 306
           GSVTGVIGLILFNFAWNQGPVVGW+TPYTY+LLIVGTVFL +F FIESR           
Sbjct: 247 GSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESRAAYPLLPFAAL 306

Query: 307 SSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGY 366
           SSD AFVL CIAAGW+SFGIWIFYTWQFME+SR Q+PLLSSAQF+PVA+SGFCAA+TTG+
Sbjct: 307 SSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGF 366

Query: 367 LLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 426
           LLS TP STVMLFAMTAFT G ILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML
Sbjct: 367 LLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 426

Query: 427 SDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLS 486
           S+SMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES VNDGGA  LKGYRCSWYMGIGLS
Sbjct: 427 SNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLS 486

Query: 487 GLGIFVAAIYAWSTFKKSKKRTSEKQH 513
           GLGIFVAA+YA STF KSKK+ SEKQ+
Sbjct: 487 GLGIFVAAVYASSTFLKSKKKASEKQY 513

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/512 (70%), Positives = 406/512 (79%), Gaps = 12/512 (2%)

Query: 11  DFDTNTGTLKKDDEVVLDEFDIQDE-----------TPGSLLWETAFVGVLCSAQLMTQA 59
            F       KKDD +  +    Q +            P SLL E AFVGV+C AQLMTQA
Sbjct: 2   SFTDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQA 61

Query: 60  GLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           GLGQS+APLHIIG SFGT NPGQLSWFA+AYSLTVGTFILIAGRLGD++GHKKFF++GFF
Sbjct: 62  GLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFF 121

Query: 120 WYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFG 179
           WYALWSLLAGFSVYSN+IFFDCCRAFQG+GPA LLPNAIAILGRTY  G+RK M+ SLFG
Sbjct: 122 WYALWSLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFG 181

Query: 180 ACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKL 239
           A AP GFVLGAVFSS+ GQL WWPWAYW MGI CFFLA+AG  +IP   +P    +S   
Sbjct: 182 ATAPAGFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELD-TSVST 240

Query: 240 LERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXX 299
            +R+D  GSVTGVIGL+L NFAWNQGPVVGWQTPYTY LLIV  VFL +FAFIESR    
Sbjct: 241 YQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESRAPHP 300

Query: 300 XXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFC 359
                  SSD AFVL C+ AGW+SFGIWI+Y W F+E+ RG +PLL+SAQF+PVA+SG C
Sbjct: 301 LLPLSALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLC 360

Query: 360 AALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 419
           AALTTG++++R   S VMLFAMTAFT G ILIATAPV Q YWAQ FVSIIVMPWGMDMSF
Sbjct: 361 AALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSF 420

Query: 420 PAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSW 479
           PAATIMLSDSMPHEHQGLAASLVN VVNYSISIGLG+AGT+E  VN+GGA  LKGYR +W
Sbjct: 421 PAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAW 480

Query: 480 YMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEK 511
           YMGIGLSG GI +A +Y + TFKKSKK  SEK
Sbjct: 481 YMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/503 (68%), Positives = 402/503 (79%), Gaps = 2/503 (0%)

Query: 10  KDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLAPLH 69
           +  +     LK ++   L       E P SL+ E  FVG+L  AQLMTQAGL QS+AP+ 
Sbjct: 6   ESLEAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVR 65

Query: 70  IIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 129
           IIG SFG +NPGQLSWF++AYSLTVGTFILIAGRLGD+FGHKK FV+GF WY+LWSLLAG
Sbjct: 66  IIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAG 125

Query: 130 FSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLG 189
           FSVYSN+IFFDCCRA QG+GPAFLLPN+IAILGRTY  GKRK MVFS+FGA APGGFVLG
Sbjct: 126 FSVYSNQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGKRKQMVFSIFGATAPGGFVLG 185

Query: 190 AVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSV 249
           +VFSS+  QLAWWPWAYW MG AC  L +AG  +IP  A P +   S  +LER+D AG+ 
Sbjct: 186 SVFSSIFSQLAWWPWAYWAMGTACLVLGVAGIIVIPQ-APPPKIDISAGILERIDAAGAT 244

Query: 250 TGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSD 309
           TG++GL L NFAWNQGPVVGWQTPYTY LLIVG VFL +F+ IESR           S+D
Sbjct: 245 TGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESRARFPLLPFAALSTD 304

Query: 310 TAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLS 369
            A+VL CIAAGW+SFGIWIFY WQF+EDSR Q+PLL+SAQF PVA+SG CAALTTGY+LS
Sbjct: 305 LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILS 364

Query: 370 RTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 429
             P   VML AM AFT G +L+ATAP++QTYWAQTFVS+I+MPWGMDMSFPAATIM+S++
Sbjct: 365 HVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNA 424

Query: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLG 489
           MPHEHQGLAASLVNTVVNYSIS+ LG AGTIE+ VN+ GA  L+GYR +WYMGIGLSGLG
Sbjct: 425 MPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLG 484

Query: 490 IFVAAIYAWSTFKKSK-KRTSEK 511
           + VA +YAWST KK K ++ SEK
Sbjct: 485 VLVAIVYAWSTLKKFKEEQLSEK 507

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/493 (69%), Positives = 392/493 (79%), Gaps = 2/493 (0%)

Query: 20  KKDDEVVLDEFDIQDETP-GSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTT 78
           K +     D   +Q+     SLL E   + VLCSAQLMTQAGL QS+ PL IIG SFG  
Sbjct: 5   KLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64

Query: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIF 138
           NPGQLSWFASA+SLTVGTFILIAGRLGD FGHKKFFV+GF WYALWS+LAGFSVYSN+IF
Sbjct: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIF 124

Query: 139 FDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ 198
           FDCCRAFQG+GPAF LPNAIAI+ RTY+ G+++NM+FSLFGACAP GFV+GAVFSSLL +
Sbjct: 125 FDCCRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSE 184

Query: 199 LAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILF 258
            AWWPWAYWIMGI CF L +AGY +IPH   P        L+ER+D AGSVTGV+GLILF
Sbjct: 185 FAWWPWAYWIMGITCFLLGVAGYLVIPHHP-PIHPDEKCSLVERIDVAGSVTGVVGLILF 243

Query: 259 NFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIA 318
           NFAWNQGPVVGW+T YTY LLIVG+ FLA F FIESR           SSDT FV+ CIA
Sbjct: 244 NFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESRAKHPLLPVRKLSSDTIFVMGCIA 303

Query: 319 AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVML 378
           AGW+SFGIW++YTWQ M + R Q PLLSSAQF PVA+SG CAA++T +LL+RT PSTVM+
Sbjct: 304 AGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMI 363

Query: 379 FAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLA 438
            AM AFT G+IL+AT PV QTYWAQTFVSIIVMPWGMDMSFPAATI+LS +MP  HQGLA
Sbjct: 364 IAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLA 423

Query: 439 ASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAW 498
           ASLVNT++NYSISIGLG AGTIES ++DG    LKGYR ++YMGIGL+GLG+ VA  YA 
Sbjct: 424 ASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAI 483

Query: 499 STFKKSKKRTSEK 511
             + + K+  SEK
Sbjct: 484 FHYSRLKRSLSEK 496

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  362 bits (930), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/508 (39%), Positives = 307/508 (60%), Gaps = 18/508 (3%)

Query: 18  TLKKDDEVVLDEFDI--QDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKS 74
           T +K+  V ++E +   QD       W E  FV      QL+ QAG   +L+ + ++ + 
Sbjct: 35  TTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERE 94

Query: 75  FGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 134
             +++  + SW  +++ L  G+FILI+GRLGDI+G KK  +LG+ W  +WSL+ G S +S
Sbjct: 95  LDSSS-AKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFS 153

Query: 135 -NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSG-KRKNMVFSLFGACAPGGFVLGAVF 192
            N  FF   RAFQG+G +F+LPN + I+G  YK G +RKN+V SL G CAP G   G +F
Sbjct: 154 HNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLF 213

Query: 193 SSL--LGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVT 250
           + +  + + + WPWA++   IA F   I  YF+IP++ +P  + + F +    D+ GS  
Sbjct: 214 AGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS-IPV-NVNKFAM----DWIGSAL 267

Query: 251 GVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXX--XXXXXSS 308
           GV GL+LFNF WNQ  VVGW T Y   LLIV    +A+F   E +             S 
Sbjct: 268 GVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESR 327

Query: 309 DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLL 368
               +L+ + AGW SFGIWIFY +QF+   R  +P+ +   F  V++ G  AALT G+ +
Sbjct: 328 SIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSI 387

Query: 369 SRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSD 428
            R  P+ ++ F+M AFT G+I+++  PVH+TY+     +++++ +GMD+SFPAA+I+LSD
Sbjct: 388 KRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSD 447

Query: 429 SMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGL 488
            +  ++QG+A SLVNTVVNYS+S+ LGI GTIE  +N  G + L+G+R + Y  IG+  L
Sbjct: 448 ELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSL 507

Query: 489 GIFVAAIYAWSTFKKSKKRTSEKQHFIE 516
           GI ++ ++     K+  +  S K++ +E
Sbjct: 508 GILISGVFVLQ--KELMRSKSRKENELE 533

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  362 bits (928), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/513 (38%), Positives = 311/513 (60%), Gaps = 17/513 (3%)

Query: 10  KDFDTNTGT-LKKDDEVVLDEFD---IQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQS 64
           K+  T + T   +  +V +D+     IQD T  S  W E  F+     +QL+ QAG  Q+
Sbjct: 15  KELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQT 74

Query: 65  LAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
           L+ ++I+ K+F ++   Q +W  +++ L  G+FIL++G++GDI+G KK  ++G+    +W
Sbjct: 75  LSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIW 133

Query: 125 SLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACA 182
           SL+ G + Y++ + FF   RAFQG+G AF+LPN + I+G  Y +G  RKNMV SL GACA
Sbjct: 134 SLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACA 193

Query: 183 PGGFVLGAVFSSLLGQLA-WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLE 241
           P G  +G +FS L+G L+  W W ++   I          ++IP+T   +   SS     
Sbjct: 194 PIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS----- 248

Query: 242 RVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXX 301
            +D+ GS  G++G+ILFNF WNQGP+VGW T Y  +LLIV    +  F   E++      
Sbjct: 249 -MDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPL 307

Query: 302 XXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFC 359
                  +   +++ +A   GW SFGIW FY + F+ + R  TPL +   +    + G  
Sbjct: 308 IPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGII 367

Query: 360 AALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 419
           AA++ GY + R PPS ++  +M AF  G I+++  PV QTY+      +I++ +GMD+SF
Sbjct: 368 AAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSF 427

Query: 420 PAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSW 479
           PA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIAGT+E  +N  G   LKGYR + 
Sbjct: 428 PASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAAL 487

Query: 480 YMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512
           Y+GIGL+ LG+F++A++    + + ++R  +++
Sbjct: 488 YLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  351 bits (901), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 190/524 (36%), Positives = 296/524 (56%), Gaps = 28/524 (5%)

Query: 10  KDFDTNTGTLKKDDEVVLDEFDIQDETP---------------GSLLWETAFVGVLCSAQ 54
           K  +    +   ++ +  D  D  DE+P                S   E AF+     +Q
Sbjct: 6   KKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQ 65

Query: 55  LMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFF 114
           L+  AG  Q+L+ ++++ +   +++  ++ W  +++ L  G+FIL++GRLGDI+G KK  
Sbjct: 66  LLNLAGTTQTLSIMNVLTRQLHSSDSLKV-WLVASFPLVSGSFILVSGRLGDIYGLKKML 124

Query: 115 VLGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKN 172
           +LG+    +WSL+ G S YS+  IFF   RAFQG+G + +LPN + ++G  YK G  +KN
Sbjct: 125 ILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKN 184

Query: 173 MVFSLFGACAPGGFVLGAVFSSLLGQLAW--WPWAYWIMGIACFFLAIAGYFIIPHTAMP 230
           MV S+ GA +P G  LG +FS L+   +   WPWA++   +A F      Y+ IP+    
Sbjct: 185 MVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPT 244

Query: 231 SRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFA 290
           + +  S      +D+ GS TGV+GLILFNF WNQ P  GW + Y  +LL++  + L  F 
Sbjct: 245 NVNRLS------MDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFG 298

Query: 291 FIESRXXXXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSA 348
             E R             +     +L+ +  GW SFGIW FY + F+ + R  +PL +  
Sbjct: 299 IYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGG 358

Query: 349 QFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSI 408
            +    +SG   A++ G+L+ +  P+ ++ F+M  F  G I+ +  PVHQTY+     ++
Sbjct: 359 SYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTM 418

Query: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGG 468
           I++P GMD+SFPA++I+LSD++P++HQG+A SLVNTV+NYS S+ LGIAGT+E + N  G
Sbjct: 419 IILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNG 478

Query: 469 AKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512
              L+GYR + Y GI  SG+ + +A +Y   T   S K   EK 
Sbjct: 479 TDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  350 bits (897), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/537 (37%), Positives = 305/537 (56%), Gaps = 43/537 (8%)

Query: 4   SSPVMQKDFDTNTGTLKKDDEVVL--DE-----------FDIQDETP-------GSLLWE 43
           SSPV  K       ++K++D+V++  DE             I +++P        S   E
Sbjct: 15  SSPVNDKI------SMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKE 68

Query: 44  TAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGR 103
             F+G    AQL+ QAG   +L  ++++ KSFG+ +  Q +W  +++ L  G+FILI+GR
Sbjct: 69  LMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISGR 127

Query: 104 LGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILG 162
           LGDI+G KK  ++G+    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++G
Sbjct: 128 LGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVG 187

Query: 163 RTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIA 219
             YK G  RKN+V S+ GAC P G + G VF  L+       WPW ++  GIA F   + 
Sbjct: 188 HVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLM 247

Query: 220 GYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILL 279
            ++ IP+    + H  S      +D+ GSV  VIGLILFNF WN+ P+ GW   Y  +LL
Sbjct: 248 AWYSIPNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLL 301

Query: 280 IVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMED 337
           +V   FL  F   E +           + +   ++  +A   GW SFGIW FY   F  +
Sbjct: 302 VVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLN 361

Query: 338 SRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVH 397
            R  +P+ +   +   A+ G  AA    + + R  P+ ++ FA+ AF AG+I+ +  PV 
Sbjct: 362 LRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVE 421

Query: 398 QTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIA 457
           Q+YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+ 
Sbjct: 422 QSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 481

Query: 458 GTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIY----AWSTFKKSKKRTSE 510
            T+E  +N  G   L+GYR + Y+GIGL+ LG+ ++  Y     W+  KK ++++ E
Sbjct: 482 ATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  345 bits (884), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/522 (38%), Positives = 295/522 (56%), Gaps = 21/522 (4%)

Query: 6   PVMQKDFDTNTGT-------LKKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMT 57
           PV +   D N G         + +DE+V      Q+       W E  F+     +QL+ 
Sbjct: 23  PVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82

Query: 58  QAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLG 117
           QAG  Q+L+ ++I+  SFG+    + SW  +++ L  G+FILI+GRLGDI+G KK  ++G
Sbjct: 83  QAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVG 141

Query: 118 FFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVF 175
           +    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V 
Sbjct: 142 YVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVI 201

Query: 176 SLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRH 233
           S  GA AP G  LG +F+ L+G      WPWA++   IA F   +   + IP T   + H
Sbjct: 202 SFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIH 261

Query: 234 ASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIE 293
             S      +D+ GSV GVIGLIL NF WNQ P+ GW   Y  ++LI+  +FL +F   E
Sbjct: 262 HFS------MDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYE 315

Query: 294 SRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFS 351
            R             D   +   +A   GW SFGI+ FY +QF  + R  T L +   + 
Sbjct: 316 IRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYF 375

Query: 352 PVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVM 411
              + G  AAL  G+ +    PS  + F+M AF  G+I+ +  PVH+TY+     ++I++
Sbjct: 376 MFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIIL 435

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKP 471
            +GMD+SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ VN  G   
Sbjct: 436 SFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHL 495

Query: 472 LKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQH 513
           LKGYR + Y+GIGL+ L   ++ +Y   +F K ++  +  ++
Sbjct: 496 LKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEY 537

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  339 bits (870), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/514 (37%), Positives = 292/514 (56%), Gaps = 18/514 (3%)

Query: 9   QKDFDTNTGTLKKD--DEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSL 65
           + D +  T T+  D  +E+ +D+   Q+       W E  F+     +QL+ QAG  Q+L
Sbjct: 32  RHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTL 91

Query: 66  APLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 125
           + ++II  SFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +G+    +WS
Sbjct: 92  SIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150

Query: 126 LLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAP 183
           L+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y SG  RKN+V SL GA AP
Sbjct: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210

Query: 184 GGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFF-LAIAGYFIIPHTAMPSRHASSFKLL 240
            G  LG +F+ L+G      WPWA++   I     LA++ Y I  +     +H S     
Sbjct: 211 VGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS----- 265

Query: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXX 300
             +D+ GS  GVIGL+L NF WNQ P+ GW   Y  +LL++  VFL +F   E+R     
Sbjct: 266 --MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSP 323

Query: 301 XXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGF 358
                   D   +   +A   GW SFGI+ FY +QF  + R  + + +   +    + G 
Sbjct: 324 LLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGI 383

Query: 359 CAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418
            AAL  G  + +  PS  +  +M AF  G+I+ +  PVH+TY+     ++I++ +GMD S
Sbjct: 384 IAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFS 443

Query: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCS 478
           FPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++V+  G   LKGYR +
Sbjct: 444 FPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGA 503

Query: 479 WYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512
            Y+GIGL+ L   ++ +Y      K  K  +  +
Sbjct: 504 QYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/473 (39%), Positives = 283/473 (59%), Gaps = 13/473 (2%)

Query: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102
           E  F+     + L+ QAG  Q+ + +++IG +F   +  + +W  +++ L  G+FIL++G
Sbjct: 81  EYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSK-TWLMASFPLVSGSFILVSG 139

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAIL 161
           R+GDI+G K+  + G     +WSL+ GF+ YS+ + FF  CRAFQG+G AF+LPN + ++
Sbjct: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLV 199

Query: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACFFLAI 218
           G  YK G  RKN+V S  G CAP G   GA ++ L+   A   WPW ++    A     +
Sbjct: 200 GNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLV 259

Query: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278
              + IP T   + H  S      +D+ GSV GVIGLILFNF WN+ P+VGW+  Y  +L
Sbjct: 260 LAIYSIPDTVPVNVHGFS------MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVL 313

Query: 279 LIVGTVFLAIFAFIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFME 336
           LI   + + +F   E +             + +   +LS +  GW SFGIW FY + F+ 
Sbjct: 314 LIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLL 373

Query: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396
           + RG TPL + A      + G  AA T  + + R  PS ++  +M AFT G+I+++  PV
Sbjct: 374 NLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPV 433

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
           HQTYW  TF   I++ +GMD+SFPA++I+LSD++P E+QG+A SLVNT+VNYS S+ LG+
Sbjct: 434 HQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGM 493

Query: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTS 509
             T E  VN  G   LKGYR + Y+GIGL  +G+ +AA++ + + ++ + RT+
Sbjct: 494 GTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGRTA 546

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/524 (37%), Positives = 297/524 (56%), Gaps = 32/524 (6%)

Query: 13  DTNTGTLKKDDEV----------VLDEFDIQDETP---GSLLWETAFVGVLCSAQLMTQA 59
           +  T   ++DDE+           L E +   + P    S   E  FV     A L+ QA
Sbjct: 32  ERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQA 91

Query: 60  GLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119
           G  Q L+ +++I  SF ++  GQ +W  +++ L  G+FILI+GRLGDI+G K+  + GF 
Sbjct: 92  GQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFI 150

Query: 120 WYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSL 177
           +  +WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++G  YK G  RKN+V SL
Sbjct: 151 FMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISL 210

Query: 178 FGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHAS 235
            G  AP G   GA++  L+       WPW ++   +A     + GY+ +P   +P+ + +
Sbjct: 211 IGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDN-IPT-NVN 268

Query: 236 SFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR 295
            F +    D+ GSV GVIGLILFNF WNQGP+VGW+  Y  +LLIV  +FL  F   E +
Sbjct: 269 GFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIK 324

Query: 296 XXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353
                      + +     +L+ +  GW SFGIW FY + F  + R  +P+ S   F   
Sbjct: 325 YAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVF 384

Query: 354 AVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPW 413
            + G  AA T    + +  P+ ++ F+   FT G+I+++  PVHQTYW  TF   I++ +
Sbjct: 385 IIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVF 444

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLK 473
           GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+  T+E  +N  G   LK
Sbjct: 445 GMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLK 504

Query: 474 GYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSEKQH 513
           GYR + Y G+G++GLG  +A +      WS  K++ K   + Q 
Sbjct: 505 GYRAALYFGVGIAGLGACIAFLNVCHDIWS--KRNAKDPKDLQR 546

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/511 (37%), Positives = 285/511 (55%), Gaps = 15/511 (2%)

Query: 4   SSPVMQKDFDTNTGTL-KKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGL 61
           SSP   K+    T  L   +DEV+  +   Q+       W E  F+     +QL+ Q+G 
Sbjct: 38  SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGT 97

Query: 62  GQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
            Q+L+ ++I+  SFG+ +    SW  +++ L  G+FILI+GR+GDIFG K   ++G+   
Sbjct: 98  TQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMI 156

Query: 122 ALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFG 179
            +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V S  G
Sbjct: 157 IIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIG 216

Query: 180 ACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF 237
           A AP G  LG  F+ L+G +    WPWA++   I      I   + IP+    + H  S 
Sbjct: 217 AMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFS- 275

Query: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXX 297
                +D+ GS  GVIGL+L N  WNQ P+ GW   Y  +LLI+  +FL +F   E    
Sbjct: 276 -----MDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFA 330

Query: 298 XXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV 355
                      D   +   ++   GW SFGI+ FY +QF  + R  TPL +   +    +
Sbjct: 331 KSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLI 390

Query: 356 SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
            G  AAL  G+ + R  PS  + FAM AF  G+I+ +  PVH+TY+     ++I++ +GM
Sbjct: 391 WGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGM 450

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGY 475
           D+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+  T+E  ++  G   LKGY
Sbjct: 451 DLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGY 510

Query: 476 RCSWYMGIGLSGLGIFVAAIYAWSTFKKSKK 506
           R + Y+GIGL+ L   ++ +Y    + K  +
Sbjct: 511 RGAQYLGIGLASLACIISGLYMVECYIKDHR 541

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  336 bits (862), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/542 (36%), Positives = 294/542 (54%), Gaps = 40/542 (7%)

Query: 2   SISSPVMQKDFDTNTGTLKKDDEVVLDEFD--------------IQDETP-------GSL 40
           S  SPV+ K       ++K +D+VV+   D              + +++P        S 
Sbjct: 13  SKDSPVIDKI------SMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSF 66

Query: 41  LWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILI 100
             E  F+     AQL+ QAG   +L  ++++ KSF + +  Q +W  +++ L  G+FILI
Sbjct: 67  GRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILI 125

Query: 101 AGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIA 159
           +GRLGDI+G KK  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + 
Sbjct: 126 SGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMG 185

Query: 160 ILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFL 216
           ++G  YK G  RKN+V S  GACAP G + G +F  L+       WPW ++   IA F  
Sbjct: 186 LVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLN 245

Query: 217 AIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTY 276
            I  ++ IP+    + H  S      +D+ GSV  VIGLILFNF WNQ P  GW T Y  
Sbjct: 246 MILAWYSIPNNIPTNVHGFS------MDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYII 299

Query: 277 ILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQF 334
            LLI+   FL  F   E +           + +   ++  +A   GW SFGIW FY   F
Sbjct: 300 ALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSF 359

Query: 335 MEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATA 394
             + R  +P+ +   +    + G  AA      + R  P+ ++ FA+ AF  G+I+ +  
Sbjct: 360 QLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVL 419

Query: 395 PVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGL 454
           PV Q++W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ L
Sbjct: 420 PVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCL 479

Query: 455 GIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHF 514
           G+  T+E  +N  G   LKGYR + Y+G+GL+ LG+ ++  Y   TF  +++   +    
Sbjct: 480 GMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVI 539

Query: 515 IE 516
            E
Sbjct: 540 TE 541

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  335 bits (858), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/478 (38%), Positives = 281/478 (58%), Gaps = 17/478 (3%)

Query: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102
           E  F+     AQL+ QAG   +L  ++++ KSF +    Q +W  +++ L  G+FILI+G
Sbjct: 69  ELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQ-AWLMASFPLAAGSFILISG 127

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161
           RLGDI+G KK  ++G+    +WS+++G S YSN   FF   RAFQG+G AF+LPN + ++
Sbjct: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLV 187

Query: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218
           G  YK G  RKN+V S  GACAP G + G +F  L+       WPW ++  GIA F   +
Sbjct: 188 GHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLL 247

Query: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278
             ++ IP+    + H  S      +D+ GS   +IGLILFNF WNQ P+VGW  PY  +L
Sbjct: 248 MAWYSIPNNVPTNIHGLS------MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVL 301

Query: 279 LIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFME 336
           LI+  +FL  F   ES+           + +   ++  +A   GW SFGIW FY   F  
Sbjct: 302 LIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361

Query: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396
           + R  +P+ +   +    + G  AA    + + R  P+ ++ F++ AF AG+I+ +  PV
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPV 421

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
            Q+YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481

Query: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSE 510
            GT+E  +N  G   LKGYR + Y+G+GL+ LG+ ++  Y     W+  +KS+ R+ E
Sbjct: 482 GGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  333 bits (855), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/538 (36%), Positives = 299/538 (55%), Gaps = 39/538 (7%)

Query: 7   VMQKDFDTNTGTLKK-DDEVVLDEFD--------------IQDETP-------GSLLWET 44
           V   D+  +  T+ K DD+VV+   D              + +++P        S   E 
Sbjct: 11  VQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKEL 70

Query: 45  AFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRL 104
            F+     AQL+ QAG   +L  ++++ KSF + +  Q +W  +++ L  G+FILI+GRL
Sbjct: 71  MFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQ-AWLMASFPLAAGSFILISGRL 129

Query: 105 GDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGR 163
           GDI+G KK  ++G+    +WS+++G S YSN   FF  CRAFQG+G AF+LPN + ++G 
Sbjct: 130 GDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGH 189

Query: 164 TYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAG 220
            YK G  RKN+V S+ GACAP G + G VF  L+       WPW ++   IA F   +  
Sbjct: 190 VYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMA 249

Query: 221 YFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLI 280
           ++ IP+    + H  S      +D+ GS   V+GLILFNF WNQ P+ GW   Y  +LLI
Sbjct: 250 WYSIPNNVPTNVHGLS------MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLI 303

Query: 281 VGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDS 338
           +   FL  F   E +           + +   ++  +A   GW SFGIW FY   F  + 
Sbjct: 304 LSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNL 363

Query: 339 RGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQ 398
           R  +P+ +   +    + G  AA    + + R  P+ ++ FA+ AF AG+I+ +  PV Q
Sbjct: 364 RHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQ 423

Query: 399 TYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAG 458
           +YW   F    ++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+  
Sbjct: 424 SYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGV 483

Query: 459 TIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSEKQ 512
           T+E  +N  G   LKGYR + Y+GIGL+ LG+ ++  Y     W+  K+S+K+  E +
Sbjct: 484 TVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEAE 541

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  333 bits (854), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/482 (38%), Positives = 269/482 (55%), Gaps = 14/482 (2%)

Query: 22  DDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNP 80
           + E   ++   Q+ T  +  W E AF+     AQL+ QAG  Q+ AP++I+  +F ++  
Sbjct: 52  ESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAK 111

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFF 139
            Q +W  +++ L  G+FIL++GR+GDI+G KK  + G+    +WSL+ GF+ Y+ N  FF
Sbjct: 112 KQ-TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFF 170

Query: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQ 198
             CRAFQG+G AF+LPN + ++G  YK+   RKN V S  G CAP G  LG V+S L+  
Sbjct: 171 ILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAH 230

Query: 199 L--AWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256
                WPW ++   I      +   + IP T   + H         +D+ GS  GV+G+I
Sbjct: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG------MDWTGSAIGVVGMI 284

Query: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXX--XXXXSSDTAFVL 314
           LFNF WNQGP+ GW   Y   LLIV    L  F   E +             +     +L
Sbjct: 285 LFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMIL 344

Query: 315 SCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPS 374
             +  GW SFGIW FY + F  + R  + + +   F    + G  AA      + R  PS
Sbjct: 345 LAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPS 404

Query: 375 TVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434
            ++ F+MT FT G I+++  PVHQ+YW       I++ +GMD+SFPA++I+LSD +P ++
Sbjct: 405 VLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQY 464

Query: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAA 494
           QG+A SLVNT+VNYS S+ LG+  T E+ VN  G   LKGYR + Y+GIGL   G+ VA 
Sbjct: 465 QGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAF 524

Query: 495 IY 496
            Y
Sbjct: 525 CY 526

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  332 bits (852), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/484 (36%), Positives = 280/484 (57%), Gaps = 13/484 (2%)

Query: 39  SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFI 98
           S L E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  +++ L  G+FI
Sbjct: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFPLVSGSFI 131

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNA 157
           L+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G +F+LPN 
Sbjct: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI 191

Query: 158 IAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACF 214
           I ++G  Y+ G  +KN+  S  GA AP G   G +FS ++       WPW ++   I  F
Sbjct: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251

Query: 215 FLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPY 274
            + +  YF +P   +P+   +      ++D+ GS  GV+GL+LF+F WNQ P+ GW   Y
Sbjct: 252 LVGVTCYFFVPDN-VPTNTNN-----LKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 275 TYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIA--AGWASFGIWIFYTW 332
             +LL++  + +  F   E             + +   ++  +A   GW +FGIW FY +
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 333 QFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIA 392
            F  + R  +P+ +   +    +SGF  A   G+L+    PS +++ ++T FT G ++ A
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 393 TAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISI 452
             P  QTYW  TF  ++++P GMD+SFPA++I+LSD +P E+QG+A SLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 453 GLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512
            LG+A T+E  +N  G   LKGYR ++Y G+G+  LGI +A++Y + TF    K  ++  
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 513 HFIE 516
           + IE
Sbjct: 546 NDIE 549

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  333 bits (854), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/522 (35%), Positives = 303/522 (58%), Gaps = 24/522 (4%)

Query: 2   SISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGL 61
           SISS  +  D D N+  L+ +++V+  ++  ++ T      E  F+     +Q M+QAGL
Sbjct: 65  SISS--VSNDSDINSENLQSENKVLSPKY-FKNRTH-----EYLFIISCMVSQFMSQAGL 116

Query: 62  GQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
            Q+L+ ++I+ +        Q +W  ++++L++G+FIL++GRLGDI+G KK  + G+   
Sbjct: 117 TQALSIMNILAEELNAEKSRQ-AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAIL 175

Query: 122 ALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFG 179
            +WSL+ GFS YS N  FF   RAFQG+G AF+LPN++ ++G  Y+ G  +KNM+    G
Sbjct: 176 TIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLG 235

Query: 180 ACAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF 237
           A +P G  LG +F+ ++G      WPW+++  GI  F   I  ++ IP+    + +  S 
Sbjct: 236 AMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLS- 294

Query: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXX 297
                +D+ G++ G+ GL++ NF +NQ P+VGWQ+ Y  +LL++    L IF   E +  
Sbjct: 295 -----MDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYA 349

Query: 298 XXXXXXXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV 355
                    SS+   ++   A   GW +FG W FY + F+ + RG T   +   +    V
Sbjct: 350 KTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIV 409

Query: 356 SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
           SG   A   G+++ + PPS ++  +M  F  G +++   P+HQ+Y+      + V+P G+
Sbjct: 410 SGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGI 469

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGY 475
           D+SFPAA+I+LSD++P ++QG+A SLV T+ NYS SI LG+AG++E+  ND G   LKGY
Sbjct: 470 DLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGY 529

Query: 476 RCSWYMGIGLSGLGIFVAAIY---AWSTFKKSKKRTSEKQHF 514
           R +      L+GLGI V+ IY      T +++ K T++ +H 
Sbjct: 530 RNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNKPKHL 571

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  330 bits (847), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 302/519 (58%), Gaps = 30/519 (5%)

Query: 18  TLKKDDEVVLDEF---DIQDETPGSL-----------LW-ETAFVGVLCSAQLMTQAGLG 62
           T ++++EV  DE    + +D T G              W E  F+     +QL+ QA   
Sbjct: 35  TKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATP 94

Query: 63  QSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 122
           Q+L+ ++II  SF  +  G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+ ++ 
Sbjct: 95  QTLSIMNIITDSF-KSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFI 153

Query: 123 LWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNMVFSLFGA 180
           +WSL++GF+ YS N IFF   RAFQG+G AF+LPN + I+G  YK   +RKN+V S+ GA
Sbjct: 154 IWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGA 213

Query: 181 CAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFK 238
            AP G  +G++F+ L+G      WPWA++   IA         + IP+    + H  +  
Sbjct: 214 SAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFA-- 271

Query: 239 LLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXX 298
               +D+ GS+  VIGLIL NF WNQGP+VGWQ  Y  +LLI+  + L +F   E +   
Sbjct: 272 ----MDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK 327

Query: 299 XXXXXXXXSSDTA--FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVS 356
                   + +     +L+ +  GW SFGI+ FY + F+ + R  + L +   +   A+ 
Sbjct: 328 SPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIW 387

Query: 357 GFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
           G  AA+  G  + R   S ++ F+M AF  G I+++  PV QTY+     ++I++ +GMD
Sbjct: 388 GTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMD 447

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYR 476
           MSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  G + LKGYR
Sbjct: 448 MSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYR 507

Query: 477 CSWYMGIGLSGLGIFVAAIYAWSTF--KKSKKRTSEKQH 513
            + Y+G+GL+GLGI ++ IY       K+ ++ +S + H
Sbjct: 508 AAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDH 546

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  327 bits (839), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/522 (37%), Positives = 296/522 (56%), Gaps = 29/522 (5%)

Query: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQDET--PGSLLWE--------TAFVGVLCS--AQL 55
           M+++ D       +      +E D Q E   P S L            ++ VL S  +QL
Sbjct: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62

Query: 56  MTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFV 115
           + QA   Q+     ++ K        Q  W  +++ L  G+FIL++G++GDI+G KK  +
Sbjct: 63  LNQAATTQTNPLFDVLSKDL-NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121

Query: 116 LGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNM 173
            G+    +WSL+ G S Y++ + FF   R+FQG+G AF+LPN + I+G  YK + + KN+
Sbjct: 122 GGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181

Query: 174 VFSLFGACAPGGFVLGAVFSSLLG-QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSR 232
           VFSL GACAP G  LG VFS L+G +   W W ++   I      +   +IIP+  +P+ 
Sbjct: 182 VFSLIGACAPIGATLGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNN-IPT- 239

Query: 233 HASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFI 292
           + + +K+    D+ GS  GV GLILFNF WNQ P+ GW + Y  +LLIV  V L  F   
Sbjct: 240 NVNEYKM----DWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITY 295

Query: 293 ESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 350
           E R             +     +LS +  GW SFGIW FY   FM + R  +PL +   +
Sbjct: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355

Query: 351 SPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIV 410
              A+ G  A+L  GY + +T P+ ++  +M AF  G I++A  PVHQTY+  T   +I+
Sbjct: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415

Query: 411 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAK 470
           + +GMD+SFPAA+I+LSD +P ++QG+A SLV+T+++YS+S+ LGI+GT E  VN  G  
Sbjct: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475

Query: 471 PLKGYRCSWYMGIGLSGLGIFVAA---IYAWSTFKKSKKRTS 509
            LKGY+ + Y+GIGL+ LG+ ++    I  W T +  +KRT+
Sbjct: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR--RKRTT 515

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/499 (38%), Positives = 285/499 (57%), Gaps = 14/499 (2%)

Query: 22  DDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNP 80
           +DE+V      Q+       W E  F+     +QL+ QAG  Q+L+ ++I+  SFG+   
Sbjct: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFF 139
            + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  FF
Sbjct: 109 SK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167

Query: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLG- 197
             CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ L+G 
Sbjct: 168 IICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGT 227

Query: 198 -QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256
                WPWA++   IA         + IP+    + H  S      +D+ GSV GVIGLI
Sbjct: 228 ENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFS------MDWIGSVLGVIGLI 281

Query: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSC 316
           L NF WNQ P+ GW   Y  ++LI+  +FLA+F   E               D   +   
Sbjct: 282 LLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIM 341

Query: 317 IAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPS 374
           +A   GW SFGI+ FY +QF  + R  T L +   +    + G  AAL  G+ +    PS
Sbjct: 342 LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS 401

Query: 375 TVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434
             + F+M AF  G+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E+
Sbjct: 402 VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY 461

Query: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAA 494
           QG+A SLVNTVVNYS+S+ LG+  T+E+ ++  G   LKGYR + Y+GIGL+ L   ++ 
Sbjct: 462 QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG 521

Query: 495 IYAWSTFKKSKKRTSEKQH 513
           +Y   +F    K  +  ++
Sbjct: 522 LYMVESFINDHKAKAATEN 540

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/491 (38%), Positives = 285/491 (58%), Gaps = 18/491 (3%)

Query: 33  QDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYS 91
           QD T     W E  FVG    +QL+ QA + Q+L+ ++I+ KSF +    Q +W  +++ 
Sbjct: 57  QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQ-TWLMASFP 115

Query: 92  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGP 150
           L  G+FILI+GR+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G 
Sbjct: 116 LVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGV 175

Query: 151 AFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYW 207
           AF+LPN +  +G  YK    RKN+V SL GACAP G  +GA F+ L+G      WPW+++
Sbjct: 176 AFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235

Query: 208 IMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPV 267
            M IA     +   + IP+    + H  S      +D+ GS   V+GLIL NF WNQGP+
Sbjct: 236 AMAIASTLTLLGALYSIPNHIPTNVHGFS------MDWIGSGLAVVGLILLNFVWNQGPI 289

Query: 268 VGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAA--GWASFG 325
            GW   Y  +LLIV    L +F   E             + +   V+  +A   GW SFG
Sbjct: 290 DGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFG 349

Query: 326 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFT 385
           I+ FY + F+ + R  + + +   +   A+ G  A++  G  + +   S ++ F+M AF 
Sbjct: 350 IFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFD 409

Query: 386 AGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 445
            G I+++  PV QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+
Sbjct: 410 VGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTM 469

Query: 446 VNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTF 501
           VNYS+S+ LG+  T+ES +N  G   LKGYR + Y+GIG++ L + ++ IY     W   
Sbjct: 470 VNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDR 529

Query: 502 KKSKKRTSEKQ 512
           K+  + TSE  
Sbjct: 530 KERMESTSETN 540

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/471 (38%), Positives = 276/471 (58%), Gaps = 15/471 (3%)

Query: 54  QLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113
           QL++QAGL Q+L+ ++++ K   +T+  Q +W  S++ L +G+FIL++GRLGDI+G KK 
Sbjct: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQ-AWLMSSFPLALGSFILVSGRLGDIYGLKKI 143

Query: 114 FVLGFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RK 171
            + G+    +WS++ G S Y+ N  FF   RAFQG+G AF LPN I ++G  Y+ G  RK
Sbjct: 144 LLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRK 203

Query: 172 NMVFSLFGACAPGGFVLGAVFSSLLGQL--AWWPWAYWIMGIACFFLAIAGYFIIPHTAM 229
           NM+ S+ GA +P G  LG +F+ L  +   + WPW+++  G+  F   I  ++ IP++  
Sbjct: 204 NMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIP 263

Query: 230 PSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIF 289
            + H        ++D+ GSV GV GLI+ NF +NQ P+VGWQ+ Y  +LL++    L IF
Sbjct: 264 TNIHG------LKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIF 317

Query: 290 AFIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSS 347
              E +           SS+     +L  +  GW SFGIW FY + F  + R  +PL + 
Sbjct: 318 VVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAG 377

Query: 348 AQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVS 407
           + +    +SG   A+  G  + +  PS +   +M  F  G I+ A  PV+QT++      
Sbjct: 378 SSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGC 437

Query: 408 IIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDG 467
           + ++P GMD SFPA++I+LSDS+P ++QG+A SLVNTV+NYS SI LG+AGT+E   N  
Sbjct: 438 MFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSH 497

Query: 468 GAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSE--KQHFIE 516
           G   L GYR + Y  IGL+GL + V+  Y      K +  + E  KQ  IE
Sbjct: 498 GKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/521 (34%), Positives = 295/521 (56%), Gaps = 17/521 (3%)

Query: 2   SISSPVMQKDFDTNTGTLKKD--DEVVLDEFDIQDETPGSLLWETAFVGVLCS-AQLMTQ 58
           ++S P   K+   N   +  +  D V+ D+   Q+    S  ++  F    C  A L+ Q
Sbjct: 18  TVSFPNEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQ 77

Query: 59  AGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           AG  Q L+ +++I +SF  ++ G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+
Sbjct: 78  AGQTQVLSTMNVISESF-HSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 136

Query: 119 FWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFS 176
            +  +WSLL GF+ ++ N  FF  CRAFQG+G +F+LPN + ++G  YK G  RKN+V S
Sbjct: 137 IFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVIS 196

Query: 177 LFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHA 234
           + G  AP G  +GA++  L+       WPW ++   +      I   + +P+    + H 
Sbjct: 197 MIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHN 256

Query: 235 SSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIES 294
            +      +D+ GS+ GV+GLILFNF WNQGPV GW   Y  +LLI+  +FL  F   E 
Sbjct: 257 FA------MDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYEL 310

Query: 295 RXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352
           +           + +     +LS +  GW +FGIW FY + F  + R  +P+     +  
Sbjct: 311 KYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFM 370

Query: 353 VAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMP 412
             + G  AAL   + + +  P+ ++ F+   FT G+++++  P+HQ YW       I++ 
Sbjct: 371 FIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILC 430

Query: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPL 472
           +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NY+ S+ LG+  T+E  +N  G   L
Sbjct: 431 FGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLL 490

Query: 473 KGYRCSWYMGIGLSGLGIFVAAI-YAWSTFKKSKKRTSEKQ 512
           KGYR + Y+ +GL GLG  +A I   ++ + K + R ++ +
Sbjct: 491 KGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLADLK 531

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/523 (38%), Positives = 297/523 (56%), Gaps = 17/523 (3%)

Query: 4   SSPVMQKDFDTNTGTLKKDDEVVLDEFDI----QDETPG-SLLWETAFVGVLCSAQLMTQ 58
            S   ++D D N   + K      +E D     ++ T   SLL E  FV ++ S+Q++  
Sbjct: 35  DSSKTRRDSDDNVSDINKSAPAP-EEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGL 93

Query: 59  AGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           AG  Q +  + +I + F  T+P    W    Y+ T G+F+LIAG++GD+ GHK  F++G+
Sbjct: 94  AGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGY 153

Query: 119 FWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSL 177
            W ALWSLL GFS Y  +  FF  CRA QG+G AF   +A++ILG++Y   KRKN +FS 
Sbjct: 154 AWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCKRKNFIFSF 213

Query: 178 FGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF 237
           FGAC   G VLG VFS+L  QLA W WAYW M IAC  + I   F IP   +     S+ 
Sbjct: 214 FGACGSFGVVLGMVFSALFTQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSN- 272

Query: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXX 297
             +   D+ G+   V GL+LF+ AWNQ P  G+   Y Y+LLIV  V LA+  ++E++  
Sbjct: 273 --VFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVD 330

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSG 357
                    S++T  VL  I   +ASF +W  YT++F   ++G T LL++A+ +P+AVSG
Sbjct: 331 DPLLPWTHISANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSG 390

Query: 358 FCAALTTGYLLS-RTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416
             AAL +  LL+        ML ++ AF    IL+AT    QTYW + FV+ IV+ +G+D
Sbjct: 391 VFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLD 450

Query: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI-----ESNVNDGGAKP 471
           +SFP+AT++LS+ +P + +GL ASLV  V+NY+ ++G   A ++        +   G   
Sbjct: 451 ISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAF 510

Query: 472 LKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKK-SKKRTSEKQH 513
            K      Y+GIG +GLG  VA     + + K + K+  +++H
Sbjct: 511 TKTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGEDRKH 553

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/479 (37%), Positives = 282/479 (58%), Gaps = 14/479 (2%)

Query: 39  SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFI 98
           S L E  F+     A L+ QAG  Q L+ +++I +SF  ++ G  +W  +++ L  G+FI
Sbjct: 36  SHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESF-HSDVGTQTWLMASFPLVSGSFI 94

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNA 157
           LI+GR+GDI+G KK  + G+ +  +W+LL GF+ Y++   FF  CRAFQG+G +F+LPN 
Sbjct: 95  LISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNI 154

Query: 158 IAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACF 214
           + ++G  YK G  RKN+V SL G  AP G  +GA++  L+   +   WPW ++   +A F
Sbjct: 155 MGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAF 214

Query: 215 FLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPY 274
              I   + +P     + H  +      +D+ G++ GV+GLILFNF WNQGPV GW  PY
Sbjct: 215 VNLIMAIYSVPENVPTNVHNFA------MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPY 268

Query: 275 TYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAF--VLSCIAAGWASFGIWIFYTW 332
             +LLI+  +FL  F   E +           + +     +L  +  GW SFGIW FY +
Sbjct: 269 IIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSFGIWTFYYY 328

Query: 333 QFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIA 392
            F  + R  +PL + A      + G  AA   G+ ++R  P+ ++ F+   FT G+++++
Sbjct: 329 AFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGFTMGSLMLS 388

Query: 393 TAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISI 452
             P+HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT++NYS S+
Sbjct: 389 VTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTIINYSTSL 448

Query: 453 GLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAI-YAWSTFKKSKKRTSE 510
            LG+  T+E  +N  G + L+GYR + Y+ +GL GLG  VA +   +  ++K K R  +
Sbjct: 449 CLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRKRKSRLDD 507

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 290/510 (56%), Gaps = 26/510 (5%)

Query: 20  KKDDEVVLDE--FDIQ----------DETPGSLLWETAFVGVLCSAQLMTQAGLGQSLAP 67
           K+D+  ++DE   D Q           E   S L E  F+     +QL+ QAG  Q+   
Sbjct: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++I+  S  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  +WSL+
Sbjct: 87  MNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145

Query: 128 AGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSG-KRKNMVFSLFGACAPGG 185
            G + Y++   FF   RAFQG+G + +LPN + I+G  Y +G KRKNMV SL G  AP G
Sbjct: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205

Query: 186 FVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
             LGAVFS L+G      WPWA++   I      +   ++IP+T   + H        ++
Sbjct: 206 ATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG------HKM 259

Query: 244 DFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXX---XX 300
           D+ GS  GV+GLI+ NF WNQ P+ GW + Y  +LLI+  + L  F   E          
Sbjct: 260 DWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLL 319

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360
                 S  T  VL  +  GW SFGI+ FY + F  + R  TPL +   +    + G  A
Sbjct: 320 PKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVA 379

Query: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420
           AL  G+ + +  PS ++  +M AF  G+I+++  P+HQTY+      +I++ +GMD+SFP
Sbjct: 380 ALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFP 439

Query: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480
           A++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E +VN+ G   LKGYR ++Y
Sbjct: 440 ASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFY 499

Query: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSE 510
           +GIGL+ +   ++     S   + +K   +
Sbjct: 500 LGIGLASMACIISGALMLSEIIQGRKNEKD 529

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/471 (38%), Positives = 278/471 (59%), Gaps = 13/471 (2%)

Query: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102
           E  F+     +QL+ QA   Q+L+ ++II  SF +   G+ +W  +++ L  G+FILI+G
Sbjct: 68  EYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEG-GKETWLIASFPLVSGSFILISG 126

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161
           R+GDI+G KK  V G+ ++ +WS+++G + YS+   FF   RAFQG+  AF+LPN + I+
Sbjct: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIV 186

Query: 162 GRTYK-SGKRKNMVFSLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAI 218
           G  YK    RKN+V S+ GA AP G   G++F+ L+G      WPWA++   IA  F   
Sbjct: 187 GNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLA 246

Query: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278
              + IP++   + H  +      +D+ GSV  VIGLIL NF WNQGP+VGWQT Y   L
Sbjct: 247 ISIYSIPNSVPTNVHGFA------MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIAL 300

Query: 279 LIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTA--FVLSCIAAGWASFGIWIFYTWQFME 336
           L+V   FLA+F   E +           + +     +L+ +  GW SFGI+ FY + F+ 
Sbjct: 301 LVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLL 360

Query: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396
           + R  + L +   +   A+ G  AA+  G  + +   + ++  +M AF  G I+++  PV
Sbjct: 361 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV 420

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
            QTY+     ++I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+
Sbjct: 421 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 480

Query: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKR 507
             T+E  +N  G   LKGYR + Y+GIGL+GLGI + AIY        +K+
Sbjct: 481 GTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/524 (36%), Positives = 293/524 (55%), Gaps = 27/524 (5%)

Query: 2   SISSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAG 60
            IS  V+    D++     +      D FD Q        W E  FV     +QL+ QA 
Sbjct: 16  DISRKVVDNHEDSDMLLASRSRLQNPDYFDKQ--------WKEYLFVISSMLSQLLNQAA 67

Query: 61  LGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
             Q+     ++ +        Q +W  +++ L  G+FIL++G++GDI+G KK  + G+  
Sbjct: 68  ALQANPLFDLLSEDL-KAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAV 126

Query: 121 YALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNMVFSLF 178
             +WSL+ G S Y++ + FF   R+FQG+G AF+LPN   I+G  YK + K KNMVFS+ 
Sbjct: 127 VVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI 186

Query: 179 GACAPGGFVLGAVFSSLLG-QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF 237
           GACAP G  LG +FS L+G +   W W ++   I      +  +++IP     + H   F
Sbjct: 187 GACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH--KF 244

Query: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXX 297
           K+    D+ GS  GV GLI+FNF WNQ P  GW + Y  +LL++  + L IF   E+R  
Sbjct: 245 KM----DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFA 300

Query: 298 XXXX--XXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV 355
                      +     +L+ +  GW SFGIW +Y   F+ + R  TPL +   +   A+
Sbjct: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360

Query: 356 SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGM 415
            G  AA   G+ + +T P+ ++L ++ AF  G I+++  PV QTY+  +  +++++ +GM
Sbjct: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420

Query: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGY 475
           D+SFPA++I+LSD +P ++QG+A SLVNT++NYS+S+ LG++GT E  VN  G   LKGY
Sbjct: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480

Query: 476 RCSWYMGIGLSGLGIFVAAIYA---WSTFKKSKK---RTSEKQH 513
           R + Y+GIGL+ +GIFV+  YA   W T ++ +    +  EK  
Sbjct: 481 RAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQ 524

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  308 bits (788), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 180/523 (34%), Positives = 277/523 (52%), Gaps = 26/523 (4%)

Query: 9   QKDFDTNTGTLKKDDEVVLDEFDI---------QDETPGSLLW-ETAFVGVLCSAQLMTQ 58
           Q   D  + ++KKD   + D+ D+         QD T     W E  F+G    A L+ Q
Sbjct: 30  QTSLDVLSDSVKKDQISITDD-DVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQ 88

Query: 59  AGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGF 118
           AG  Q+L+ ++++  S  +    + +W  ++++L  G+FIL++GR+GDI+G K  F+ G 
Sbjct: 89  AGQTQTLSTMNVLADSLNSDGAAK-TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGN 147

Query: 119 FWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFS 176
             + +WS+L G S Y+  + FF  CRAFQG+G AF+LPN + ++G  Y  G  RKN+V S
Sbjct: 148 IIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVIS 207

Query: 177 LFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHA 234
             G  AP G   G ++  L+       WPW ++   IA F   I G + IP+      H 
Sbjct: 208 FIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPN------HV 261

Query: 235 SSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIES 294
            +     ++D+ GS+ GVIGLIL NF WNQ P+ GW   Y  ++LIV   FL  F   E 
Sbjct: 262 PTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYEL 321

Query: 295 RXXXXXXXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352
           +           + +   V   I+   GW +FGIW FY + F  + R  +PL + +    
Sbjct: 322 KKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFV 381

Query: 353 VAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMP 412
             + G   A+T  + +++  PS +   +   FT G I+ +     QTYW  +    I++ 
Sbjct: 382 FIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILA 441

Query: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPL 472
            GMD+SFP ++I+LSD +P ++QG++ SLVNT+ NY+ S+ LG+  T E   N+GG   L
Sbjct: 442 LGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVL 501

Query: 473 KGYRCSWYMGIGLSGLGIFVAAIYAWSTF--KKSKKRTSEKQH 513
           KGYR + Y+ IGL  LG   +  Y       +  K+R +EK+ 
Sbjct: 502 KGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  299 bits (765), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/493 (37%), Positives = 278/493 (56%), Gaps = 17/493 (3%)

Query: 34  DETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQ---LSWFASA 89
           DE P ++ + E   V ++ S Q ++  G  Q +  +  I  +F +  P Q   L W  +A
Sbjct: 38  DEHPLNMQFKEIIIVLLISSGQFISLLGAVQGIPQMASIASTF-SLRPDQNLELGWCNAA 96

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS--NKIFFDCCRAFQG 147
           Y+ T  TF++IAG+LGDI GHK  F+ G+ W  LWSLL GFS Y+  N +FF  CR  QG
Sbjct: 97  YATTATTFVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQG 156

Query: 148 MGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYW 207
           +G AFL P  +A+LG+ Y   KRKN VFS +GAC P G V G+VFS+L  QL  W W YW
Sbjct: 157 IGSAFLTPTGLALLGKHYPPCKRKNYVFSFYGACGPFGIVAGSVFSALFTQLTTWAWTYW 216

Query: 208 IMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPV 267
            M + C  + I  Y  IP    P R  S+F      D+ G   G+ G+ILF+  WNQ P+
Sbjct: 217 SMAVTCLIITILSYIFIPKDNTPKRERSAFY---SFDYVGGFCGITGMILFSVVWNQAPL 273

Query: 268 VGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIW 327
             ++ PY Y LLIV  VF+ +   I+SR            S+    L  +  G+  F IW
Sbjct: 274 SHFKAPYVYSLLIVSVVFMTMALIIDSRVKDPLIPWKSMCSNVIKALIVVFFGFLGFTIW 333

Query: 328 IFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTV-MLFAMTAFTA 386
           +FY+W+F   ++  + LL++A+F P+ +SG  AA  +  LL++  P  + +L A+ AF  
Sbjct: 334 LFYSWRFYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLI 393

Query: 387 GTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVV 446
             ILI+T  + +TYW   FV+ +++  G+D++FP+AT++LS+ + +E QGLAA+L  T +
Sbjct: 394 CAILISTMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATAL 453

Query: 447 NYSISIGLGIAGTIES-NVNDGGAKP----LKGYRCSWYMGIGLSGLGIFVAAIYAWSTF 501
           NY  ++G G+A  I +   +D  A+     +     + Y+ IG +G+ + VA   + + +
Sbjct: 454 NYGTALGPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEY 513

Query: 502 KKSK-KRTSEKQH 513
            K +     EK+ 
Sbjct: 514 YKERMDDLREKKR 526

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  288 bits (736), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 176/482 (36%), Positives = 272/482 (56%), Gaps = 18/482 (3%)

Query: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQDETPG---SLLWETAFVGVLCSAQLMTQAGLGQS 64
           +Q D   +  + +K + +V ++   QD  PG   +   E  FVG   + QL+ QA   Q+
Sbjct: 13  IQSDISIDKSSNEKCEVIVREKSKWQD--PGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70

Query: 65  LAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124
           L+ ++++  SF ++   Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +W
Sbjct: 71  LSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129

Query: 125 SLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACA 182
           SL+ GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  A A
Sbjct: 130 SLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189

Query: 183 PGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240
           P G  +G  F+ L+     + WPW+++   IAC F  +   + IP + +P+ + + FK+ 
Sbjct: 190 PVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIP-SNIPT-NVNGFKM- 246

Query: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXX 300
              D+ GS   V GLILFNFAWNQGP+VGW   Y  +LLI+  +F+  F   E       
Sbjct: 247 ---DWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSP 303

Query: 301 XXXXXXSSDTAFVLSCIAA--GWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGF 358
                 +     +++      GW S+GIW FY + F+ + R  +P+ +   +    + G 
Sbjct: 304 LIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGV 363

Query: 359 CAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418
            A+   G  + +     ++LF+M  F  GT L++ APV Q+Y+  T   + ++  G+D S
Sbjct: 364 LASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTS 423

Query: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCS 478
           FPAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E  +N  G   LKGYR +
Sbjct: 424 FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483

Query: 479 WY 480
            Y
Sbjct: 484 EY 485

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  283 bits (725), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 176/496 (35%), Positives = 265/496 (53%), Gaps = 14/496 (2%)

Query: 27  LDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNP---GQL 83
           L E D     P + + E   V +L S+QL+T  G  Q + P+    +      P   G +
Sbjct: 22  LTEVDTSIRLPKTWIREIFLVIILISSQLVTLIGAVQGV-PIAAYLRERYRIEPAKGGLV 80

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS--NKIFFDC 141
            W  ++Y L     +LIAG+LGD+ GHK+  V G+ W  +WSL+ GFS Y   N+ F+  
Sbjct: 81  GWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYT 140

Query: 142 CRAFQGMGPAFLLPNAIAILGRTY-KSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLA 200
            RA QG+G  F++PN++AI+GRTY + G +K ++FS+FG     GFV+G  FSSL  QL 
Sbjct: 141 ARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT 200

Query: 201 WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNF 260
            W W YW +   C    +     IP   +  +  +S  L +R D+ G++TGV GL+LF+ 
Sbjct: 201 KWAWNYWALACVCVLYTVGAILFIPPDNIVHK-PNSKPLYKRFDYLGAITGVSGLVLFDV 259

Query: 261 AWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAAG 320
           A+ Q   +GW  P+TYI LI+G + + I  F++ R            +D   +L C+  G
Sbjct: 260 AFTQASALGWSPPHTYITLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYFG 319

Query: 321 WASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAAL-TTGYLLSRTPPSTVMLF 379
           + SF IW  + WQF E     +PL  +A+  P+A+    AA+ T   L       T+M+ 
Sbjct: 320 FLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVI 379

Query: 380 AMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAA 439
           +M  F    IL+AT   + TYWAQ FVS I+ P+ +D++ P AT++ SDS+  E QG+AA
Sbjct: 380 SMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAA 439

Query: 440 SLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKG-----YRCSWYMGIGLSGLGIFVAA 494
           SL+ TV++Y+ISIG      +   V   G     G        ++  GI LSG+G+  A 
Sbjct: 440 SLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAV 499

Query: 495 IYAWSTFKKSKKRTSE 510
           I     +K ++    +
Sbjct: 500 IAGLIDYKITRTHCGD 515

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  283 bits (723), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 180/477 (37%), Positives = 271/477 (56%), Gaps = 15/477 (3%)

Query: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102
           E  F+     AQL+ QAG  QSL+ ++++   F  +N  +  W  +++ L  G+FILI+G
Sbjct: 85  EVMFIISCMVAQLLNQAGQTQSLSTMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISG 143

Query: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161
           RLGDI+G KK   +G+    LWS++ G + Y+N   FF  CR+FQG+G AF+LPN + ++
Sbjct: 144 RLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203

Query: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218
           G  YK G  RKN+V S  G  AP G  LGA+F  L+       WPW ++  GIA F   +
Sbjct: 204 GNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNML 263

Query: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278
              + IP+  +P+   +       +D+ GS+ GV GL+L N  WNQ P+VGW   Y  +L
Sbjct: 264 LALYSIPNN-VPTNLNN-----LNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVL 317

Query: 279 LIVGTVFLAIFAFIESRXXXXXXX--XXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFME 336
           LI+  + L IF   E +             +     +L+ +  GW SFGIW +Y + F  
Sbjct: 318 LIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQL 377

Query: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396
           + R  TPL +        + G  AA      + +  P+ ++ F+M AF  G+I+++  PV
Sbjct: 378 NLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPV 437

Query: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456
           HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTVVNYS S+ LG+
Sbjct: 438 HQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGM 497

Query: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTF--KKSKKRTSEK 511
             T+E   N  GA  LKGYR + Y+ IGL+  G+ V+ ++  +    K+ +KR   +
Sbjct: 498 GNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  273 bits (697), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 169/519 (32%), Positives = 271/519 (52%), Gaps = 25/519 (4%)

Query: 4   SSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQ 63
           ++P   K F T +  L++ D +  + F            E  FV V    Q ++Q GL Q
Sbjct: 95  ATPPDNKPFITESQNLRRPD-IFKNRFQ-----------EFGFVLVGVIGQFLSQVGLTQ 142

Query: 64  SLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYAL 123
            L+ ++I+ +   TT   Q  W  +A+ L +G  ILI+GRLGDIFG KK  +LG+    +
Sbjct: 143 VLSTMNILAEELHTTKMRQ-PWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTI 201

Query: 124 WSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGAC 181
           W+L+ GFS Y++    F   R FQG+G A  LPN   ++G  YK    +KNM+F + GA 
Sbjct: 202 WTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAM 261

Query: 182 APGGFVLGAVFS--SLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKL 239
           +P G  LG +F+  S+   +  WPW+++   I  F   I  +F IP+     ++    K+
Sbjct: 262 SPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDI--EKNPQGLKM 319

Query: 240 LERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXX 299
               D+ GS  G+ GL++ NF +NQ P+ GW + Y  +LL+V  V L +F   E      
Sbjct: 320 ----DWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANF 375

Query: 300 XXXXXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSG 357
                   S+   +L  +    GW  F IW FY + F  + R  +PL +S+    + +SG
Sbjct: 376 PLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISG 435

Query: 358 FCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 417
               +     + R  P  ++ F+M  F  G IL A  P+HQT++   F S+ + P GM  
Sbjct: 436 TIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVF 495

Query: 418 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRC 477
           SFP+A++M ++++P  ++ +A SLVN  +NY+ SI +G+AG+   N N+ G   L G+R 
Sbjct: 496 SFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRA 555

Query: 478 SWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516
           + Y+ IGLSG  +F++ +Y   +    + +  ++   I 
Sbjct: 556 ASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKENKLIN 594

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  254 bits (648), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 264/501 (52%), Gaps = 22/501 (4%)

Query: 28  DEFDIQDETPG-SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLS-- 84
           D+ +  +  PG S L E  F+ ++ S+Q ++ A   Q++  +  I   F       L   
Sbjct: 55  DQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAG 114

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNK---IFFDC 141
           W  +A+++T GTFI+ AG+L D+ G K  F+ G+ WY LWSLL G S Y+ K    FF  
Sbjct: 115 WANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFF 174

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAW 201
            R  QG+G A L P+++A+LG+ Y    +KN+VFSL+G C P G V+G VFS++  QLA 
Sbjct: 175 GRGCQGIGAAALFPSSLALLGKYYPPSCKKNIVFSLYGFCVPLGVVVGGVFSAIFTQLAH 234

Query: 202 WPWAYWIMGI-ACFFLAIAGYFIIPHTAMPSRHASSFKL---LERVDFAGSVTGVIGLIL 257
           W W YW M I + FF  I+ ++I P   + S      +    L + D+ G+   V  L+L
Sbjct: 235 WSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLL 294

Query: 258 FNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCI 317
           F   WNQ     +++   Y+ LIV  V       +E                T   L  +
Sbjct: 295 FAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEFYVDDPIIPARKIHPQTIKALLVV 354

Query: 318 AAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVM 377
              + SF IW+FY W++    R  T LL +A+F P++++GF AAL +  L+S   P  + 
Sbjct: 355 FFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIR 414

Query: 378 LFA-MTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           L A   +F    IL  T    ++YWA+ F++II++  G+D+SFP+AT++LS+ +P E +G
Sbjct: 415 LLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRG 474

Query: 437 LAASLVNTVVNYSISIGLGIAGTI-----ESNVNDGGAKP-LKGYRCSWYMGIGLSGLGI 490
           ++A+LV T +NY   IG  IA TI     +  +  G     +K    +  +GIG SG+ +
Sbjct: 475 ISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAV 534

Query: 491 FV-----AAIYAWSTFKKSKK 506
            V        Y+W T   SK+
Sbjct: 535 VVGLYGTVTEYSWETHSYSKR 555

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  249 bits (635), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 166/537 (30%), Positives = 266/537 (49%), Gaps = 69/537 (12%)

Query: 38  GSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGT--TNPGQLSWFASAYSLTVG 95
            S L +  F+ ++CS+Q +T A   Q++  +  +   F    T+  QL W  +++++T G
Sbjct: 66  NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCG 125

Query: 96  TFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVY--SNKIFFDCCRAFQGMGPAFL 153
            FI++AG+L DI   +  F+ G+ W++LW+L+ GF+ Y   N IF   CR  QG+G A L
Sbjct: 126 AFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALL 185

Query: 154 LPNAIAILGRTYKSGK-------------------------------------------- 169
            P+A+ +L + Y   +                                            
Sbjct: 186 FPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDI 245

Query: 170 ---RKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFI--- 223
               K++ FSL+GACAP G V+G +FS++  QLA WPW YW M I    L+I  YF    
Sbjct: 246 ICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLATWPWNYWSMSIVTTLLSILSYFYVVV 305

Query: 224 -IPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVG 282
            IP   + S + +S K  +  DF G + G+  LILF  +W+Q  +  ++T + Y+ L+  
Sbjct: 306 PIPVEKLDS-NPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLFS 364

Query: 283 TVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQT 342
            V        E                T   L  +   + SF  W+FYTW+   + +  +
Sbjct: 365 LVSFIAMIIWEYYFNNPIIPIRQIHPGTIKALLVVFFSYISFTQWLFYTWKLFTEVKDNS 424

Query: 343 PLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFA-MTAFTAGTILIATAPVHQTYW 401
           P+L S +F P++V+G  +A  +  L+ +  P  + L A  ++F    IL+ T  +  +YW
Sbjct: 425 PILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYW 484

Query: 402 AQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI- 460
              F SII +  G+D+SFP+AT++L++ +P E QG+ A+LV +V+NY  +IG  IA TI 
Sbjct: 485 TYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTII 544

Query: 461 ----ESNVNDGGAKP--LKGYRCSWYMGIGLSGLGIFVAAI-----YAWSTFKKSKK 506
               ES ++D   K   LKG   +  +G+G SG+ + +        Y+W T   SKK
Sbjct: 545 QYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLIGIYGTITEYSWKTKGFSKK 601

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  173 bits (438), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 135/464 (29%), Positives = 227/464 (48%), Gaps = 22/464 (4%)

Query: 40  LLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFIL 99
           L  E AFV     AQ   QAG    L  ++++  SF         +  ++Y +  G+F+L
Sbjct: 47  LCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSF------HGKFLLNSYPMVCGSFML 100

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAI 158
           I GRLG++ G+K+  + G+    L SLL G S YS + IF+  CRAFQG+G A +LPN  
Sbjct: 101 IGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFS 160

Query: 159 AILGRTYKS---GKRKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIAC 213
           A     Y+S     RK ++ ++ G  A  G  LG   S +      + W WAY+   IA 
Sbjct: 161 AAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAA 220

Query: 214 FFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVV--GWQ 271
                  Y+ +P              L  + +  + +   GL++ N A N   V    W 
Sbjct: 221 TLTLALSYYSVPDNITKKNKPC----LNGLGWFSNRS--CGLLMLNVACNLAAVASSNWS 274

Query: 272 TPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYT 331
                +++ V  + L +   ++             ++  + VL+ I  GW ++GIW  Y 
Sbjct: 275 HIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYF 334

Query: 332 WQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILI 391
           ++F+ + R  +PL + + +  + + G+ A +    L+ RT P   +LF+   FT   I++
Sbjct: 335 FRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIIL 394

Query: 392 ATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSIS 451
           +  P+HQ+Y+  T  S+I +  G+D SFP++ I+L + +P ++  + A L N + NY+IS
Sbjct: 395 SVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAIS 454

Query: 452 IGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAI 495
              GI  +   +++    + +K YR  +Y  IGLS +G+F A I
Sbjct: 455 FWPGICNSALRSLSS--IELIKYYRYVYYFAIGLSAIGLFAAGI 496

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 76/126 (60%), Gaps = 3/126 (2%)

Query: 53  AQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 112
           +QL+ Q G  Q+L  ++++ + F ++   Q    AS   L  G+FIL++G++GDI+G K 
Sbjct: 3   SQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVAS-IPLVSGSFILVSGKVGDIYGLKN 61

Query: 113 FFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-R 170
             + G+    +WS + G + Y+  + FF   RAFQG+G AF+LPN +  +   Y +G  R
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 171 KNMVFS 176
           KNMV++
Sbjct: 122 KNMVYA 127

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 448 YSISIGLGIAGTIESNVNDGGAKPL 472
           YS+ + LGIAGT+E  V+ GGA  L
Sbjct: 159 YSMPMCLGIAGTVEHRVHKGGADRL 183

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 104/451 (23%), Positives = 182/451 (40%), Gaps = 49/451 (10%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNA---IAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSL-LGQL 199
           A QG+  A L+P A   I IL    K  K  ++V   F +    G ++G  F++  +G  
Sbjct: 125 AIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFATTKIGYR 184

Query: 200 AWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFN 259
             +   + +M +         Y +      P +  +S   ++ +DF GS+  V G IL  
Sbjct: 185 GIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTS-VKSLDFIGSLIFVAGSILIV 243

Query: 260 FAWNQGPVVGWQTPYTYILLIVGTV-FLAIFA---------------------FIESRXX 297
               +G    W  P TY+ L++G + F   F                      + E    
Sbjct: 244 VGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQL 302

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV-- 355
                     +    VL+  A   A     ++   Q+ + +   +PLL+  +  P+ +  
Sbjct: 303 LIPIDVLFMKNFIPIVLA-FALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICM 361

Query: 356 ---SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQT-YWAQTFVSIIVM 411
              +  CA  +T       P   V +    A     ILI    V +  +W   F +  ++
Sbjct: 362 VIGNALCAFEST----KLRPRVGVAIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALV 417

Query: 412 PWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND--GGA 469
            +G+ + +P A  +     P E +G+A+ +  T     I I   +  ++  N+N+  G +
Sbjct: 418 GFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKS 477

Query: 470 KPLKGYR-----CSWYMGIGLSGLGIFVAAI 495
             ++ +R     CS++  + +  LG  V AI
Sbjct: 478 NAIQKFRTGFQNCSYFT-VAVGALGFLVTAI 507

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 180/448 (40%), Gaps = 43/448 (9%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +    +A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNA---IAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLA 200
           A QG+  A L+P A   I IL    K  K  ++V   F +    G ++G  F++   ++ 
Sbjct: 125 AIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAAT--KIG 182

Query: 201 WWPWAYWIMGIACFFLAIAGYFI--IPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILF 258
           +    Y    +      IA +F   + +     +   +   ++ +DF GS+  V G IL 
Sbjct: 183 YRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILI 242

Query: 259 NFAWNQGPVVGWQTPYTYILLIVGTV-FLAIFA---------------------FIESRX 296
                +G    W  P TY+ LI+G + F   F                      + E   
Sbjct: 243 VVGLTEGGE-SWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQ 301

Query: 297 XXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVS 356
                      +    VL+  A   A     ++   Q+ + +   +PLL+  +  P+ + 
Sbjct: 302 LLIPVDVLFMKNFIPIVLA-FALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIIC 360

Query: 357 GFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV--HQTYWAQTFVSIIVMPWG 414
                    +  ++  P   +    +   AG+I++    +     +W   F S  ++ +G
Sbjct: 361 MVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVGFG 420

Query: 415 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND--GGAKPL 472
           + + +P A  +     P + +G+A+ +  T     I I   +  ++  ++N+  G    +
Sbjct: 421 VAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAI 480

Query: 473 KGYR-----CSWYMGIGLSGLGIFVAAI 495
           + +R     CS++  + +  LG  V AI
Sbjct: 481 QNFRTGFQNCSYFT-VAVGALGFLVTAI 507

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 98/450 (21%), Positives = 183/450 (40%), Gaps = 53/450 (11%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+   F +  F++A+ SLL   +V  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC--AVMPNFPAFAVFR 124

Query: 144 AFQGMGPAFLLPNA---IAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSL-LGQL 199
           A QG+  A L+P A   I +L    +  K  ++V   F +    G ++G  F++  +G  
Sbjct: 125 AIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYK 184

Query: 200 AWWPWAYWIMGIACFFLAIAGYFI---IPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256
             +   + +M    F ++I  +F    + + + P R   +   +  +DF GS+  V G I
Sbjct: 185 GIFYLTFAVM----FLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSI 240

Query: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSDTAF---- 312
           L      +G    W  P TY+ L++G +    F F                 DT+     
Sbjct: 241 LIVVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEK 299

Query: 313 -----------------VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV 355
                            ++   A   A     I+   Q+ +     +PL +  +  P+ +
Sbjct: 300 VQLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLII 359

Query: 356 -----SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV--HQTYWAQTFVSI 408
                +G CA  +T     +  P   ++   +   AG+I++    +     +W   F S 
Sbjct: 360 CMVIGNGLCAFEST-----KLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQ 414

Query: 409 IVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVN--- 465
            ++ +G+ + +P A  +     P   +G+A+ +  T     I I   +  ++  N++   
Sbjct: 415 ALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIR 474

Query: 466 --DGGAKPLK-GYRCSWYMGIGLSGLGIFV 492
              G ++  + G++   Y  + +  LG  V
Sbjct: 475 GKSGASQKFRTGFQNCTYFTVAVGALGFLV 504

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 100/428 (23%), Positives = 179/428 (41%), Gaps = 55/428 (12%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  +AY++T   FI   GR+GDI G+   FV   F +++ SL+   +V +N   F   R
Sbjct: 63  SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLIC--AVVNNFGTFAVFR 120

Query: 144 AFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-------GFVLGAVFSSLL 196
           A QG+  A ++P+  A++     +   ++ V S F   + G       GF++G  F+  L
Sbjct: 121 ALQGIAAAGIVPSGYALI----PTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFT--L 174

Query: 197 GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTA------MPSRHASSFKLLERVDFAGSVT 250
            ++ +    Y    +    ++I  YF I  +A        S   + +     +DF GS  
Sbjct: 175 TRIGYKGIFYLTFAVM-LVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFM 233

Query: 251 GVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXXXXXXSSD- 309
            +   IL      +G    W+ P  Y+ LIVG     +F FI +            +S+ 
Sbjct: 234 FISSTILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLF-FIWNICYGVLVKNLKSASNP 291

Query: 310 -------TAFVL------------SCIAAGWASFGIW---IFYTWQFMEDSRGQTPLLSS 347
                  T  VL                A +A++G     ++   Q+ +     +PLL++
Sbjct: 292 KVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAA 351

Query: 348 AQFSPVAVS----GFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQT-YWA 402
            +  P+ VS        A+ +  +   +P   V+L     F    ILI    +    YW 
Sbjct: 352 VKLLPLVVSMLIPNVVIAIKSDLI---SPRKAVVLGFFIMFIGSIILIQLHLITDNLYWK 408

Query: 403 QTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIES 462
             F S  ++ +G  + FP +  +L    P E++G+A+ ++ T   + + +   +  +I  
Sbjct: 409 IFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILG 468

Query: 463 NVNDGGAK 470
           N+N+   K
Sbjct: 469 NINELSGK 476

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 101/479 (21%), Positives = 189/479 (39%), Gaps = 69/479 (14%)

Query: 39  SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFI 98
            L+   A + + C+  L+  AG+   ++ +  +G+++G       SW  ++Y++T    I
Sbjct: 29  QLIINMALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYT-TASWALTSYAITFAGLI 84

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
              GRLGDI G+   F +  F+++L+ LL   +V +N   F   RA QG+  A L+P   
Sbjct: 85  AFMGRLGDIIGNSVLFTISGFFFSLFCLLC--AVVTNFPAFAVLRALQGIAAAGLVPCGY 142

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIA---CFF 215
           A++  T    +   + F+          V+   FSS +G       A+ +  +     F+
Sbjct: 143 ALI-PTLADPEDVQLFFA----------VVSCGFSSTIGIGLIIGGAFALTNVGYKGIFY 191

Query: 216 LAIAG------------YFIIPHTAMPSRHASSFKLLERV---DFAGSVTGVIGLILFNF 260
           L+ AG            Y I  H      +  S     +V   DF GS+  + G +L   
Sbjct: 192 LSFAGMLLVSIAAFFFTYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLIVV 251

Query: 261 AWNQGPVVGWQTPYTYILLIVGTVF-------------LAIF---------AFIESRXXX 298
              +G    W+ P  Y+   +G +F             L IF          ++E     
Sbjct: 252 GLTEGGE-SWKRPVAYVPFTIGMIFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLEKVQVL 310

Query: 299 XXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVS-- 356
                   ++     L  +  G   +   I+   Q+ +     +PLL+  +  P+ ++  
Sbjct: 311 IPRDVLFMTNFIPITLGFLCNGGCLYS-NIYIIDQYSQYVDKNSPLLAGVKLVPLIITMV 369

Query: 357 ---GFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQT-YWAQTFVSIIVMP 412
                CA+ +    +   P   V L  ++      ILI    V +  YW   F S I++ 
Sbjct: 370 IGNTICASKS----VKLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVG 425

Query: 413 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKP 471
           +G  + +P A  ++    P   +G+A+ +  T     I +   +  ++  N+    ++P
Sbjct: 426 FGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRP 484

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 99/213 (46%), Gaps = 10/213 (4%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           Q  W  ++Y +T   FI   GR+GDI G+     +    + ++SLL   +V  N I F  
Sbjct: 59  QSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPNFIAFTV 116

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKRK---NMVFSLFGACAPGGFVLGAVFSSLLGQ 198
            RAFQGM  A ++P A A++ + ++    +   +++ S+  A A  GF++G  F      
Sbjct: 117 FRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGET--A 174

Query: 199 LAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHA--SSFKLLERVDFAGSVTGVIGLI 256
           L +  + Y++   +    A+    I     + +RH+    F+ + ++D  G +  + G I
Sbjct: 175 LGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSI 234

Query: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIF 289
           L      QG    W  P  Y+ L V  V L IF
Sbjct: 235 LLVVGLTQGG-ESWNDPTAYVPLAVSIVLLIIF 266

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 99/457 (21%), Positives = 176/457 (38%), Gaps = 59/457 (12%)

Query: 51  CSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGH 110
           C+  L+  AG+   ++ +  +G+++     G  SW  ++Y++T   FI   GRLGDI G+
Sbjct: 37  CTFDLLNVAGV---ISVIEDLGETYKLGYTGA-SWALTSYAITFAGFIAFMGRLGDIVGN 92

Query: 111 KKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNA---IAILGRTYKS 167
              F +  F + L+SLL   +V  +   F   RA QG+  A ++P     I +L      
Sbjct: 93  SVLFTISCFLFTLFSLLC--AVVRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDI 150

Query: 168 GKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHT 227
            K  ++V   F +    G ++G  F+  L ++ +        GI  F+L+ AG  ++   
Sbjct: 151 QKFFSIVSCGFSSTIGIGLIVGGAFA--LTKVGY-------AGI--FYLSFAGMLVVSIA 199

Query: 228 A-MPSRHASSFKLLE--------------RVDFAGSVTGVIGLILFNFAWNQGPVVGWQT 272
           A   +      K LE               +DF GS+  V G +L      +G    W+ 
Sbjct: 200 ASFYTYRIEERKFLEVKVEDIPHDHPKVASLDFVGSLIFVSGSVLIVAGLTEGG-ESWRR 258

Query: 273 PYTYILLIVGTVFLAIFAF-------IESRXXXX--------XXXXXXXSSDTAF----- 312
           P  Y+   +G +    F         + SR                     D  F     
Sbjct: 259 PVAYVPFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFI 318

Query: 313 -VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYL-LSR 370
            ++   A   A     I+   Q+ +     +PL++  +  P+ VS      T     L  
Sbjct: 319 PIILSFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQL 378

Query: 371 TPPSTVMLFAMTAFTAGTILIATAPVHQ-TYWAQTFVSIIVMPWGMDMSFPAATIMLSDS 429
            P   V+L  +       ILI    +    +W   F S I +  G  + +P A  ++   
Sbjct: 379 RPKVGVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGG 438

Query: 430 MPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVND 466
            P   +G+A+ +  T   + + +   +  ++  N+ D
Sbjct: 439 APDGAKGIASGMTQTFAQFGVEVTFSVMVSVLGNITD 475

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/417 (20%), Positives = 158/417 (37%), Gaps = 41/417 (9%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  ++Y++T   FI   GRLGDI G+ + F +    +A+ SLL G  +  N   F   R
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCG--LMPNFEAFAVMR 124

Query: 144 AFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWP 203
           A QG+  A L+    A++         K  V   F   + G      +   + G    + 
Sbjct: 125 ALQGIAAAGLVMCGYALIPIL----SPKEQVQEYFSIVSCGFSSTIGIGFIIGGAXXGYK 180

Query: 204 WAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFK----LLERVDFAGSVTGVIGLILFN 259
             +++   A   + I  +F               K     +  +DF GS+  + G IL  
Sbjct: 181 GIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASLDFIGSLIFITGSILIV 240

Query: 260 FAWNQGPVVGWQTPYTYILLIVGTV-FLAIFA----------------------FIESRX 296
               +G    W+    Y+   +G + FL+ FA                      F + + 
Sbjct: 241 VGLTEGG-ESWREAKAYVTFAIGIILFLSFFAWNCFYLKIVNGIRLIGIDTTKYFEKVQL 299

Query: 297 XXXXXXXXXXSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVS 356
                         AF ++  A  ++S    I+   Q+ +     +PL++  +  P+ +S
Sbjct: 300 LVPLNIHFMTXIVLAFAMNN-ACPFSS----IYIIDQYSQYKENDSPLMAGVKLVPLIIS 354

Query: 357 GFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIA--TAPVHQTYWAQTFVSIIVMPWG 414
                   G   +R  P   +        +G+I++    A  +  +W   F + +++ +G
Sbjct: 355 MIIGNFLCGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVKYDVFWKIFFSAEVLVGFG 414

Query: 415 MDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKP 471
           + + +P A  +     P E +G+A+ +  T     I I   I  ++  N+ +   +P
Sbjct: 415 VAIFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMASVLGNIEEIRGRP 471

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 83/194 (42%), Gaps = 23/194 (11%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           Q+SW A+AY L+   F  + G+L DIFG K   +L    +AL   + G S ++N ++   
Sbjct: 77  QMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLS 135

Query: 142 CRAFQ----GMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLG 197
              F     G G A L     + +    K G  + +V   F      G VLGAV    +G
Sbjct: 136 TGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQQGIG 195

Query: 198 QLAWWPWAYWI---MGIACFFLAIAGYFIIPHTA-------MPSRHASSFK---LLERVD 244
               W WA+ +   M + C  L IA    +P  +       +  +     K   + E VD
Sbjct: 196 ----WRWAFLVQVPMALVC-ALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMVD 250

Query: 245 FAGSVTGVIGLILF 258
           F GS T +  +IL 
Sbjct: 251 FVGSFTLIASMILL 264

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 94/407 (23%), Positives = 151/407 (37%), Gaps = 37/407 (9%)

Query: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           IG  F + +  + SW A++Y L+  T   + G+L D  G K   V     +A+  L+ G 
Sbjct: 113 IGSEFNSLD--KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170

Query: 131 SVYSNKIFFDCC-RAFQGMGPAFLLPNAIAILGRTYKSGKRK------NMVFSLFGACAP 183
              SN I+     R   G+G   L   A  I+        R       N VF L    A 
Sbjct: 171 ---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL--GTAS 225

Query: 184 GGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFK----- 238
           GG V GA F         W  A+ +    C    ++G  I+ +  +P R ++S K     
Sbjct: 226 GGLV-GAYFRD-------WRLAFILQ---CPISVLSGILIVVYLELPPRASASNKDCWSA 274

Query: 239 LLERVDFAGSVTGVIGLILFNFAWNQ-GPVVGWQTPYTYILLIVGTVFLAIFAFIESRXX 297
            L R+D+AG+ + +  L LF    +  G  V + +     +     VF A+F ++E R  
Sbjct: 275 RLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVA 334

Query: 298 XXXXXXXXXSSDTAFVLSCIAAGW---ASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVA 354
                      D + VL    A W    S     FY   +     G        +  P  
Sbjct: 335 ADPVLPVTFLRDRS-VLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSF 393

Query: 355 VSGFCAALTTGYLLSRTPPSTVMLFAMTAFT-AGTILIATAPVHQTYWAQTFVSIIVMPW 413
            S    +L  G  + RT      L A      AG + I         W Q  +  +V  +
Sbjct: 394 FSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ-VVPGF 452

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460
           G+ +      + +  ++PHEH     S+     +   ++G+ +   +
Sbjct: 453 GVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 83/189 (43%), Gaps = 10/189 (5%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G +   +   F++ L  L+
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLM 117

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+  +     G G 
Sbjct: 118 TCFA--RNVTEFSIARAVCGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 187 VLGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           +LGA    +  +   W   + +   M I C  LAI    I      P +   + K L R+
Sbjct: 174 LLGAPLGGIFIETIGWRALFGVQVPMIIVCSILAIKNINIKLFHVPPMKERYTLKNLSRI 233

Query: 244 DFAGSVTGV 252
           D  GS++ V
Sbjct: 234 DIFGSLSLV 242

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 84/189 (44%), Gaps = 10/189 (5%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   ++  F++ L  LL
Sbjct: 60  MNRVAEDFSESSRKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCLL 117

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+  +     G G 
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 187 VLGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           +LGA    +  +   W   + +   M + C  LAI    I      P +   + K L R+
Sbjct: 174 LLGAPLGGVFIETIGWRALFGVQVPMIMLCTILAIKNINIKLFHVPPMKERYTLKNLSRI 233

Query: 244 DFAGSVTGV 252
           D  GS++ V
Sbjct: 234 DLFGSLSLV 242

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 83/189 (43%), Gaps = 10/189 (5%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 67  MNRVAEEFAESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLL 124

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+   N   F   RA  GMG   +  NA++ +  +     R+  +F  +     G G 
Sbjct: 125 TCFA--QNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGMGQ 180

Query: 187 VLGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           VLGA    L      W   + I   M + C +L I    I      P +   ++K L R+
Sbjct: 181 VLGAPLGGLFLDHIGWRTLFGIQVPMIMFCSYLTITNVNIKLLHVPPRKERFTWKNLSRI 240

Query: 244 DFAGSVTGV 252
           D  GS++ V
Sbjct: 241 DIFGSLSLV 249

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 83/190 (43%), Gaps = 12/190 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ +  LL
Sbjct: 60  MNRVAEEFSESSRKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLL 117

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFS-----LFGACA 182
             F+   N   F   RA  G+G   L  NAI  +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYANIVFGLGQ 173

Query: 183 PGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLER 242
             G  LG VF   +G  A +     ++ + C  LAI    I      P +   + K L R
Sbjct: 174 LLGAPLGGVFIETIGWRALFGVQVPVI-MLCSVLAIKNINIKLFHVPPMKERYTLKNLSR 232

Query: 243 VDFAGSVTGV 252
           +D  GS++ V
Sbjct: 233 IDIFGSLSLV 242

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 12/190 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L  LL
Sbjct: 60  MNRVAEEFSESSKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLL 117

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFS-----LFGACA 182
             F+   N   F   RA  G+G   L  NAI+ +  +     R+  V+      +FG   
Sbjct: 118 TCFA--RNVTEFSIARAICGIGAGGL--NAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 183 PGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLER 242
             G  LG VF   +G  A +     ++ + C  LAI    I      P +   + K L R
Sbjct: 174 LLGAPLGGVFIETIGWRALFGIQVPVI-MLCSVLAIKNINIKLFHVPPMKERYTLKNLSR 232

Query: 243 VDFAGSVTGV 252
           +D  GS++ V
Sbjct: 233 IDIFGSLSLV 242

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 128/316 (40%), Gaps = 43/316 (13%)

Query: 3   ISSPVMQKDFDTNTG------TLKKDDEVVLDEFDIQ---DETPGSLLWETAFVGVLCSA 53
           +++ V Q+D+++ TG      T   D        D+     ETP   L  +    ++ S 
Sbjct: 29  VANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALSSSRIRIIMISM 88

Query: 54  QL-MTQAGLGQSLAP--LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGH 110
            L +  A L  ++    L  IG  F + +  ++SW A++Y L+  T   + G+L D  G 
Sbjct: 89  FLGIFLAALDGTIVSTLLTRIGSEFNSLD--KVSWIATSYLLSSSTCQPLYGKLSDQLGR 146

Query: 111 KKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQ----GMGPAFLLPNAIAILGRTYK 166
           K   V     +++  L+ G    S  I++     F     G G   L    I+ L    +
Sbjct: 147 KPLLVFSNVVFSIGCLICGM---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRE 203

Query: 167 SGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPH 226
               + +   +FG     G ++GA F         W  A+    I C     +   I+ +
Sbjct: 204 RAVYQGLCNFIFGLGTASGGLVGAAFQD-------WRMAF---TIQCPISLASCALIVSY 253

Query: 227 TAMPSRHASSFKL-----LERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYI---L 278
             +P RH           L  +D+AG VT V  L LF    + G   G +  Y  +   L
Sbjct: 254 LELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLG---GKEIAYDSVLFAL 310

Query: 279 LIVGTVFL-AIFAFIE 293
           L V T+ L +IFA++E
Sbjct: 311 LCVTTLVLGSIFAYVE 326

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 96/236 (40%), Gaps = 17/236 (7%)

Query: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           IG  F   +    SW  ++Y +T  +F  + G   D+ G +K        +++  L  G 
Sbjct: 94  IGNEFNHMDLS--SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGI 151

Query: 131 SVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GFVLG 189
           S+  N ++    RAF G+G   L+  +  +      + KR   +F  F     G G + G
Sbjct: 152 SI--NILWLSFMRAFTGIGGGGLITLSTIVNSDMIPTSKRG--IFQAFQNLLLGLGAICG 207

Query: 190 AVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHAS-----SFKLLERVD 244
           A F  ++     W W + +        A+ G+  + +     R  S     + ++L+ +D
Sbjct: 208 ASFGGVITSSIGWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHID 267

Query: 245 FAGSVTGVIGLILFNFAWNQGPVVG-----WQTPYTYILLIVGTVFLAIFAFIESR 295
           F+G+   +IGL L     + G         W +P    +L+   + L +F   E R
Sbjct: 268 FSGAFLIIIGLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEER 323

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 144/387 (37%), Gaps = 25/387 (6%)

Query: 69  HIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG  F   N    SW  +AY +T  +F  + G   D  G +         + +  L  
Sbjct: 80  QTIGNEFNHMNIS--SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLAC 137

Query: 129 GFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GFV 187
           G S   N +     RA  G+G   L+  +  +      S KR   +F  F     G G +
Sbjct: 138 GLS--PNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRG--IFQAFQNLLLGLGAI 193

Query: 188 LGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF-----KLLER 242
            GA F   +     W W +++    C   ++     +P+          F     K+L+ 
Sbjct: 194 CGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKD 253

Query: 243 VDFAGSVTGVIGLILFNFAWNQGPV---VGWQTPYTYILLIVGTVFLAIFAFIESRXXXX 299
           +D  GSV  +IGL L     + G     V W +P    LL    + L +F + E++    
Sbjct: 254 IDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSAR 313

Query: 300 XXX-XXXXSSDTAFVLSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVS 356
                    S  +FV+  I+   G+AS+  ++F    F +   G +   +  + +  ++ 
Sbjct: 314 AIIPLELMRSSFSFVVLTISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLF 372

Query: 357 GFCAALTTGYLLSRTPPSTVMLFAMTAFTA-GTILIATAPVHQTYWAQTFVSIIVMP--W 413
                L TG  +SR     ++L+A     A G  L          W    V + ++P   
Sbjct: 373 TPVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNW---LVGLFLIPANL 429

Query: 414 GMDMSFPAATIMLSDSMPHEHQGLAAS 440
           G  ++FPA       + P   Q  A S
Sbjct: 430 GQGITFPATLFTFIFAFPKSRQATATS 456

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 87/199 (43%), Gaps = 33/199 (16%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           Q+SW A++Y L+   F  + G+L DIFG K   V     +A+   L G    +N      
Sbjct: 77  QMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSA 136

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKR------KNMVFSLFGACAPGGFVLGAVFSSL 195
            R   G+G   L   +           KR       N+ FSL   CA G  VLGAV    
Sbjct: 137 GRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSL--GCASGS-VLGAVLQQG 193

Query: 196 LGQLAWWPWAYWI-MGIACFFLAIAGYFIIPHTAMPS----------RHA--SSF---KL 239
           +G    W WA+ I + IA     I+G  I+    +PS           HA  ++F   K+
Sbjct: 194 IG----WRWAFLIQVPIA----LISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKV 245

Query: 240 LERVDFAGSVTGVIGLILF 258
            + +DF GS+T V+ ++L 
Sbjct: 246 TKMIDFVGSITLVMSMLLL 264

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 91/403 (22%), Positives = 159/403 (39%), Gaps = 40/403 (9%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
            +SW A+AY L+  TF  + G++ DIFG K   +     +AL  L+ G S          
Sbjct: 165 HISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS--PGLWCLVA 222

Query: 142 CRAFQGMG-------PAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSS 194
            R   G+G        +    + + +  R    G   N  F L  AC  GG V G  FS 
Sbjct: 223 GRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQGI-CNFFFGLGTAC--GGLV-GGWFSE 278

Query: 195 LLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASS----------FKLLERVD 244
             G    W  A+ I    C   AI+   I+ +  +P     S           + L R+D
Sbjct: 279 HGG---GWRVAFLIQIPLC---AISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRID 332

Query: 245 FAGSVTGVIGLILFNFAWNQGPVVGWQTPYT----YILLIVGTVFLAIFAFIESRXXXXX 300
           + G+++ V+ L+LF  A + G   G + P+     Y L +   V  A F ++E+      
Sbjct: 333 WFGALSLVVFLLLFMLASSLG---GKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDP 389

Query: 301 XXXXXXSSDTAFVLSCIAAGWASFGIWI--FYTWQFMEDSRGQTPLLSSAQFSPVAVSGF 358
                   +   + S +A  ++  G+    ++   +        P     +  P   S  
Sbjct: 390 ILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTA 449

Query: 359 CAALTTGYLLSRTPPSTVMLFAMTAF-TAGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 417
             +L  GY + +T     +L A  A    G + I+    +   W Q ++ +++  +G+ +
Sbjct: 450 LGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQ-YILLVIPGFGLSV 508

Query: 418 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460
                 + +  ++PHEHQ    S+     +   ++G+ I G I
Sbjct: 509 LITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 96/233 (41%), Gaps = 26/233 (11%)

Query: 8   MQKDFDTNTGTLKKDDEV-VLDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLA 66
           ++ D D+ T +   DD+V    +   + + P +LL      G++    ++T  G   SL 
Sbjct: 60  IEGDLDSETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVA---ILTMCGFWSSLG 116

Query: 67  P------LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
                  L  + K F   +   ++     Y L  G    ++G L D FG +   + G   
Sbjct: 117 SPIYYPALRQLEKQF-NVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLI 175

Query: 121 YALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFG 179
           Y + S+ LA    Y   IF  C ++  G+ P   + + +  +G      +R   V     
Sbjct: 176 YVIASIGLACAPSYGVIIFLRCIQSI-GISPTIAISSGV--VGDFTLKHERGTFV----- 227

Query: 180 ACAPGGFVL-GAVFSSLLGQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
             A  GFVL G  F SL+G +  A W W   +W + I C    +  + I+P T
Sbjct: 228 -GATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET 279

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 99/228 (43%), Gaps = 15/228 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ I   F  ++  Q  W A++Y LT   F  + G+L DI G K   +   F++AL  LL
Sbjct: 66  MNSIAAEFAESDKKQ--WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLL 123

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+   N   F   RA    G      NA++ +  T     R+  V+  +     G G 
Sbjct: 124 TCFA--QNVTQFSIARAI--CGIGGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQ 179

Query: 187 VLGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           +LGA     L     W   + I   M + C  LA+    I      P     ++K L R+
Sbjct: 180 LLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSVLALKNVNIKLVHIPPRNERFTWKNLSRI 239

Query: 244 DFAGSVTGV--IGLILF--NFAWNQGPVVGWQTPYTYILLIVGTVFLA 287
           D  GS++ V  I  ILF  +  WN+  ++G  T  ++ L I   +++A
Sbjct: 240 DIFGSISLVATISGILFLTSSNWNKS-LLGIFTVLSFSLFIYIELYVA 286

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 85/214 (39%), Gaps = 26/214 (12%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           ++SW A+AY L+  TF  + G+L DIFG +   V     + L +L+ G S   N      
Sbjct: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS--KNLWVLVL 233

Query: 142 CRAFQGMGPAFLLP-------NAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSS 194
            R   G+G   L         + + +  R    G   N+ F L  AC  GG V G     
Sbjct: 234 GRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGI-CNVFFGLGTAC--GGLVGGLFADR 290

Query: 195 LLGQLAWWPWAYWIMGIACFF--LAIAGYFIIP-----HTAMPSRHASSFKLLERVDFAG 247
            +G    W  A+ +          AI  +  +P     H     R       L  VD+ G
Sbjct: 291 AVG----WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTG 346

Query: 248 SVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIV 281
           +VT V+ L  F    +   + G   P+ Y++ +V
Sbjct: 347 TVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVV 377

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 19/157 (12%)

Query: 69  HIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   N   + W  + YSL+   F L+ GR+  + G K   +L    + + SL+A
Sbjct: 68  ETIGEKFNDYN--DVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIA 125

Query: 129 GFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMV-----FSLFGACAP 183
             S  ++       R   G G +  + + + I+G +  S + + MV     F+  G+ A 
Sbjct: 126 AVS--NSMGMLIAGRVVAGAGGSG-IQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNA- 181

Query: 184 GGFVLGAVFSSLLGQLAWWPWAYWIM----GIACFFL 216
           GG +LG      L + A W W ++I     G A F L
Sbjct: 182 GGPILGGA----LNEHASWRWCFFINLPIGGAAAFML 214

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 95/258 (36%), Gaps = 47/258 (18%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++ + FG  N  +  W  + YSL      LI GR   I G +   +L    +   SL+
Sbjct: 61  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFV 187
           A  +   N + F   R   G+G +  L     ++G T    + + +V S+         +
Sbjct: 119 AALASSMNMLIFG--RVVAGVGGSG-LQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 188 LGAVFSSLLGQLAWWPWAYWI------MGIACFFLAIAGY-------------FIIPHTA 228
           +G +          W W ++I      + I  F L                   I   T 
Sbjct: 176 VGPIIGGAFTTHVTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTF 235

Query: 229 MPSRHASSFKLLE-----RVDFAGSVTGVIGLILF---------NFAWNQGPVVGWQTPY 274
              RH  +FK L      + DF G      GL+LF          ++WN G V+      
Sbjct: 236 SKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVI------ 289

Query: 275 TYILLIVGTVFLAIFAFI 292
           TY++L    V L IF+ +
Sbjct: 290 TYLVL---GVLLFIFSLV 304

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 85/194 (43%), Gaps = 24/194 (12%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFD 140
            Q+SW A++Y L+   F  + G+L D+FG K   +     +    +L G + ++  ++  
Sbjct: 67  NQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWML 125

Query: 141 CC-RAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLG-- 197
           C  R   G+G   L  N+++ +  +     R+  V+   G      F LG    SL+G  
Sbjct: 126 CIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGVYQGMGNIV---FALGCASGSLIGAF 180

Query: 198 --QLAWWPWAYW----IMGIACFFLAIAGYFIIPHTA-------MPSRHASSFKLLERVD 244
             Q   W WA+     +  ++C    I  +  +P  +       + ++  ++  + E VD
Sbjct: 181 LQQRIGWRWAFLCQVPLSLLSCSL--IMKFLNLPAGSPGRGLINLSNKKITTADVREHVD 238

Query: 245 FAGSVTGVIGLILF 258
           F GS T +  ++L 
Sbjct: 239 FTGSFTLITTMLLL 252

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 94/231 (40%), Gaps = 22/231 (9%)

Query: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQDET--PGSLL---WETAFVGVLCSAQLMTQAGLG 62
           ++ D ++ T +   DD++   +  I  ET  P +LL    +   V +L      +  G  
Sbjct: 60  IEGDLESETSSHSGDDKIDPQQ-QITAETGAPYTLLSYGQKWGMVAILTMCGFWSSLGSP 118

Query: 63  QSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 122
                L  + K F   +   ++     Y L  G    I+G L D FG +   + G   Y 
Sbjct: 119 IYYPALRQLEKQF-NVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYV 177

Query: 123 LWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGAC 181
           + S+ LA    Y   IF  C ++  G+ P   + +   ++G      +R   V       
Sbjct: 178 VASIGLACAPSYGVIIFLRCIQSI-GISPTIAISS--GVVGDFTLKHERGTFV------G 228

Query: 182 APGGFV-LGAVFSSLLGQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
           A  GFV LG  F SL+G +  A W W   +W + I C    +  + ++P T
Sbjct: 229 ATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPET 279

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 94/232 (40%), Gaps = 24/232 (10%)

Query: 8   MQKDFDTNTGTLKKDDEVVLD-EFDIQDET--PGSLL---WETAFVGVLCSAQLMTQAGL 61
           ++ D ++ T +   DD+  LD    I  ET  P +LL    +   V VL      +  G 
Sbjct: 60  IEGDLESETSSHSGDDK--LDPSLPITTETGAPYTLLSYGQKWGMVAVLTMCGFWSSLGS 117

Query: 62  GQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121
                 L  + K F   +   ++     Y +  G    + G L D FG +   + G   Y
Sbjct: 118 PIYYPALRQLEKEF-NVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIILGGMLVY 176

Query: 122 ALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA 180
            + S+ LA    Y   IF  C ++  G+ P   + + +  +G      +R   V      
Sbjct: 177 VVASVGLACAPSYGVIIFLRCVQSI-GISPTIAISSGV--VGDFTLKHERGTFV------ 227

Query: 181 CAPGGFVL-GAVFSSLLGQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
            A  GFVL G  F SL+G +  A W W   +W + I C    +  +FI+P T
Sbjct: 228 GATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGTCFLIAFFILPET 279

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 73/165 (44%), Gaps = 14/165 (8%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL- 126
           L  + K FG  +  +++     Y L  G    I+G L D+FG +   ++G   Y + S+ 
Sbjct: 114 LRQLEKQFGL-DENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIG 172

Query: 127 LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGF 186
           LA    Y   +F    R  Q +G +  +  +  ++G      +R   V    GA + G  
Sbjct: 173 LACAPSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTLKHERGTFV----GATS-GLV 224

Query: 187 VLGAVFSSLLGQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
           +LG  F SL+G +  A W W   +W + I C    I  + ++P T
Sbjct: 225 LLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 124/310 (40%), Gaps = 21/310 (6%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKK--FFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           +W  +AY +T  +F  + G   D  G +   FF  G F   +  L  GFS   N      
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAF--TIGCLACGFS--KNIYMLSF 60

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GFVLGAVFSSLLGQLA 200
            RA  G+G   L+  +  +      S KR   +F  F     G G + GA F   +    
Sbjct: 61  MRALTGIGGGGLITLSTIVNSDVIPSSKRG--IFQAFQNLLLGFGAICGASFGGTIASSI 118

Query: 201 WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF-----KLLERVDFAGSVTGVIGL 255
            W W + I        +I   + +P+    +R  SS      K+L  +D  GS+  + GL
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGL 178

Query: 256 ILFNFAWNQG---PVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXX--XXXXXSSDT 310
            L     + G     + W +P   +LL+   + L +F   E +             SS +
Sbjct: 179 TLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYS 238

Query: 311 AFVLS-CIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLS 369
             VLS  I  G+AS+  ++F    F +   G +   +  + +  ++     +L TG+ +S
Sbjct: 239 VVVLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMS 297

Query: 370 RTPPSTVMLF 379
           +     ++L+
Sbjct: 298 KYNCLRLLLY 307

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 62/145 (42%), Gaps = 15/145 (10%)

Query: 89  AYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQG 147
            Y L  G    ++G L D FG +   + G   Y + S+ LA    Y   IF  C ++  G
Sbjct: 143 VYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSI-G 201

Query: 148 MGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVL-GAVFSSLLGQL--AWWPW 204
           + P   + + +  +G      +R   V       A  GFVL G  F SL+G +  A W W
Sbjct: 202 ISPTIAISSGV--VGDFTLKHERGTFV------GATSGFVLLGQCFGSLIGAVLTARWDW 253

Query: 205 A--YWIMGIACFFLAIAGYFIIPHT 227
              +W + I C    +  + I+P T
Sbjct: 254 RSIFWFLTIGCGSCFLIAFLILPET 278

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
           I+G L D++G +   + G   Y + S+ LA  + Y   +F  C ++  G+ P  L+  + 
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQS-AGISP--LIAISS 208

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVL-GAVFSSLLGQ--LAWWPWA--YWIMGIAC 213
            ++G      +R + V    GA +  GF L G  F SL+G    A + W   +W + I C
Sbjct: 209 GVVGDFTTKSERGSFV----GAVS--GFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 214 FFLAIAGYFIIPHT 227
               +  +F++P T
Sbjct: 263 GTCFVINFFLLPET 276

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
            +SW A+AY L+  TF  + G++ DIFG +   ++   ++ L  L+ G S
Sbjct: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 79/181 (43%), Gaps = 14/181 (7%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           ++ W A+++ LT   F  I G+L D+ G +   VL +  + L  L+  ++   N   F  
Sbjct: 83  RIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFLLGCLVTAYA--RNIWEFAF 140

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAW 201
            RA  G+G   +    +  +G  +   ++     S++ + A   + +G V  + +G +A 
Sbjct: 141 GRAICGIGAGGIPTMCVITMGDMFSVKEQ-----SIYQSYAHIIYTIGEVLGAPIGGIAL 195

Query: 202 WPWAYWIMGIA-------CFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIG 254
               +  + +A       C +L +    +      P     ++K + R+D +GS+  +I 
Sbjct: 196 ETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRMDLSGSILLIIS 255

Query: 255 L 255
           L
Sbjct: 256 L 256

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 12/197 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L DI G K   +   F++ L   L
Sbjct: 64  MNKVAEEFEESDKKQ--WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFL 121

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+   N   F   RA  G+G   +  NA++ +  +     R+  ++  +     G G 
Sbjct: 122 TCFA--QNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQ 177

Query: 187 VLGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           +LGA    L      W   + +   M + C  LA     +      P +   ++K L R+
Sbjct: 178 LLGAPLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERFTWKNLSRI 237

Query: 244 DFAGS--VTGVIGLILF 258
           D  GS  + G I  +LF
Sbjct: 238 DIFGSLALVGTISSLLF 254

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 13/132 (9%)

Query: 101 AGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIA 159
            G L D+FG +   + G   Y + S+ LA  + Y   +F  C ++  G+ P   + +  A
Sbjct: 147 CGGLADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQS-AGISPTISISSG-A 204

Query: 160 ILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ-LAW---WPWAYWIMGIACFF 215
           +   T KS +        F     G  +LG  F SL+G  LA    W   +W + I C  
Sbjct: 205 VGDFTVKSER------GTFVGAVSGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGV 258

Query: 216 LAIAGYFIIPHT 227
             +  +F++P T
Sbjct: 259 SMMVAFFVLPET 270

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGM---GPAFLLP 155
           +I   L +I+G +   V+  F + ++      +     I    CR F G+    P  ++P
Sbjct: 253 VIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMI--CRFFSGVIGSAPMAVVP 310

Query: 156 NAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGI 211
            A A +  T   GK   + FSLF    P   +L  VF S + Q   W W  +++GI
Sbjct: 311 AAFADMFDTNLRGKAICL-FSLFVFVGP---ILSPVFGSYMAQRTTWRWLEYVVGI 362

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           ++SW A+AY L+  TF  I G++ DIFG K   +     + + SL+ G S
Sbjct: 157 RISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 87/239 (36%), Gaps = 42/239 (17%)

Query: 69  HIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
             IG+ F   +  ++ W  + Y+L    F L+ GRL  I G K         + + SL+ 
Sbjct: 32  ETIGEKF--KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIV 89

Query: 129 GFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVL 188
             S     I     R   G G +  + + + ++G +    + + MV ++ G      F +
Sbjct: 90  AVSNSMGMIIGG--RVVAGCGGSG-IQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAV 146

Query: 189 GAVFSSLLGQLAWWPWAYWIM----GIACFFLAIAGYFIIPHTAMPS------------- 231
           G V      +   W W ++I     G+A   L  + Y     +   +             
Sbjct: 147 GPVIGGAFTENVSWRWCFYINLPIGGVALTMLTFS-YNTTEKSVQETLTYNCRQLQTYRY 205

Query: 232 ---------RHASSFKLLERVDFAGSVTGVIGLILF---------NFAWNQGPVVGWQT 272
                    R A +F + + +DF G      G +LF          +AWN G ++ + T
Sbjct: 206 GQWVTASFWRRAYNFLMFD-LDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLT 263

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 11/142 (7%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGM 148
           Y L  G    I+G L D++G +   + G   + + S+ +A    Y   +F  C ++  G+
Sbjct: 135 YLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSI-GI 193

Query: 149 GPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG---GFVLGAVFSSLLGQLAWWPWA 205
            P   + + + +   T K  +R   V +  G    G   G +LGAV ++ L     W   
Sbjct: 194 SPTIAISSGV-VSDFTVKR-ERGTFVGATSGLVLIGQGIGPLLGAVITAAL----HWRAV 247

Query: 206 YWIMGIACFFLAIAGYFIIPHT 227
           +W + I C    I G+F++P T
Sbjct: 248 FWFLTIGCGSCMIIGFFLLPET 269

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 82/218 (37%), Gaps = 10/218 (4%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           SW  +AY +T  +F  + G   D  G +         + +  L   FS  +N       R
Sbjct: 96  SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFS--TNIYMLSFMR 153

Query: 144 AFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GFVLGAVFSSLLGQLAWW 202
           A  G+G   L+  +  +      S KR   +F  F     G G + GA F   +     W
Sbjct: 154 ALAGIGGGGLITLSTIVNSDVIPSSKRG--IFQAFQNLLLGFGAICGASFGGTITSTIGW 211

Query: 203 PWAYWIMGIACFFLAIAGYFIIPHTAMPSRHA-----SSFKLLERVDFAGSVTGVIGLIL 257
            W + I        ++   + +P+             SS K+L+ +D  GS+  + GL L
Sbjct: 212 RWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDIDITGSILIIAGLTL 271

Query: 258 FNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR 295
                + G    W  P   +LL+   V + +F   E +
Sbjct: 272 QLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNERK 309

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 10/86 (11%)

Query: 168 GKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGI--ACFFLAIAGYFIIP 225
            K + +  SLF A    G V+G +  SLL     W W YW M I   C +  +A +    
Sbjct: 241 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVILSGCLYAVMAVF---- 296

Query: 226 HTAMPSRHASSFKLLERVDFAGSVTG 251
              MP  H  +  L +R      +TG
Sbjct: 297 ---MPETHHQTL-LKKRAKKLREITG 318

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 66/151 (43%), Gaps = 17/151 (11%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIF--FDCCRAFQGM---GPAFL 153
           +I   L +++G K   +L  F ++++     F+V  +K F     CR F G+    P  +
Sbjct: 194 IIYAPLSELYGRKGVIILSAFGFSVFQ----FAVAVSKDFQSIMICRFFGGLIGAAPMAV 249

Query: 154 LPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIAC 213
           +P   A +  T   GK      +LF      G +LG V  S + Q   W W  +++G  C
Sbjct: 250 VPACFADMFDTNMRGK----AIALFSLGVFVGPILGPVMGSYIVQHTTWRWLEYVIG--C 303

Query: 214 FFLAI--AGYFIIPHTAMPSRHASSFKLLER 242
           F  AI  A  F +  T  PS   +  K + +
Sbjct: 304 FSAAIFVALLFFMEETHHPSILVNKAKQMRK 334

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 100/256 (39%), Gaps = 39/256 (15%)

Query: 1   MSISSPVMQKDFDTNTGTLKKD-------DEVVLDEFDIQD--ETPG--SLLWETAFVGV 49
           M +  PV+  + D     L +D        E+     D +D  E+ G  S L + A   +
Sbjct: 20  MKLEKPVLGLEGDNTKKLLPQDAASRVTTREMRESSSDSRDRVESSGVNSKLPQGAPFTL 79

Query: 50  LCSAQ------LMTQAGLGQSLAP------LHIIGKSFGTTNPGQLSWFASAYSLTVGTF 97
           L   Q      L+T AG   SL        L  + K F  +    ++     Y +  G  
Sbjct: 80  LSHGQKWFMVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEE-MVNITVVVYLIFQGIA 138

Query: 98  ILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPN 156
             I+G L D++G +   ++G   Y   S+ LA    Y   +F  C ++  G+ P   + +
Sbjct: 139 PTISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFLRCLQS-AGISPIIAINS 197

Query: 157 AIAILGRTYKSGKRKNMVFSLFGACAPGGFVL-GAVFSSLLGQLAW----WPWAYWIMGI 211
              ++G      +R   V    GA +  GF L G  F SL+G        W   +W + I
Sbjct: 198 --GVVGDFTLKHERGTFV----GAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTI 249

Query: 212 ACFFLAIAGYFIIPHT 227
            C    I  + I+P T
Sbjct: 250 GCGTCMIINFLILPET 265

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 181 CAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHT 227
           C+ GG V+G +F  L+ +   W W +WI  I      +  +FI+P T
Sbjct: 248 CSVGGTVIGPIFGGLMEEHLSWHWNFWIQLIFNGVTQVLHFFIVPET 294

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 91/403 (22%), Positives = 163/403 (40%), Gaps = 44/403 (10%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIF--F 139
           ++SW A++Y L+  TF  + G++ DIFG K   V     + +  L+ G S    K F   
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS----KSFWWL 202

Query: 140 DCCRAFQGMG-------PAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVF 192
              R   G+G        +  + + + +  R    G   N+ + L  AC   G ++G  F
Sbjct: 203 VIARFVAGVGGGGLTSMSSITITDLVPLRERAMYQGI-CNVFYGLGTAC---GGIVGGWF 258

Query: 193 SSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHAS-------SFKLLERVDF 245
           S   G    W  A+ I        AI+   II H  +PS+ A+         KLL  +D+
Sbjct: 259 SDNKG---GWRMAFLIQ---VPLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLA-IDW 311

Query: 246 AGSVTGVIGLILFNFAWNQGPVVGWQTPY---TYILLIVGTVF-LAIFAFIESRXXXXXX 301
            G+ T VI L+LF    + G   G +  Y   T+ L+++ ++    +F ++E R      
Sbjct: 312 LGASTLVIFLVLFLLTASLG---GKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPI 368

Query: 302 XXXXXSSDTAFVLSCIAAGWASFGIWI--FYTWQFMEDSRGQTPLLSSAQFSPVAVSGFC 359
                 +  + + S ++  +         +Y   +       +P     +  P   S   
Sbjct: 369 LPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAF 428

Query: 360 AALTTGYLLSRTPPST--VMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDM 417
            +L  GY + +T       ++F   A      ++   P   T W Q ++ ++V   G  +
Sbjct: 429 GSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPT-WRQ-YILLLVPGVGTSV 486

Query: 418 SFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTI 460
               A + +  ++PHEHQ    S+     +   ++G+ I G I
Sbjct: 487 LITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAI 529

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 63/170 (37%), Gaps = 44/170 (25%)

Query: 83  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYAL-----------WSLLAGFS 131
           +SW A++Y L+   F  + G+L DIFG K   +     + L           W LLAG  
Sbjct: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAG-- 246

Query: 132 VYSNKIFFDCCRAFQGMG-------PAFLLPNAIAILGR-TYKSGKRKNMVFSLFGACAP 183
                      R   G+G       P+ ++ + + +  R +Y+          LF  C  
Sbjct: 247 -----------RFVAGIGGGGLTSMPSIIISDIVPLRSRASYQ---------DLFNICYV 286

Query: 184 GGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRH 233
            G  LG      L +   W   + +  +A     I+G FI     +P  H
Sbjct: 287 LGITLGGSMGGWLAEYGGWRLVFLLQVVAAL---ISGCFIQAFLILPKVH 333

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 82/212 (38%), Gaps = 14/212 (6%)

Query: 4   SSPVMQKDFDTNTGTLKKDDEVVLDEFDIQDETP-------GSLLWETAFVGVLCSAQLM 56
           S PV +K  D   G   +D  V L      D          G  L+   F  VL  AQL+
Sbjct: 30  SEPVSKKYEDKKAGEDAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCLFALVL--AQLI 87

Query: 57  TQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116
               +      + ++ K+ G     +  W  + YSL      LI GR   + G +   ++
Sbjct: 88  VALDVFIVNTVIDVVSKNLG--GYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLI 145

Query: 117 GFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFS 176
             F + + S+++  +   N +     R   G+G + L   ++ I+G +    + + +V +
Sbjct: 146 SIFIFEVGSIVSATATSMNNLVVG--RVVAGIGGSGLQTVSM-IIGCSLVEERNRTIVIA 202

Query: 177 LFGACAPGGFVLGAVFSSLLGQLAWWPWAYWI 208
           +  +      ++G          A W W +WI
Sbjct: 203 VIMSAFAVSSLIGPFIGGAFTTHATWRWCFWI 234

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 15/134 (11%)

Query: 100 IAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
           ++G L DI+G +   + G   Y + S+ +A  + Y   IF  C    Q  G + L+  + 
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFLRC---LQSTGISPLIAISS 209

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ-LAW---WPWAYWIMGIAC- 213
             +G      +R   V    GA + G  ++G  F SL+G  LA    W   +W + I C 
Sbjct: 210 GAVGDFTVKAERGTFV----GAVS-GLVLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCG 264

Query: 214 FFLAIAGYFIIPHT 227
             +AIAG  ++P T
Sbjct: 265 ACMAIAG-IVLPET 277

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 59/142 (41%), Gaps = 13/142 (9%)

Query: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           + K FG  +  +  W  + YSL      L+ GR+  I G K   +     + + SL++G 
Sbjct: 105 VAKKFGAYS--KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV 162

Query: 131 SVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGA 190
           +   N +     R   G+G + +   A  ++G      +R+ ++     AC    F + +
Sbjct: 163 ANSMNMLIGG--RVIAGVGGSGIQSLAF-VIGSNLVDERRRGLII----ACMSSAFAVAS 215

Query: 191 VFSSLLG----QLAWWPWAYWI 208
           V    LG      A W W ++I
Sbjct: 216 VIGPFLGGAFTTHATWRWCFYI 237

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 77/189 (40%), Gaps = 22/189 (11%)

Query: 51  CSAQLMTQAGLGQSLAP------LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRL 104
           C   L+T AG   SL        L  + K F  +    ++     Y +  G    I+G L
Sbjct: 87  CMVALLTSAGFWSSLGSPIYYPALKQLEKQFSVSEE-LVNITVVVYLIFQGVAPTISGGL 145

Query: 105 GDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGR 163
            D++G +   ++G   Y   S+ LA  + Y   +F  C ++  G+ P   + +   ++G 
Sbjct: 146 ADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFLRCLQS-AGISPIIAINS--GVVGD 202

Query: 164 TYKSGKRKNMVFSLFGACAPGGFVL-GAVFSSLLGQLAW----WPWAYWIMGIACFFLAI 218
                +R   V    GA +  GF L G  F SL+G        W   +W + I C    +
Sbjct: 203 FTVKQERGTFV----GAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCML 256

Query: 219 AGYFIIPHT 227
             + ++P T
Sbjct: 257 VNFLLLPET 265

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 13/167 (7%)

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRA 144
           W  + YSL    F LI GR   + G +    L  F + + S+++  +   + +     R 
Sbjct: 97  WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVG--RV 154

Query: 145 FQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSL----FGACAPGGFVLGAVFSSLLGQLA 200
             G+G + L   ++ ++G +    K + M+ S+    F A +  G  +G  F++ +    
Sbjct: 155 IAGVGGSGLQTLSL-VIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHV---- 209

Query: 201 WWPWAYWIMGIACFFLAIAGYFII--PHTAMPSRHASSFKLLERVDF 245
            W W +WI        A+  YF       +  SR  S FK ++ + F
Sbjct: 210 IWRWCFWINLPIGAVTALLFYFTYNPKRLSAASRFTSCFKSVKALSF 256

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 88/219 (40%), Gaps = 28/219 (12%)

Query: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQ-DETPGSLLWETAFVGVLCSAQLMTQAGLGQSLA 66
           + +D ++   +    D    ++ +IQ +  P SLL    +    C   L+T  G   SL 
Sbjct: 61  LPEDLESEISSTHSQD--AKEDLEIQHNAAPYSLL---NYRDKWCMVALLTACGFWSSLG 115

Query: 67  P------LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFW 120
                  L  + K F   +   ++     Y L  G     +G L D FG +   ++G   
Sbjct: 116 SPIYYPALKQLEKQF-DIDENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPVLLIGMLI 174

Query: 121 YALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFG 179
           Y + S+ LA    Y   +F  C ++  G+ P+  + + +  +G      +R   V     
Sbjct: 175 YVVASIGLACAPSYGVIVFLRCVQSI-GISPSIAISSGV--VGDFTVKSERGTFV----- 226

Query: 180 ACAPGGFVL-GAVFSSLLGQL--AWWPWA--YWIMGIAC 213
             A  GFVL G  F SL+G    A W W   +W + I C
Sbjct: 227 -GATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGC 264

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  +N  Q  W A++Y LT   F  + GRL DI G K   ++  F++ + S L
Sbjct: 90  MNRVAEDFNASNQKQ--WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 128 AGFS 131
             FS
Sbjct: 148 TTFS 151

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 80/397 (20%), Positives = 155/397 (39%), Gaps = 46/397 (11%)

Query: 85  WFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRA 144
           W  + YSL    F L+ GRL  + G +   +     +   SL++  +   N +     R 
Sbjct: 83  WIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLI--SGRV 140

Query: 145 FQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPW 204
             G+G + L   ++ I G    + K + +V SL         ++G            W W
Sbjct: 141 IAGVGGSGLQTLSLVI-GCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRW 199

Query: 205 AYWI-MGIACFFLAIAGYFIIPHTA-MPSRHASSFK--------------LLERVDFAGS 248
            ++I + I    +AI  +F  P  A +  + + +FK              LL+++ F   
Sbjct: 200 CFYINLPIGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFD 259

Query: 249 VTGVI----GLILFNFAWN-QGPVVGWQTPYTYILLIVGTVFLA--------IFAFIESR 295
           +   +    G +LF  A    G    W++      +IVG + +A        +F  I++ 
Sbjct: 260 IVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVISFIIVGVLLIALSLIYDFRLFDHIKTM 319

Query: 296 XXXXXXXXXXXSSDTAFVLSCIAAGWAS---FGIWIFYTWQFMEDSRGQTPLLSSAQFSP 352
                       S  A +L+    G+ S   + + + Y+ QF +   G +   +     P
Sbjct: 320 DTFRPLLSWHLMSQRA-ILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIP 378

Query: 353 VAVSGFCAALTTGYLLSRT---PPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSII 409
           + VS    ++ +G ++ +T    P  V   AM    +G +++    ++ T    T + ++
Sbjct: 379 ILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMIL----LNNTSTKHTQIGVL 434

Query: 410 VMPWGMDMSF--PAATIMLSDSMPHEHQGLAASLVNT 444
           ++P G+ + F  PAA I     +        A ++ T
Sbjct: 435 ILP-GVALGFVLPAALITCHVQLDRTSPSYGADMLET 470

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 14/165 (8%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL- 126
           L  + K F   +  +++     Y L  G    ++G L D+FG +   + G   Y + S+ 
Sbjct: 125 LRQLEKEFNM-DENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIG 183

Query: 127 LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGF 186
           LA    Y    F  C ++  G+ P   + + +  +G      +R   V    GA + G  
Sbjct: 184 LACAPSYGVICFLRCIQSI-GISPTIAISSGV--VGDFTLKHERGTFV----GATS-GLV 235

Query: 187 VLGAVFSSLLGQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
           +LG  F SL+G +  A W W   +W + I      I   F +P T
Sbjct: 236 LLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPET 280

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 78/188 (41%), Gaps = 24/188 (12%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           ++ W A++Y L+   F  + G+L DIFG K   +     +    ++ G S   N + +  
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWG- 491

Query: 142 CRAFQGMG-------PAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSS 194
            R   G+G           + + + +  R    G    +    FG     G V+G +F  
Sbjct: 492 -RFVAGIGGGGITSMTTITVSDIVPLRSRAVYQG----ICNFFFGLGTAFGGVIGGIF-- 544

Query: 195 LLGQLAWWPWAYW----IMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVT 250
            +     W   +W    + G++   L I  + ++P   + +   S  + L RVD+ GS++
Sbjct: 545 -VDHQYGWRMVFWSQVPVSGLST--LLICSFLVVPR--IKNYEVSLGRKLMRVDWLGSIS 599

Query: 251 GVIGLILF 258
            ++ L  F
Sbjct: 600 MILWLTSF 607

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 59/143 (41%), Gaps = 13/143 (9%)

Query: 90  YSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGM 148
           Y L  G    + G L DI+G +   + G   Y + S+ LA  + Y   IF  C    Q  
Sbjct: 147 YLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRC---LQSC 203

Query: 149 GPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQL--AWWPWA- 205
           G + ++  +   +G      +R   V    GA + G  +LG  F SL+G    A W W  
Sbjct: 204 GISPIIAISSGCVGDFTMKAERGTFV----GAVS-GLVLLGQAFGSLIGAALAAAWDWRA 258

Query: 206 -YWIMGIACFFLAIAGYFIIPHT 227
            +W + I        G  ++P T
Sbjct: 259 IFWFLAIGAGCCLFVGILVLPET 281

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 95/239 (39%), Gaps = 32/239 (13%)

Query: 12  FDTNTGTLKKD-DEVVLDEFDIQDETPG-----SLLWETAFVGVLCSAQ------LMTQA 59
           F T T  L+ D D+VV  E   ++  P       L  E     +L   Q      L+T A
Sbjct: 32  FRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTYRQKWFMVALLTSA 91

Query: 60  GLGQSLAP------LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKF 113
           G   SL        L  +   F   N   ++     Y L  G    I+G L D++G +  
Sbjct: 92  GFWSSLGSPIYYPALKELEAEFDV-NEELINITVVVYLLFQGIAPTISGGLADVYGRRPI 150

Query: 114 FVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKN 172
            +LG   Y + S+ LA    Y   +F  C ++  G+ P   + + +A  G      +R  
Sbjct: 151 ILLGMLIYVIASIGLACSKSYGAVVFLRCLQS-AGISPIIAINSGVA--GDFTVKSERGT 207

Query: 173 MVFSLFGACAPGGFVLGAVFSSLLGQ--LAWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
            V    GA + G  ++G  F SL+G    A + W   +W + I C    I   F++  T
Sbjct: 208 FV----GAVS-GFTLMGQAFGSLIGAALTAAYDWRAIFWFLVIGCGTCMIILCFLLIET 261

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 83/411 (20%), Positives = 154/411 (37%), Gaps = 48/411 (11%)

Query: 71  IGKSFGT-TNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAG 129
           + K+FG  T  G   W  + YSL    F L+  RL  + G +   V     +   SL++ 
Sbjct: 71  VCKTFGDYTKSG---WIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAGSLISA 127

Query: 130 FSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLG 189
            +   N +     R   G+G + L   ++ I G      K + +V SL         ++G
Sbjct: 128 LANSMNMLI--AGRVVAGIGGSGLQTLSLVI-GCQLVDEKSRPLVLSLLNCTFAVASIVG 184

Query: 190 AVFSSLLGQLAWWPWAYWI--------MGIACFFLAIAGYFIIPHTAMPSRHASSF---- 237
                       W W ++I        + I  FF    G  ++       +  SSF    
Sbjct: 185 PFLGGAFTTHVTWRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVK 244

Query: 238 ----KLLERVDFAGSVTGVI----GLILFNFAWN-QGPVVGWQTPYTYILLIVGTVFLAI 288
               K+L+++ F   +   I    G +LF  A    G    W +      +I+G + +AI
Sbjct: 245 KSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVISFIIIGVLLIAI 304

Query: 289 --------FAFIESRXXXXXXXXXXXSSDTAFVLSCIAAGWAS--FGIWIFYTWQFMEDS 338
                   F  I+++            S+ + +LS     +++  + + + Y+ QF +  
Sbjct: 305 SLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLV 364

Query: 339 RGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRT---PPSTVMLFAMTAFTAGTILIATAP 395
            G +   +     P+ VS    ++ +G L  +T    P  V   AM     G + +    
Sbjct: 365 YGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTL---- 420

Query: 396 VHQTYWAQTFVSIIVMPWGMDMSF--PAATIMLSDSMPHEHQGLAASLVNT 444
           +       T + ++++P G+ + F  P+A I     +   +    A L+ T
Sbjct: 421 LDNKSTKHTQIGVLILP-GVALGFVLPSALIACHVQLDKGNPSYGADLLET 470

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 91/236 (38%), Gaps = 42/236 (17%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFD 140
           G + W  + Y+L+   F+L+ GRL +I G K+  ++    + + SL++  S  ++     
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS--NSMATLI 100

Query: 141 CCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSL---FGACAPGGFVLGAVFSSLLG 197
             R   G G + +   A  +     +   R  M+ +L   +      G  +G  F+  L 
Sbjct: 101 SGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLS 160

Query: 198 QLAWWPWAYWIM----GIACFFLAIAGYFIIPHTAM--PSR-------------HASSFK 238
               W W ++I       A   LA       PH  M  PS+              AS +K
Sbjct: 161 ----WRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWK 216

Query: 239 -----LLERVDFAGSVTGVIGLILF---------NFAWNQGPVVGWQTPYTYILLI 280
                L+ ++D  G +    G  L          NF WN G ++ + T    +LL+
Sbjct: 217 NTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFTVGPILLLL 272

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 77/372 (20%), Positives = 140/372 (37%), Gaps = 23/372 (6%)

Query: 84  SWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR 143
           +W  +AY +T  +F  + G   D  G +         + +  L  GFS  SN       R
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFS--SNIYMLSFMR 62

Query: 144 AFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GFVLGAVFSSLLGQLAWW 202
           A  G+G   L+  +  +      + KR   +F  F     G G + GA F   +     W
Sbjct: 63  ALTGIGGGGLITLSTIVNSDVIPTSKRG--IFQAFQNLLLGFGAICGASFGGTIASTIGW 120

Query: 203 PWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF-----KLLERVDFAGSVTGVIGLIL 257
            W + I        +I   + +P+    +   S+      K+L  +D  GS+  + GL L
Sbjct: 121 RWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLTL 180

Query: 258 FNFAWNQG---PVVGWQTPYTYILLIVGTVFLAIFAFIESRXXXXXXX-XXXXSSDTAFV 313
                + G     + W +P   +LL    + L +F   E +            SS  +FV
Sbjct: 181 QLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFV 240

Query: 314 LSCIA--AGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSR- 370
           +  I+   G+AS+  ++F    F +   G +   +  + +  ++     +L TG+ +S+ 
Sbjct: 241 VLSISILVGFASYA-YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSKY 299

Query: 371 TPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMP--WGMDMSFPAATIMLSD 428
               +++   ++    G  L          W    +S+ ++P   G  ++FP        
Sbjct: 300 NCLRSLLYLGISLMFLGNFLFLFIEETSPNW---LISLFLIPANLGQGITFPTTLFTFIF 356

Query: 429 SMPHEHQGLAAS 440
             P   Q  A S
Sbjct: 357 MFPKSDQATATS 368

>Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067C
           (REAL)
          Length = 591

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 15/113 (13%)

Query: 124 WSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIA---ILGRTYKSGK--RKNMVFSL 177
           WSLL   + Y N +      R F G   AF  P+ +A   + G  YK  +  R++  + L
Sbjct: 212 WSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYL 268

Query: 178 ---FGACAPGGFVLGAVFSSLLGQ--LAWWPWAYWIMGIACFFLAIAGYFIIP 225
               G  + GG +  AVFSSL G   LA W W + I  I    + I G++++P
Sbjct: 269 GQYLGILSAGG-IQSAVFSSLNGVNGLAGWRWNFIIDAIVSVAVGIIGFYVLP 320

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 93/245 (37%), Gaps = 50/245 (20%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFD 140
           G + W  + Y+LT   F+L+ GRL +I G  +  ++    + + SL++  S     +   
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLI-- 100

Query: 141 CCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGA--CAPG-GFVLGAVFSSLLG 197
             R   G G + +   A  +     +   R  M+ +L  +   A G G  +G  F+  L 
Sbjct: 101 SGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLS 160

Query: 198 QLAWWPWAYWI-MGIACFFLAIAGYF-----IIPHTAMPSRHAS--SFKLLE-------- 241
               W W ++I + I  F L I  +       +P  ++ S+  S  S+K  E        
Sbjct: 161 ----WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWK 216

Query: 242 --------RVDFAGSVTGVIGLILF---------NFAWNQGPVVGWQTPYTYILLIVGTV 284
                   ++D  G      G  L          NFAWN   ++         L  VG +
Sbjct: 217 KAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIIS--------LFTVGPI 268

Query: 285 FLAIF 289
            L +F
Sbjct: 269 LLILF 273

>SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some
           similarities with uniprot|P43542 Saccharomyces
           cerevisiae YFL062W COS4 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 204

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 3/76 (3%)

Query: 177 LFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASS 236
            FG    G F L + FS ++G L W    +W++  +     I   F IP  AM    A  
Sbjct: 34  FFGVLKSGVFKLWSAFSIIMGVLCWKTHNFWVVFFSLELFLITSIF-IPSFAMYI--AGR 90

Query: 237 FKLLERVDFAGSVTGV 252
           FKL E V F+  V  V
Sbjct: 91  FKLRELVKFSEEVAEV 106

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 82/196 (41%), Gaps = 25/196 (12%)

Query: 43  ETAFVGVLCSAQLMTQAGLGQSL-APLH-----IIGKSFGTTNPGQLSWFASAYSLTVGT 96
           E + + VLC++     AGL  ++ AP++     II + F  +    ++     Y +  G 
Sbjct: 77  EKSILAVLCAS-----AGLFSTISAPIYYPALTIIEEDFNISQ-EMVNITVVVYFILQGL 130

Query: 97  FILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLP 155
             ++ G L D  G +   +     YA+  + LA    Y   +F  C ++  G+ P   + 
Sbjct: 131 APMLMGGLADKVGRRPIVLCSIALYAVACIGLASAQNYGEVLFLRCLQS-AGISPVVAVN 189

Query: 156 NAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQ--LAWWPWA--YWIMGI 211
           N I  +G      +R        G  A G  V+G+ F +L+G    A W W   +W + I
Sbjct: 190 NGI--IGDITTKAERGGY----LGLMA-GTQVIGSAFGALIGAGITARWGWRAIFWFLAI 242

Query: 212 ACFFLAIAGYFIIPHT 227
              F      F++P T
Sbjct: 243 GSGFSLAVASFLLPET 258

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 97/239 (40%), Gaps = 22/239 (9%)

Query: 69  HIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128
            +IG  F        SW  +AY +T  +F  + G   D  G ++        +AL  L  
Sbjct: 71  QLIGNEFEDVKVS--SWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGC 128

Query: 129 GF--SVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGF 186
           G   ++YS  I     RA  G+G   L+  +  I+       K++ M  S        G 
Sbjct: 129 GLTSTIYSLIIM----RAVTGIGGGGLITLS-TIVNSDIIPAKKRGMYQSFQNILVGTGA 183

Query: 187 VLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKL------L 240
           V+GA     +     W W + +        A+  Y  +    +  ++  S  L      +
Sbjct: 184 VVGASCGGEIASSMGWRWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGALPSNVSKI 243

Query: 241 ERVDFAGS---VTGVIGLILF---NFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIE 293
           +++DF G+   ++G++  ++F   N +  +G    W +  +  L +V  V L +FA++E
Sbjct: 244 KKIDFLGAFLLISGLVSQLIFLTINSSAQEGKST-WLSGRSLALGLVTAVSLILFAYVE 301

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 9/110 (8%)

Query: 104 LGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGM---GPAFLLPNAIAI 160
           L +I+G K   V+  F +AL+      +     I    CR F G+    P  ++P   A 
Sbjct: 251 LSEIYGRKLILVISGFGFALFQFAVATAENLQTIMI--CRFFSGLIGGAPMAVVPAVFAD 308

Query: 161 LGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMG 210
           +  T   GK       LF A    G +LG +  S + Q   W W  +++G
Sbjct: 309 MFDTNFRGK----AICLFSAFVFIGPILGPIMGSYIVQHTSWRWLNYVVG 354

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 83  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           ++W A+AY LT      + G++ DI G +K  + G   +AL  LL  F+
Sbjct: 97  VTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLCNFA 145

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 57/147 (38%), Gaps = 9/147 (6%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCR---AFQGMGPAFLLP 155
           +I   L +++G K   V+    +AL+      +     I    CR    F G  P  ++P
Sbjct: 247 IIYAPLSELYGRKGVLVVSGLGFALFQFAVATAENFQTIMI--CRFFAGFIGAAPMAIVP 304

Query: 156 NAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFF 215
              A +  T   GK       LF      G +LG V  S + Q   W W  +++G     
Sbjct: 305 AVFADMFDTDFRGK----AICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQACA 360

Query: 216 LAIAGYFIIPHTAMPSRHASSFKLLER 242
           + +A    +  T  P+   +  KLL +
Sbjct: 361 VFVAIVLFVEETHHPTILVNKAKLLRK 387

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 3/76 (3%)

Query: 168 GKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGI--ACFFLAIAGYF-II 224
            K + +  S+F A    G V+G +  SLL     W W YW M I  AC +  +  +    
Sbjct: 259 NKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLIFSACLYGVMVVFLPET 318

Query: 225 PHTAMPSRHASSFKLL 240
            H  +  R A   + L
Sbjct: 319 HHQTLLKRRAKKLRKL 334

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 168 GKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGI--ACFFLAIAGYFIIP 225
            K + +  SLF A    G V+G +  SLL     W W YW M I   C +  +A +    
Sbjct: 254 NKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVIFSGCLYAVMAVFLPET 313

Query: 226 H 226
           H
Sbjct: 314 H 314

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 96/229 (41%), Gaps = 37/229 (16%)

Query: 83  LSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCC 142
           ++W A+AY LT      + G++ DI G +K  + G   +A+     G  ++S  I     
Sbjct: 139 VTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVG---VGLCIFSKSI----- 190

Query: 143 RAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG------GFVLGAVFSSLL 196
                  P   +   I  +G +  +G   N++ S     +        G +LG VF SL 
Sbjct: 191 -------PQLAIARGICGIGGS-GTGAMTNIILSDMAPLSERGKYWGYGSMLGGVFQSLG 242

Query: 197 GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL-----ERVDFAGSVTG 251
           G L      Y+  G++  F+     F +    +  ++   +        +R+DF GS+  
Sbjct: 243 GPLGGILLTYF--GVSGLFIPQIP-FCLATLYLSWKYVQDYNQDTKGSWKRIDFGGSICL 299

Query: 252 VIGL--ILFNFAWNQGPVV----GWQTPYTYILLIVGTVFLAIFAFIES 294
           ++G+   +F F+ ++ P +    GW +PY      +  +F  +F  +E 
Sbjct: 300 LVGISSFIFFFSADENPSISEHSGW-SPYKKWSFAIFVLFTILFLVVEK 347

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 377 MLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           ++  +  +  GTI+  +A   Q  W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 148 LMIVIVLYVVGTIIQISA---QDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 204

Query: 437 LAASLVNTVVNYSISIG-LGIAGTIESN 463
              S    +V + I +G   + GT + N
Sbjct: 205 TLISCYQLMVTFGIFLGYCAVYGTRKYN 232

>Kwal_33.13713 s33 (361891..363393) [1503 bp, 500 aa] {ON} YCR028C
           (FEN2) - Amino acid permease [contig 114] FULL
          Length = 500

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 55/134 (41%), Gaps = 12/134 (8%)

Query: 124 WSLLAGFSVYSNKIFFDCC--RAFQGMGPAFLLPNAIAILGRTYKSGKR--KNMVFSLFG 179
           W LL  FS+Y    F  CC  R FQ +  +        ILG  YK  +   +  +F+  G
Sbjct: 131 WGLLT-FSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILGSWYKERELTIRTAIFTSSG 189

Query: 180 ACAP--GGFVLGAVFSSLLGQ--LAWWPWAYWIMGIACFFLAIAGYFIIPHTA---MPSR 232
                  GF+  A+  SL G   LA W W + +  +    +A+ G+   P T       R
Sbjct: 190 LVGSIFSGFMQVAIHKSLDGHRGLAGWRWLFIVDFLITLPVAVYGFIFFPTTPDHINRKR 249

Query: 233 HASSFKLLERVDFA 246
           H  S    + + FA
Sbjct: 250 HGPSLFSEQELQFA 263

>TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4.30
           YLL028W
          Length = 615

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 58/142 (40%), Gaps = 9/142 (6%)

Query: 104 LGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGM---GPAFLLPNAIAI 160
           L +++G +   VL    +A++      +     I    CR F G+    P  ++P   A 
Sbjct: 234 LSELYGRRGVLVLSGLGFAIFQFAVATAENLQTIMI--CRFFGGLIGAAPMAVVPAVFAD 291

Query: 161 LGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAG 220
           +  T   GK       LF A    G +LG +  S + Q   W W  +++G     + +A 
Sbjct: 292 MFDTNFRGK----AICLFSAFVFIGPILGPIIGSYIVQHTTWRWLNYVIGCLAAAVFVAI 347

Query: 221 YFIIPHTAMPSRHASSFKLLER 242
            F++  T   S   +  K++ +
Sbjct: 348 LFLVEETHHASILVNKAKMMRK 369

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHK 111
           ++SW A+AY L+  TF  + G++ DIFG K
Sbjct: 131 RISWIATAYLLSSATFQPLYGKISDIFGRK 160

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 78/189 (41%), Gaps = 10/189 (5%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A++Y LT   F  + G+L D+ G K   +   F++ L  LL
Sbjct: 61  MNRVAEEFQESDKKQ--WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLL 118

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPG-GF 186
             F+    +  F   RA  G+G   +  NA++ +  +    +R+  ++  +     G G 
Sbjct: 119 TCFANSVTQ--FAIARAICGVGGGGI--NAMSSITVSDICTQRERGIYQGYANIVFGLGQ 174

Query: 187 VLGAVFSSLLGQLAWWPWAYWIMG---IACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243
           +LGA    L      W   + +     + C  L      I     +P      +  L R+
Sbjct: 175 ILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSHLLPVEERFKWSNLSRI 234

Query: 244 DFAGSVTGV 252
           D  GS T V
Sbjct: 235 DILGSSTLV 243

>TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {ON}
           Anc_4.30 YLL028W
          Length = 608

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 57/147 (38%), Gaps = 9/147 (6%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGM---GPAFLLP 155
           +I   L ++FG +K  ++  F  AL+      +     I    CR F G+    P  ++P
Sbjct: 221 IIFAPLSELFGRQKVILISSFGNALFQYAVATAANLQTILI--CRFFAGLIGAAPIAVVP 278

Query: 156 NAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFF 215
              A +  T   GK      +LF      G +LG +  S + Q   W W  +++     F
Sbjct: 279 AVFADIFDTNIRGK----AIALFSLGVFIGPILGPIIGSYIVQHTTWRWTEYVISFLSTF 334

Query: 216 LAIAGYFIIPHTAMPSRHASSFKLLER 242
           + +     +  T  P    +  K L +
Sbjct: 335 VTLLILLFLEETHHPIILVNKAKKLRK 361

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 54/142 (38%), Gaps = 13/142 (9%)

Query: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           + + FG  +  +  W  + YSL      LI GR+  + G K   +     + + SL+A  
Sbjct: 82  VAREFG--DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAAL 139

Query: 131 SVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGA 190
           +   + +     R   G+G + +      I+    +  KR      L  AC    F + +
Sbjct: 140 ANSMDMLIGG--RVIAGLGGSGIQTLCFVIISTLVEESKR-----GLLIACMGSAFGIAS 192

Query: 191 VFSSLLG----QLAWWPWAYWI 208
           V    LG        W W +WI
Sbjct: 193 VVGPFLGGAFTTHVTWRWCFWI 214

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 56/143 (39%), Gaps = 5/143 (3%)

Query: 66  APLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 125
           A + +I + F   +  +  W  S YSLT     L+ GR   I G K   ++    +   S
Sbjct: 140 ASIEVIAEQF--KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 126 LLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGG 185
           L++  S   N +     R   G+G +  + +   ++  T    + + ++ S+        
Sbjct: 198 LISAISNSMNMLIGG--RVVAGIGGSG-IQSLCFVIASTLTPDRSRVIIISVLSCSYAVA 254

Query: 186 FVLGAVFSSLLGQLAWWPWAYWI 208
            V+G      L     W W ++I
Sbjct: 255 AVVGPFLGGALTTHVTWRWCFYI 277

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 184 GGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHT 227
           GG VLG VF  L+ +   W W +WI  I      I  +F++P T
Sbjct: 193 GGSVLGPVFGGLMQEHLSWHWNFWIQLIFNGVSQILHFFLVPET 236

>NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 15/113 (13%)

Query: 124 WSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIA---ILGRTYKSGK--RKNMVFSL 177
           WSLL   + Y N +      R F G    F  P+ +A   + G  YK  +  R++  + L
Sbjct: 210 WSLLTIGAAYVNSVPHLKAIRFFIG---GFEAPSYLAYQYLFGCFYKHDEMVRRSAFYYL 266

Query: 178 ---FGACAPGGFVLGAVFSSLLGQ--LAWWPWAYWIMGIACFFLAIAGYFIIP 225
               G  + GG +  AV+S+L G+  L+ W W++ I  I   F+ I G++++P
Sbjct: 267 GQYVGILSSGG-IQSAVYSNLDGRNGLSGWRWSFIIDAIISVFVGILGFYVLP 318

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 90/242 (37%), Gaps = 29/242 (11%)

Query: 2   SISSPVMQKD------FDTNTGTLKKDDEVVLDEFDIQDETPGSLLW----ETAFVGVLC 51
           SI  P    D       DT  G  K   +   DE DI D  P S  W    E AF+ V C
Sbjct: 51  SIEIPTDDDDDEEGNHHDTTNGMYKTKSQN-RDEPDI-DSPPYS--WFDKKEKAFLVVQC 106

Query: 52  SAQLMTQAGLGQSLAP-LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGH 110
           +   +  +  G    P L ++   F  T   Q++     Y +       + G L D  G 
Sbjct: 107 AFTGLLSSLAGSIYYPVLSVLEVKFHITEE-QINISVVVYYVFQAVSPTLMGGLADSLGR 165

Query: 111 KKFFVLGFFWYALWSL-LAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK 169
           +   +   F Y    + LA  + YS  I   C +A  G+ P   + + +  +G      +
Sbjct: 166 RPVIITSVFLYFCACIGLACCNNYSQLIGLRCLQA-TGISPVIAVNSGL--MGDVTTKAE 222

Query: 170 RKNMVFSLFGACAPGGFVLGAVFSSLLGQ--LAWWPWA--YWIMGIACFFLAIAGYFIIP 225
           R       +     G  VLG  F +L+G    + W W   +W + I      +   FI+P
Sbjct: 223 RGG-----YMGLVSGTQVLGTAFGALIGAALFSRWGWRSIFWFLVIGSGVCLVLSLFILP 277

Query: 226 HT 227
            T
Sbjct: 278 ET 279

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 64/155 (41%), Gaps = 15/155 (9%)

Query: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKI 137
           N  Q++     Y L  G     +G L D +G +   + G   Y + S+ LA    Y   +
Sbjct: 147 NESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIGLARAPSYGVIV 206

Query: 138 FFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVL-GAVFSSLL 196
           F    ++  G+ P   + + +     +  + KR+   F      A  GFVL G     LL
Sbjct: 207 FLRIVQSI-GISPTIAISSGVV----SDYTLKRERGTF----VGATSGFVLIGQGIGPLL 257

Query: 197 GQL--AWWPWA--YWIMGIACFFLAIAGYFIIPHT 227
           G +  A W W   +W + I C    +  +F++P T
Sbjct: 258 GAVIAARWDWRAIFWFLVIGCGTSMLIAFFLLPET 292

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 71/203 (34%), Gaps = 14/203 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++ K FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 69  IDVVAKQFG--NYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLV 126

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFV 187
           A  +   N +                L     ++G T    + + +V S+         +
Sbjct: 127 AALANSMNMLI---VGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVISILSCAFAVAAI 183

Query: 188 LGAVFSSLLGQLAWWPWAYWI------MGIACFFLAIAGYF--IIPHTAMPSRHASSFKL 239
           +G +          W W ++I      + +  F L        II       R  S F+ 
Sbjct: 184 VGPIIGGAFTTHVTWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQQMKGALRKISGFE- 242

Query: 240 LERVDFAGSVTGVIGLILFNFAW 262
             R+   G++   I  ++F F +
Sbjct: 243 FSRLKKPGNLRKAINCLIFKFDF 265

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 92/216 (42%), Gaps = 25/216 (11%)

Query: 18  TLKKDDEVVLDEFDIQDE---TPGSLLWETAFVGVLCSAQLMTQAGLGQSLAPLHI--IG 72
           T  + DE  + E +++     + GS+L+    V ++  A  +  A L   +    I  + 
Sbjct: 34  TSSEHDETSIPEDNVKKNVELSKGSILY----VSLVAVALSLFLAALDVMIVSTIIEEVA 89

Query: 73  KSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSV 132
           K  G+ +  ++ W  + YSL     +LI GR+    G K   +     + + SL++  + 
Sbjct: 90  KQLGSYS--EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALAS 147

Query: 133 YSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSL----FGACAPGGFVL 188
             N +     R   G+G   +   +  ++G T     ++ M+ ++    F   +  G  L
Sbjct: 148 SMNMLI--GGRVIAGIGGCGIQSLSF-VIGSTLVEESKRGMLIAILSSSFAIASVVGPFL 204

Query: 189 GAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGY 221
           G VF+S +     W W ++I   +G   FFL +  Y
Sbjct: 205 GGVFTSSVT----WRWCFYINLPIGGLAFFLFVLFY 236

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 92/223 (41%), Gaps = 26/223 (11%)

Query: 41  LWETAFVGVLCS---AQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTF 97
           LW  +F+G L S   A +M +            + + F  ++  Q  W  +++ LT   F
Sbjct: 46  LWMGSFLGSLDSTIVANIMNK------------VAEEFEESDKKQ--WIVTSFLLTNTAF 91

Query: 98  ILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGP---AFLL 154
             + G+L D+ G K   ++   ++ +  L    S   N + F   RA  GMG    + L 
Sbjct: 92  QPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALS--RNLVEFSIARAVCGMGAGGISALS 149

Query: 155 PNAIAILGRTYKSGKRKNMVFSLFGACAP-GGFVLGAVFSSLLGQLAWWPWAYWIMGIAC 213
             +++ +    + G  +     +FG  +  GG + G +  S   ++ +      IM   C
Sbjct: 150 SISVSDICTPKERGVYQGYANVVFGTGSMLGGPIGGWLMDSFGWKVIFAGQVPLIM--TC 207

Query: 214 FFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256
            FL      I      P      ++ ++R+D  GS++ +IG I
Sbjct: 208 MFLGYRNVNIKLLHVPPRHERYRWENIKRIDLGGSIS-LIGTI 249

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 83/204 (40%), Gaps = 14/204 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ I + F  ++  Q  W A+++ LT   F  + GR  DI G K   ++   ++ L +LL
Sbjct: 68  MNKIAEEFHESDKKQ--WMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL 125

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPN---AIAILGRTYKSGKRKNMVFSLFGACAPG 184
             F+   N   F   RA  GMG   +       ++ +  T + G  +     +FGA    
Sbjct: 126 TCFA--RNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYANVIFGA---- 179

Query: 185 GFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAM---PSRHASSFKLLE 241
           G VLGA    L+ +   W   +    +A     I  Y  I    +   P     + K L 
Sbjct: 180 GQVLGAPVGGLIMETFNWRIIFAAQVVAIMICMILAYRNINLKLLHIPPFHQRFTRKNLS 239

Query: 242 RVDFAGSVTGVIGLILFNFAWNQG 265
           R+D  GS      L+ F   ++ G
Sbjct: 240 RIDLFGSSMLSCSLVSFLMLFSSG 263

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131
           G + W  + Y+L+   F+L+ GRL +I G  +  ++    + + SL++  S
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALS 93

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 79/188 (42%), Gaps = 12/188 (6%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           ++ + + F  ++  Q  W A+++ LT   F  + G+L D+ G K   ++ +F+  +  LL
Sbjct: 59  MNRVAEEFSESDKKQ--WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFS-----LFGACA 182
              +   N   F   RA    G      NA + +  +     ++  ++      +FG   
Sbjct: 117 TCLA--RNVTEFAVARAI--CGIGGGGINACSSITVSDICTAKERGIYQGYANIVFGMGQ 172

Query: 183 PGGFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLER 242
             G  LG +F   +G  A +     ++ ++  FLA     I      P     + K L R
Sbjct: 173 MLGAPLGGLFIDTIGWRAIFGIQVPVVMVSA-FLAYRNVNIKLSHVPPISERFTRKNLSR 231

Query: 243 VDFAGSVT 250
           +DF GSVT
Sbjct: 232 IDFLGSVT 239

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 78/208 (37%), Gaps = 15/208 (7%)

Query: 27  LDEFDIQDETPGSLLWETAFVGVLCSAQLMTQAGLGQSLA------PLHIIGKSFGTTNP 80
           LDE D+ D  P S     + +G++         G   S+A       L +I   F   N 
Sbjct: 60  LDEQDVMDMIPYSRFGTKSKLGLVVQCAF---TGFFSSIAGAIYYPVLSVIENKFHI-NE 115

Query: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL-LAGFSVYSNKIFF 139
            Q++     Y +  G    + G L D  G +   +     Y    + LA  + Y+  I  
Sbjct: 116 EQVNMTVVVYFIFQGLSPTLMGGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQVIAL 175

Query: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQL 199
            C +A  G+ P   + + +  +G      +R   V  + G    G    GAVF +LL   
Sbjct: 176 RCLQA-AGISPVIAINSGM--MGDVTTKAERGGYVGYVSGFQVVGT-ATGAVFGALLSSR 231

Query: 200 AWWPWAYWIMGIACFFLAIAGYFIIPHT 227
             W   +W + I     +I    ++P T
Sbjct: 232 WGWRSIFWFLAIGSGACSIVSLLLLPET 259

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 377 MLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           ++F +  +  GTI+  +A      W Q F+  I+  WG+      A +++S++ P   +G
Sbjct: 145 LMFVVGVYVVGTIIQISA---SDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRG 201

Query: 437 LAASLVNTVVNYSISIG 453
              S    +V + I +G
Sbjct: 202 TLISCYQLMVTFGIFLG 218

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 377 MLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436
           ++F  + F  G ++I  A V +  W Q F+  I+   GM +    + +++S+  P E +G
Sbjct: 154 LIFGTSIFVVG-VIIQIASVSK--WFQYFIGRIIAGIGMGVIAVLSPMLISEVAPKELRG 210

Query: 437 LAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGL 488
              S    ++ + I +G         N  + G K  +  +  W + +GL  L
Sbjct: 211 AMVSCYQLMITFGIFLG---------NCCNYGTKSYQNSK-QWRIAVGLQFL 252

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 185 GFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHT 227
           G V+G +F  L+ +   W W +WI  I      I  +FI+P T
Sbjct: 196 GSVIGPIFGGLMQEHLSWHWNFWIQLIFNGVAQILHFFIVPET 238

>Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
           +I   L +++G K   VL  F +AL+      +     IF   CR F G   A  +    
Sbjct: 201 IIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFI--CRFFGGFIGAAPMAVVP 258

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACF---- 214
           A     + +  R   + +LF      G +L  V  S + Q   W W  +++G  CF    
Sbjct: 259 AAFADMFDTNVRGKAI-ALFALGVFVGPILAPVMGSYIAQRTTWRWLEYVVG--CFASLV 315

Query: 215 FLAIAGYFIIPH 226
           F+ IA +F   H
Sbjct: 316 FVLIALFFEETH 327

>TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON}
           Anc_8.858 YML123C
          Length = 598

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 75/211 (35%), Gaps = 51/211 (24%)

Query: 90  YSLTVGTFILI-AGRLG---------DIFGHKKFFVLGFFWYALWSLLAGFSVYS---NK 136
           Y+  VG  ILI AG L          DI G K     GFF   +   + GF+ +    N 
Sbjct: 396 YNSAVGNLILICAGSLPGYWASVFTIDIIGRKPIQTFGFFILTVLFCVIGFAYHRLTPNS 455

Query: 137 I--FFDCCRAFQGMGP---AFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFVLGAV 191
           +   +  C+ FQ  GP    F++P    I    Y+S        +  G  A  G V   +
Sbjct: 456 LLGLYIVCQFFQNFGPNTTTFIIPG--EIFPTRYRS--------TAHGISAASGKVGAII 505

Query: 192 FSSLLGQL-------------AWWPWAYWIMGIACFFLAIAGY-FIIPHTAMPSRHASSF 237
             ++LG L              W P    I   A F L   G  F+IP T   +    S 
Sbjct: 506 AQTVLGTLINHNCARDGKPTNCWLPHVMEIF--ALFMLCGLGLSFLIPETKRMTLEEISE 563

Query: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVV 268
           K    VD          L   N  +N+  V+
Sbjct: 564 KYHGEVDLT-------KLAERNLNYNKNSVI 587

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 127/308 (41%), Gaps = 35/308 (11%)

Query: 5   SPVMQKDFDTNTGTLKKDDEVV-LDEFDIQDETPGSLLWETA-FVGVLCSAQLMTQAGLG 62
           +P  +K+   +  ++ +++++  L E     E    LL ETA F  V  S       GL 
Sbjct: 7   NPNERKNVPPSYSSISREEQMFSLTERPSWSERHKVLLIETALFTNVFLS-------GLD 59

Query: 63  QSLAP--LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK--FFVLGF 118
            +++     +IG  FG       SW  +AY +T  +F  + G   D  G +   FF    
Sbjct: 60  STISASTYQLIGNEFGDVKLS--SWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTI 117

Query: 119 FWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLF 178
           F    +      ++YS  +     RA  G+G   L+  +  I      + KR   ++  F
Sbjct: 118 FALGCFGCGTTTTIYSLILM----RALTGIGGGGLITLSTIINSDIIPAKKRG--IYQAF 171

Query: 179 GACAPG-GFVLGAVFSSLLGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMP------- 230
                G G V+GA    L+     W W + +         +  +F + H   P       
Sbjct: 172 QNVLLGTGAVVGASCGGLIATTMGWRWCFLLQVPISVGGTLVAFFFV-HDQRPDINGGVS 230

Query: 231 SRHASSFKLLERVDFAGSVTGVIGLI--LFNFAWN---QGPVVGWQTPYTYILLIVGTVF 285
           +   + ++ LE++DF+G++  V+GL   LF    N   +     W +P + +L +   V 
Sbjct: 231 AVRTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTLSTGVS 290

Query: 286 LAIFAFIE 293
           L +FA++E
Sbjct: 291 LILFAYVE 298

>TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30
           YLL028W
          Length = 584

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
           +I   L +I+G K   ++  F ++++      +     IF   CR F G+  A  +    
Sbjct: 198 VIYAPLSEIYGRKGVIIISAFGFSIFQFAVATAENLQTIFI--CRFFGGLIGAAPMAVVP 255

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACF 214
           A     + +  R   + SLF      G VLG V  S + Q   W W  +++G  CF
Sbjct: 256 AAFADMFDNNMRGKAI-SLFSLGVFVGPVLGPVIGSYIVQHTTWRWLEYVIG--CF 308

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 50/129 (38%), Gaps = 7/129 (5%)

Query: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDC 141
           ++ W  + YSL+   F L+ GR   IFG K   ++    + + SL+   S   + I    
Sbjct: 56  KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGG- 114

Query: 142 CRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMV--FSLFGACAPGGFVLGAVFSSLLGQL 199
            R   G G + +     AI         R  +V   SL  A A     LG      L + 
Sbjct: 115 -RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASA---LGPYIGGALTEY 170

Query: 200 AWWPWAYWI 208
             W W ++I
Sbjct: 171 VTWRWCFYI 179

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 52/127 (40%), Gaps = 19/127 (14%)

Query: 79  NPGQLSWFASAYSLTVGTFILIA----GRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 134
           N  Q+S ++   S T      +A    GR  D +G K   +LG     +  L+ GFS   
Sbjct: 56  NEAQVSRYSGYLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTCISLLILGFS--- 112

Query: 135 NKIFFDCCRAFQGMGPAFLLPNAIA----ILGRTYKSGKRKNMVFSLFGACAPGGFVLGA 190
            K F+    A   MG   LL   IA    I+G     G+ + + FS      P  F  G 
Sbjct: 113 -KHFYQAMIARSMMG---LLNGNIAVIRTIVGELTTEGRHQAIAFS----TIPLLFQFGT 164

Query: 191 VFSSLLG 197
           V  S++G
Sbjct: 165 VIGSIIG 171

>YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyamine
           transporter that recognizes spermine, putrescine, and
           spermidine; catalyzes uptake of polyamines at alkaline
           pH and excretion at acidic pH; phosphorylation enhances
           activity and sorting to the plasma membrane
          Length = 586

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKIFFDCCRAFQGMGPAFLLPNAI 158
           +I   L +++G K   VL  F +AL+      +     IF   CR F G   A  +    
Sbjct: 200 VIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFI--CRFFGGFIGAAPMAVVP 257

Query: 159 AILGRTYKSGKRKNMVFSLFGACAPGGFVLGAVFSSLLGQLAWWPWAYWIMGIACF---- 214
           A     + +  R   + +LF      G +L  V  S + Q   W W  +++G  CF    
Sbjct: 258 AAFADMFDTNVRGKAI-ALFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVG--CFASAV 314

Query: 215 FLAIAGYFIIPH 226
           F+AI  +F   H
Sbjct: 315 FVAIVLFFEETH 326

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 14/163 (8%)

Query: 71  IGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGF 130
           + K FG+ +  ++ W  + YSL      LI GR+    G K+  +     + + SL++  
Sbjct: 103 VAKQFGSYS--EIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISAL 160

Query: 131 SVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSL---FGACAPGGFV 187
           +   N +     R   G+G   +   +  I     +   R  ++  L   F   +  G  
Sbjct: 161 ANSMNVLI--GGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAIASVVGPF 218

Query: 188 LGAVFSSLLGQLAWWPWAYWI---MGIACFFLAIAGYFIIPHT 227
           LG VF+S +     W W ++I   +G   FFL +      PHT
Sbjct: 219 LGGVFTSRV----TWRWCFYINLPIGGLTFFLFLMFCNPDPHT 257

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 90/258 (34%), Gaps = 45/258 (17%)

Query: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127
           + ++ + FG  N  +  W  + YSL      L+ GR   I G +   +L    +   SL+
Sbjct: 59  IDVVAEQFG--NYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLV 116

Query: 128 AGFSVYSNKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGKRKNMVFSLFGACAPGGFV 187
           A     +N +                L     ++G T  + + + +V S+         +
Sbjct: 117 AAL---ANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAI 173

Query: 188 LGAVFSSLLGQLAWWPWAYWI------MGIACFFLA--IAGYFIIPHTAMPSRHASSFKL 239
           +G +          W W ++I        +  F L        I+  T       S F+L
Sbjct: 174 VGPIIGGAFTTHVTWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRISKFEL 233

Query: 240 ----------------LERVDFAGSVTGVIGLILF---------NFAWNQGPVVGWQTPY 274
                           L + DF G      GL+LF          ++WN G ++      
Sbjct: 234 RRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQII------ 287

Query: 275 TYILL-IVGTVFLAIFAF 291
           TY++L I+  VF  I+ F
Sbjct: 288 TYLVLGILLFVFSLIYDF 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,473,518
Number of extensions: 2026907
Number of successful extensions: 6371
Number of sequences better than 10.0: 241
Number of HSP's gapped: 6256
Number of HSP's successfully gapped: 251
Length of query: 516
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 402
Effective length of database: 40,409,475
Effective search space: 16244608950
Effective search space used: 16244608950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)