Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3446.69ON46546522670.0
YOR177C (MPC54)6.69ON46446518270.0
Smik_15.3626.69ON46546518130.0
Suva_8.2336.69ON46546518060.0
Kpol_1008.29singletonON5384031661e-11
NDAI0D029304.46ON9603671582e-10
KNAG0F006501.110ON13063701563e-10
CAGL0D00924g4.238ON19803711538e-10
Kpol_483.114.238ON25463621466e-09
Skud_4.6255.414ON9473741456e-09
TBLA0B051606.188ON6522931421e-08
ZYRO0E04708gsingletonON6114181412e-08
TPHA0H016805.414ON9893831412e-08
Kwal_26.93864.238ON12152911412e-08
KLLA0E21517g5.414ON8583451384e-08
YLR309C (IMH1)4.46ON9113251351e-07
TBLA0A104705.267ON19993031351e-07
NCAS0A059604.46ON9203201332e-07
ZYRO0G08250g6.188ON6542921313e-07
CAGL0J00693g5.267ON18842321313e-07
ZYRO0A11132gsingletonON6984451304e-07
ZYRO0C11066g5.267ON19183091288e-07
KAFR0F030204.46ON8243101261e-06
Skud_11.3345.702ON18853461261e-06
KLLA0D06875g8.636ON4622231223e-06
NCAS0F032205.414ON9623831233e-06
NDAI0E014508.636ON5183561223e-06
NCAS0A007701.110ON13043301233e-06
Kwal_55.196975.702ON17602901233e-06
NCAS0A024504.238ON19283411233e-06
TBLA0E040608.604ON8042441215e-06
YIL149C (MLP2)5.702ON16792721215e-06
Skud_9.195.702ON16802771215e-06
KLLA0A00594g5.702ON17482081215e-06
NDAI0D044204.238ON19143101215e-06
TPHA0B008304.238ON25362881216e-06
Ecym_71018.604ON7172401206e-06
CAGL0E03454g4.46ON8672841206e-06
Kpol_1026.314.46ON10052481206e-06
CAGL0L12188g8.259ON13983401207e-06
Smik_4.1764.238ON17952621207e-06
KAFR0G032004.238ON18693211207e-06
NDAI0B057703.479ON7632221198e-06
TDEL0E055304.46ON9062711198e-06
KLLA0E05281g4.238ON17553321199e-06
CAGL0G02497g5.702ON17803431199e-06
Kwal_23.55345.267ON19073171199e-06
SAKL0H05852g8.704ON8694071181e-05
KLTH0E01056g5.702ON17714161181e-05
YDL058W (USO1)4.238ON17903871181e-05
NDAI0B055205.414ON10094101171e-05
TDEL0A058208.636ON4762351161e-05
ZYRO0G21318g1.294ON14541981172e-05
Kpol_274.48.121ON5953121162e-05
Suva_12.2254.364ON7083131152e-05
KLTH0H09438g4.46ON9272291152e-05
Suva_4.1914.238ON17822901153e-05
ZYRO0B12144g4.238ON20053311153e-05
TDEL0G015706.188ON6703011143e-05
TBLA0F032103.393ON4812381133e-05
Kpol_1044.137.101ON11032641143e-05
NDAI0F025702.199ON14972341144e-05
Smik_9.205.702ON16823081144e-05
KLTH0A05544g6.289ON6313081134e-05
ZYRO0B01936gsingletonON8242611134e-05
SAKL0G02024g5.414ON8493291134e-05
YDR356W (SPC110)5.414ON9443071134e-05
KNAG0L021405.702ON16083811135e-05
KNAG0C065905.702ON16512101135e-05
TBLA0I029004.238ON17943111135e-05
Smik_11.3585.702ON18783041135e-05
SAKL0A08206g6.69ON6453911125e-05
NDAI0D026005.88ON11672241126e-05
TBLA0G035308.68ON12322771126e-05
KNAG0F027205.267ON18722351126e-05
Skud_12.3934.46ON9132941118e-05
SAKL0H24200g4.46ON9632911118e-05
Ecym_71787.488ON12693561118e-05
KAFR0B027108.259ON14163071118e-05
Kpol_1033.336.188ON5783181109e-05
KAFR0E040105.414ON9052991101e-04
Kwal_14.23264.46ON9233031101e-04
KNAG0I029604.46ON9643741101e-04
CAGL0L02695g8.636ON4592451091e-04
TPHA0J007208.259ON13932551101e-04
KAFR0D022205.702ON16743231101e-04
ZYRO0F10538g8.331ON25252381101e-04
TDEL0A034005.476ON8102461091e-04
Kpol_1055.275.296ON8293391091e-04
Ecym_83744.46ON9143551091e-04
TDEL0E013304.238ON16573691091e-04
TDEL0A070306.289ON6323281082e-04
TPHA0D014408.704ON8612651082e-04
Suva_14.2602.215ON1992001032e-04
KLTH0F12144g3.425ON8431621072e-04
Ecym_55145.414ON8543401072e-04
TDEL0A072006.306ON8892871072e-04
Smik_4.6225.414ON9441921072e-04
TBLA0B099704.46ON10652931072e-04
TPHA0F012202.257ON10782151072e-04
Suva_15.1337.101ON10922511072e-04
Smik_14.2362.199ON12322021072e-04
KLTH0E01650g7.488ON13961221063e-04
SAKL0H03300g4.238ON17073211063e-04
Kwal_55.215155.414ON5672971053e-04
KAFR0E043404.364ON6162711054e-04
TBLA0B052006.184ON8122971054e-04
CAGL0I10516g3.492ON8132791054e-04
Suva_10.4054.46ON9162551054e-04
KLLA0E19141g6.188ON6482601045e-04
SAKL0E14212g2.16ON9202391045e-04
YFR016C1.377ON12333461045e-04
Suva_8.2698.636ON4852601036e-04
Kpol_520.424.311ON4913031036e-04
TDEL0B021905.702ON18103171046e-04
ZYRO0G06600g5.702ON18202741046e-04
Skud_8.785.267ON19272701046e-04
Kpol_1018.236.289ON6512461036e-04
Skud_10.3574.364ON7053851036e-04
Skud_7.4413.492ON8072901037e-04
SAKL0H08426g8.604ON8162901037e-04
KNAG0C050605.414ON10403261037e-04
NDAI0C042405.338ON4652951027e-04
Kpol_1043.705.702ON13212661037e-04
KAFR0G019208.636ON4732361027e-04
Suva_11.3315.702ON18983291038e-04
Suva_15.2095.267ON19293851038e-04
YGR130C3.492ON8162671029e-04
SAKL0B02288g8.68ON12283311020.001
KLLA0C13794g2.199ON12992871020.001
Skud_14.881.110ON13163011020.001
KLTH0D10274g8.636ON4712571010.001
TBLA0G021904.327ON14132971020.001
Skud_4.1964.238ON17923161020.001
NCAS0G013602.15ON6162701010.001
Kpol_1002.646.188ON6572791010.001
TPHA0E003907.488ON7993341010.001
KNAG0F033905.296ON8752091010.001
KAFR0K015103.425ON9053041010.001
SAKL0C03652g1.119ON10602681010.001
Smik_15.1317.101ON10932541010.001
YNL091W (NST1)2.199ON12402221010.001
Kpol_1029.172.199ON13341751010.001
TBLA0F027507.488ON14143011010.001
TBLA0E044108.259ON14222761010.001
NCAS0A067605.267ON18762811010.001
NDAI0D018305.267ON18902171010.001
Ecym_31895.311ON6682131000.001
KNAG0A033608.604ON7563301000.001
Smik_15.3828.604ON8292801000.002
TDEL0F030703.425ON8772021000.002
KLLA0E15511g5.88ON9052541000.002
Smik_12.3934.46ON9102941000.002
ZYRO0F15378g2.16ON9283001000.002
KAFR0J012502.199ON11462271000.002
ZYRO0D15642g7.186ON11702891000.002
TPHA0D046105.702ON11832141000.002
YNL250W (RAD50)1.110ON13123211000.002
NDAI0K017702.563ON311236980.002
SAKL0H25608g4.25ON204167960.002
Smik_8.905.267ON19272641000.002
SAKL0F05918g3.425ON830210990.002
Suva_7.4183.492ON831278990.002
Smik_6.2263.492ON839327990.002
TBLA0C027401.295ON1119259990.002
SAKL0F07282g7.186ON1170269990.002
TPHA0E002305.702ON1284313990.002
KNAG0M018402.199ON1291293990.002
NCAS0C016208.659ON464151980.002
KNAG0A031708.636ON471238980.002
TBLA0B018102.199ON1504219990.002
SAKL0B10274g7.68ON1554190990.002
Ecym_34343.393ON486234980.002
KLTH0D14102g4.238ON1712304990.002
Kwal_27.112328.331ON3336184990.002
TBLA0C056701.162ON627290980.002
TPHA0H020606.289ON680188980.003
NCAS0B018008.604ON791256980.003
Suva_10.2791.60ON803205980.003
ZYRO0G16588g5.296ON927212980.003
YKL105C2.476ON1132168980.003
Suva_14.921.110ON1312280980.003
NCAS0G002305.702ON1735270980.003
Kpol_1050.1033.479ON697231970.003
CAGL0I10901g8.604ON816278970.003
Skud_15.3628.604ON829270970.003
NDAI0C058808.604ON846294970.004
TBLA0A036205.414ON970289970.004
KNAG0B060104.237ON1117184970.004
NDAI0G020707.186ON1171292970.004
Suva_14.2492.199ON1244334970.004
KAFR0D037601.110ON1301312970.004
NDAI0F002905.702ON1554283970.004
YHR023W (MYO1)5.267ON1928213970.004
CAGL0H00638g6.289ON584198960.004
NDAI0B019708.259ON1415258960.005
AEL015W3.149ON455319950.005
Suva_9.395.702ON1682462960.005
KLLA0C14586g5.338ON474187950.005
NCAS0J01230singletonON319267940.005
NCAS0F034703.479ON698190950.006
NCAS0F025005.296ON831325950.006
NCAS0G029502.234ON216169920.006
Kpol_1031.155.414ON929287950.006
KLLA0D13948g7.137ON281194930.006
TDEL0F015804.39ON1229130950.006
KNAG0B031005.630ON289256930.007
YKR095W (MLP1)5.702ON1875321950.007
TPHA0K011506.69ON324234930.007
NCAS0G010406.289ON608200940.007
TPHA0L006107.102ON706305940.008
ZYRO0C08030g1.162ON711211940.008
NCAS0A025504.268ON712314940.008
Kpol_1018.1413.425ON764197940.008
KNAG0A078803.479ON764195940.008
SAKL0H03322g4.237ON1111235940.008
Skud_14.2402.199ON1243273940.009
Kwal_26.86348.636ON447230930.009
Kpol_1059.308.636ON457320930.009
KNAG0D043404.238ON2220280940.009
NDAI0F007905.630ON315219920.009
AFL170C6.289ON633240930.010
YDR295C (HDA2)5.311ON674211930.010
Kpol_543.608.315ON177130890.011
Kpol_269.28.443ON865256930.011
CAGL0A02596g5.414ON872334930.011
NCAS0E011803.425ON947264930.011
KLTH0B08316g2.16ON950323930.011
Kpol_2001.755.702ON1006299930.011
Skud_13.171na 1ON404225920.011
Smik_7.3467.186ON1170196930.011
Kpol_1039.262.257ON1204202930.011
TPHA0P009302.199ON1311270930.011
TDEL0F038608.259ON1399250930.011
ZYRO0F06424g8.636ON452258920.012
TPHA0F027706.91ON293188910.012
Kwal_14.21838.121ON574168920.013
TPHA0N016502.633ON682246920.013
KAFR0G029307.186ON1170194920.015
YKL201C (MNN4)1.509ON1178291920.015
Ecym_73038.68ON1222323920.015
SAKL0E14916g5.702ON1779316920.015
NCAS0A032005.702ON1788304920.015
Kpol_479.88.609ON477265910.016
NCAS0B013108.636ON487367910.016
YML071C (COG8)4.339ON607218910.017
ZYRO0F10714g8.604ON708338910.018
KLTH0C09966g3.106ON760206910.018
ZYRO0F09570g5.414ON835272910.018
YDR285W (ZIP1)5.296ON875237910.018
NOTE: 5 genes in the same pillar as Skud_15.344 were not hit in these BLAST results
LIST: KLTH0G15334g AGR274C Kwal_56.23256 TDEL0G04560 Ecym_3119

BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_15.344
         (1398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...   877   0.0  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...   708   0.0  
Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...   702   0.0  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...   700   0.0  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    69   1e-11
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    65   2e-10
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    65   3e-10
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    64   8e-10
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    61   6e-09
Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356...    60   6e-09
TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] ...    59   1e-08
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    59   2e-08
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    59   2e-08
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    59   2e-08
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    58   4e-08
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    57   1e-07
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    57   1e-07
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    56   2e-07
ZYRO0G08250g Chr7 (671493..673457) [1965 bp, 654 aa] {ON} simila...    55   3e-07
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    55   3e-07
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    55   4e-07
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    54   8e-07
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    53   1e-06
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    53   1e-06
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    52   3e-06
NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.4...    52   3e-06
NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.6...    52   3e-06
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    52   3e-06
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...    52   3e-06
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    52   3e-06
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    51   5e-06
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    51   5e-06
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    51   5e-06
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    51   5e-06
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    51   5e-06
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    51   6e-06
Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar t...    51   6e-06
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    51   6e-06
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    51   6e-06
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    51   7e-06
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    51   7e-06
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    51   7e-06
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    50   8e-06
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    50   8e-06
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    50   9e-06
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    50   9e-06
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    50   9e-06
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    50   1e-05
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...    50   1e-05
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    50   1e-05
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    50   1e-05
TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] ...    49   1e-05
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    50   2e-05
Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)...    49   2e-05
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    49   2e-05
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    49   2e-05
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    49   3e-05
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    49   3e-05
TDEL0G01570 Chr7 complement(309710..311722) [2013 bp, 670 aa] {O...    49   3e-05
TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {O...    48   3e-05
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    49   3e-05
NDAI0F02570 Chr6 complement(630462..634955) [4494 bp, 1497 aa] {...    49   4e-05
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    49   4e-05
KLTH0A05544g Chr1 (460303..462198) [1896 bp, 631 aa] {ON} weakly...    48   4e-05
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    48   4e-05
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    48   4e-05
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    48   4e-05
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    48   5e-05
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    48   5e-05
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    48   5e-05
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    48   5e-05
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    48   5e-05
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    48   6e-05
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    48   6e-05
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    48   6e-05
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    47   8e-05
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    47   8e-05
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    47   8e-05
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    47   8e-05
Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON} (91526....    47   9e-05
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    47   1e-04
Kwal_14.2326 s14 (707822..710593) [2772 bp, 923 aa] {ON} YLR309C...    47   1e-04
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    47   1e-04
CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} simil...    47   1e-04
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    47   1e-04
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    47   1e-04
ZYRO0F10538g Chr6 (856604..864181) [7578 bp, 2525 aa] {ON} weakl...    47   1e-04
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...    47   1e-04
Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON} (70806....    47   1e-04
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    47   1e-04
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    47   1e-04
TDEL0A07030 Chr1 (1229629..1231527) [1899 bp, 632 aa] {ON} Anc_6...    46   2e-04
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    46   2e-04
Suva_14.260 Chr14 complement(477268..477867) [600 bp, 199 aa] {O...    44   2e-04
KLTH0F12144g Chr6 complement(1023571..1026102) [2532 bp, 843 aa]...    46   2e-04
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    46   2e-04
TDEL0A07200 Chr1 complement(1255540..1258209) [2670 bp, 889 aa] ...    46   2e-04
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    46   2e-04
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    46   2e-04
TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {...    46   2e-04
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    46   2e-04
Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL09...    46   2e-04
KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa] ...    45   3e-04
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    45   3e-04
Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {...    45   3e-04
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    45   4e-04
TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa] ...    45   4e-04
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    45   4e-04
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    45   4e-04
KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} simi...    45   5e-04
SAKL0E14212g Chr5 (1169895..1172657) [2763 bp, 920 aa] {ON} simi...    45   5e-04
YFR016C Chr6 complement(177042..180743) [3702 bp, 1233 aa] {ON} ...    45   5e-04
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    44   6e-04
Kpol_520.42 s520 (101479..102954) [1476 bp, 491 aa] {ON} (101479...    44   6e-04
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    45   6e-04
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    45   6e-04
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    45   6e-04
Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {O...    44   6e-04
Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {...    44   6e-04
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    44   7e-04
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    44   7e-04
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    44   7e-04
NDAI0C04240 Chr3 complement(966340..967737) [1398 bp, 465 aa] {O...    44   7e-04
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    44   7e-04
KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.6...    44   7e-04
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    44   8e-04
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    44   8e-04
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    44   9e-04
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    44   0.001
KLLA0C13794g Chr3 (1178848..1182747) [3900 bp, 1299 aa] {ON} som...    44   0.001
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    44   0.001
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    44   0.001
TBLA0G02190 Chr7 complement(568903..573144) [4242 bp, 1413 aa] {...    44   0.001
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    44   0.001
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    44   0.001
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    44   0.001
TPHA0E00390 Chr5 complement(64714..67113) [2400 bp, 799 aa] {ON}...    44   0.001
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    44   0.001
KAFR0K01510 Chr11 (311581..314298) [2718 bp, 905 aa] {ON} Anc_3....    44   0.001
SAKL0C03652g Chr3 (344282..347464) [3183 bp, 1060 aa] {ON} weakl...    44   0.001
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    44   0.001
YNL091W Chr14 (452408..456130) [3723 bp, 1240 aa] {ON}  NST1Prot...    44   0.001
Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON} (32401...    44   0.001
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    44   0.001
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    44   0.001
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    44   0.001
NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {...    44   0.001
Ecym_3189 Chr3 complement(364109..366115) [2007 bp, 668 aa] {ON}...    43   0.001
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    43   0.001
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    43   0.002
TDEL0F03070 Chr6 (559392..562025) [2634 bp, 877 aa] {ON} Anc_3.4...    43   0.002
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    43   0.002
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    43   0.002
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    43   0.002
KAFR0J01250 Chr10 complement(230562..234002) [3441 bp, 1146 aa] ...    43   0.002
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    43   0.002
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    43   0.002
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    43   0.002
NDAI0K01770 Chr11 (395335..396270) [936 bp, 311 aa] {ON} Anc_2.5...    42   0.002
SAKL0H25608g Chr8 complement(2243456..2244070) [615 bp, 204 aa] ...    42   0.002
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    43   0.002
SAKL0F05918g Chr6 (444390..446882) [2493 bp, 830 aa] {ON} simila...    43   0.002
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    43   0.002
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    43   0.002
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    43   0.002
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    43   0.002
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    43   0.002
KNAG0M01840 Chr13 complement(341241..345116) [3876 bp, 1291 aa] ...    43   0.002
NCAS0C01620 Chr3 (300476..301870) [1395 bp, 464 aa] {ON} Anc_8.6...    42   0.002
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    42   0.002
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    43   0.002
SAKL0B10274g Chr2 (881660..886324) [4665 bp, 1554 aa] {ON} unipr...    43   0.002
Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar t...    42   0.002
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    43   0.002
Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR1...    43   0.002
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    42   0.002
TPHA0H02060 Chr8 (487254..489296) [2043 bp, 680 aa] {ON} Anc_6.2...    42   0.003
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    42   0.003
Suva_10.279 Chr10 (490526..492937) [2412 bp, 803 aa] {ON} YLR182...    42   0.003
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    42   0.003
YKL105C Chr11 complement(239185..242583) [3399 bp, 1132 aa] {ON}...    42   0.003
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    42   0.003
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    42   0.003
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...    42   0.003
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    42   0.003
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    42   0.003
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    42   0.004
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    42   0.004
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.004
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    42   0.004
Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL09...    42   0.004
KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {...    42   0.004
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    42   0.004
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    42   0.004
CAGL0H00638g Chr8 complement(61015..62769) [1755 bp, 584 aa] {ON...    42   0.004
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....    42   0.005
AEL015W Chr5 (608518..609885) [1368 bp, 455 aa] {ON} Syntenic ho...    41   0.005
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    42   0.005
KLLA0C14586g Chr3 complement(1274520..1275944) [1425 bp, 474 aa]...    41   0.005
NCAS0J01230 Chr10 (215105..216064) [960 bp, 319 aa] {ON}               41   0.005
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...    41   0.006
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    41   0.006
NCAS0G02950 Chr7 complement(541260..541910) [651 bp, 216 aa] {ON...    40   0.006
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    41   0.006
KLLA0D13948g Chr4 (1198201..1199046) [846 bp, 281 aa] {ON} weakl...    40   0.006
TDEL0F01580 Chr6 complement(288032..291721) [3690 bp, 1229 aa] {...    41   0.006
KNAG0B03100 Chr2 complement(597560..598429) [870 bp, 289 aa] {ON...    40   0.007
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    41   0.007
TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.6...    40   0.007
NCAS0G01040 Chr7 complement(179805..181631) [1827 bp, 608 aa] {O...    41   0.007
TPHA0L00610 Chr12 (106262..108382) [2121 bp, 706 aa] {ON} Anc_7....    41   0.008
ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} simila...    41   0.008
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    41   0.008
Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]...    41   0.008
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...    41   0.008
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    41   0.008
Skud_14.240 Chr14 (442718..446449) [3732 bp, 1243 aa] {ON} YNL09...    41   0.009
Kwal_26.8634 s26 complement(875659..877002) [1344 bp, 447 aa] {O...    40   0.009
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    40   0.009
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    41   0.009
NDAI0F00790 Chr6 complement(189781..190728) [948 bp, 315 aa] {ON...    40   0.009
AFL170C Chr6 complement(116228..118129) [1902 bp, 633 aa] {ON} S...    40   0.010
YDR295C Chr4 complement(1052623..1054647) [2025 bp, 674 aa] {ON}...    40   0.010
Kpol_543.60 s543 (140661..141194) [534 bp, 177 aa] {ON} (140661....    39   0.011
Kpol_269.2 s269 (2702..5299) [2598 bp, 865 aa] {ON} (2702..5299)...    40   0.011
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    40   0.011
NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {O...    40   0.011
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    40   0.011
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    40   0.011
Skud_13.171 Chr13 (293952..295166) [1215 bp, 404 aa] {ON} YMR017...    40   0.011
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    40   0.011
Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON} (82489...    40   0.011
TPHA0P00930 Chr16 complement(187009..190944) [3936 bp, 1311 aa] ...    40   0.011
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    40   0.011
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    40   0.012
TPHA0F02770 Chr6 complement(612966..613847) [882 bp, 293 aa] {ON...    40   0.012
Kwal_14.2183 s14 complement(647952..649676) [1725 bp, 574 aa] {O...    40   0.013
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    40   0.013
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    40   0.015
YKL201C Chr11 complement(63930..67466) [3537 bp, 1178 aa] {ON}  ...    40   0.015
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    40   0.015
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    40   0.015
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    40   0.015
Kpol_479.8 s479 complement(16333..17766) [1434 bp, 477 aa] {ON} ...    40   0.016
NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {O...    40   0.016
YML071C Chr13 complement(129749..131572) [1824 bp, 607 aa] {ON} ...    40   0.017
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    40   0.018
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    40   0.018
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    40   0.018
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    40   0.018
ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON...    40   0.019
Kpol_1044.17 s1044 (36316..37518) [1203 bp, 400 aa] {ON} (36316....    39   0.019
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    40   0.019
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    40   0.020
Kwal_26.7055 s26 complement(190653..195320) [4668 bp, 1555 aa] {...    40   0.020
TBLA0J00420 Chr10 (76709..78136) [1428 bp, 475 aa] {ON} Anc_8.63...    39   0.021
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    39   0.021
KAFR0B06220 Chr2 complement(1279469..1281088) [1620 bp, 539 aa] ...    39   0.022
CAGL0M03905g Chr13 (437944..439704) [1761 bp, 586 aa] {ON} simil...    39   0.022
CAGL0G09867g Chr7 complement(942215..944149) [1935 bp, 644 aa] {...    39   0.023
SAKL0G06512g Chr7 complement(543956..544978) [1023 bp, 340 aa] {...    39   0.023
KAFR0C02150 Chr3 (428622..430691) [2070 bp, 689 aa] {ON} Anc_6.1...    39   0.023
Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON} (57362....    39   0.023
KAFR0G00410 Chr7 (120504..121676) [1173 bp, 390 aa] {ON} Anc_1.1...    39   0.025
KLLA0E01915g Chr5 complement(180022..183243) [3222 bp, 1073 aa] ...    39   0.025
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    39   0.025
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    39   0.025
TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON}               39   0.026
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    39   0.027
Kpol_1028.48 s1028 complement(115150..115623) [474 bp, 157 aa] {...    37   0.028
KLTH0B08690g Chr2 (704855..706639) [1785 bp, 594 aa] {ON} weakly...    39   0.029
TBLA0A01720 Chr1 (414871..416682) [1812 bp, 603 aa] {ON} Anc_8.4...    39   0.029
CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {...    37   0.029
YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON} ...    39   0.030
TPHA0D01850 Chr4 complement(386116..388167) [2052 bp, 683 aa] {O...    39   0.030
CAGL0J05434g Chr10 (520083..520682) [600 bp, 199 aa] {ON} highly...    38   0.031
ZYRO0F01188g Chr6 (94085..96631) [2547 bp, 848 aa] {ON} similar ...    39   0.032
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    39   0.032
Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {O...    39   0.032
Skud_7.369 Chr7 (621608..622768) [1161 bp, 386 aa] {ON} YGR072W ...    39   0.033
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    39   0.033
NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {...    39   0.034
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    39   0.035
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    39   0.035
SAKL0A05170g Chr1 complement(466816..468768) [1953 bp, 650 aa] {...    39   0.040
KAFR0K01620 Chr11 (340011..342056) [2046 bp, 681 aa] {ON} Anc_3....    39   0.040
NDAI0I01220 Chr9 complement(293892..295994) [2103 bp, 700 aa] {O...    39   0.040
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    39   0.040
SAKL0D14454g Chr4 (1186923..1189358) [2436 bp, 811 aa] {ON} weak...    39   0.042
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    39   0.042
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    39   0.042
ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syn...    39   0.042
KNAG0B01160 Chr2 complement(216662..219280) [2619 bp, 872 aa] {O...    39   0.042
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    39   0.042
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    39   0.044
KLTH0G08250g Chr7 (672012..675770) [3759 bp, 1252 aa] {ON} some ...    39   0.044
SAKL0E09856g Chr5 complement(820709..824518) [3810 bp, 1269 aa] ...    39   0.044
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    39   0.045
KLTH0D02068g Chr4 complement(200288..204958) [4671 bp, 1556 aa] ...    39   0.045
YBR152W Chr2 (546376..547251) [876 bp, 291 aa] {ON}  SPP381mRNA ...    38   0.048
KLLA0E01475g Chr5 complement(143257..144213) [957 bp, 318 aa] {O...    38   0.051
AGR229W Chr7 (1177911..1180028) [2118 bp, 705 aa] {ON} Syntenic ...    38   0.053
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    38   0.053
Skud_13.186 Chr13 complement(318929..321460) [2532 bp, 843 aa] {...    38   0.055
Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W ...    38   0.055
NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]...    38   0.057
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    38   0.059
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    38   0.061
TBLA0A07430 Chr1 complement(1839818..1840723) [906 bp, 301 aa] {...    37   0.065
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    38   0.066
YMR198W Chr13 (659745..661529) [1785 bp, 594 aa] {ON}  CIK1Kines...    38   0.067
YPL253C Chr16 complement(71063..73006) [1944 bp, 647 aa] {ON}  V...    38   0.069
Smik_7.197 Chr7 (341623..343776) [2154 bp, 717 aa] {ON} YGL086W ...    38   0.070
TPHA0A04560 Chr1 complement(1036993..1037712) [720 bp, 239 aa] {...    37   0.071
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    38   0.076
Suva_10.539 Chr10 complement(932196..933452) [1257 bp, 418 aa] {...    37   0.078
Skud_11.53 Chr11 (112067..113341) [1275 bp, 424 aa] {ON} YKL172W...    37   0.079
Skud_8.123 Chr8 (202671..204032) [1362 bp, 453 aa] {ON} YHR066W ...    37   0.081
Kpol_1033.45 s1033 complement(113755..114597) [843 bp, 281 aa] {...    37   0.082
Kpol_YGOB_1033.45 s1033 complement(113725..114597) [873 bp, 291 ...    37   0.084
KLTH0D12892g Chr4 complement(1051723..1052676) [954 bp, 317 aa] ...    37   0.089
TBLA0E00350 Chr5 (61567..63984) [2418 bp, 805 aa] {ON} Anc_3.546...    37   0.095
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    37   0.097
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    37   0.10 
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    37   0.10 
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    37   0.10 
ZYRO0C15488g Chr3 complement(1209452..1213954) [4503 bp, 1500 aa...    37   0.10 
NCAS0A08860 Chr1 (1753035..1753544) [510 bp, 169 aa] {ON} Anc_1....    36   0.11 
TPHA0D01160 Chr4 (243973..245331) [1359 bp, 452 aa] {ON} Anc_8.6...    37   0.11 
NCAS0B08810 Chr2 (1692462..1693919) [1458 bp, 485 aa] {ON} Anc_1...    37   0.11 
Skud_15.62 Chr15 (104695..106530) [1836 bp, 611 aa] {ON} YOL091W...    37   0.12 
Kpol_1013.36 s1013 (86548..88500) [1953 bp, 650 aa] {ON} (86548....    37   0.12 
Skud_16.26 Chr16 complement(45266..47215) [1950 bp, 650 aa] {ON}...    37   0.12 
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...    37   0.12 
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    37   0.12 
ZYRO0G08712g Chr7 complement(702763..703794) [1032 bp, 343 aa] {...    37   0.12 
TBLA0C02510 Chr3 complement(592152..594608) [2457 bp, 818 aa] {O...    37   0.13 
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    37   0.13 
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    37   0.13 
KAFR0C02060 Chr3 (409684..410895) [1212 bp, 403 aa] {ON} Anc_3.5...    37   0.13 
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    37   0.13 
SAKL0G06314g Chr7 (525076..530016) [4941 bp, 1646 aa] {ON} some ...    37   0.14 
Suva_13.184 Chr13 (298007..299257) [1251 bp, 416 aa] {ON} YMR017...    37   0.14 
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    37   0.14 
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    37   0.14 
ZYRO0F06974g Chr6 (568852..570165) [1314 bp, 437 aa] {ON} simila...    37   0.14 
KNAG0D00670 Chr4 complement(98205..99818) [1614 bp, 537 aa] {ON}...    37   0.15 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    37   0.15 
Ecym_3250 Chr3 complement(473064..475115) [2052 bp, 683 aa] {ON}...    37   0.16 
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    37   0.16 
Skud_4.182 Chr4 complement(319563..321665) [2103 bp, 700 aa] {ON...    37   0.16 
KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {O...    37   0.17 
NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {O...    37   0.17 
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....    37   0.17 
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    37   0.17 
TBLA0C02340 Chr3 complement(554335..557685) [3351 bp, 1116 aa] {...    37   0.17 
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    37   0.18 
TDEL0C05910 Chr3 complement(1063668..1067585) [3918 bp, 1305 aa]...    37   0.18 
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...    37   0.18 
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    37   0.18 
Suva_8.304 Chr8 (546424..547260) [837 bp, 278 aa] {ON} YOR255W (...    36   0.19 
SAKL0B00880g Chr2 complement(82514..82954) [441 bp, 146 aa] {ON}...    35   0.20 
YOL091W Chr15 (145334..147163) [1830 bp, 609 aa] {ON}  SPO21Comp...    36   0.20 
Kwal_27.11183 s27 (675668..677650) [1983 bp, 660 aa] {ON} YGL086...    36   0.21 
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    36   0.21 
SAKL0H13970g Chr8 (1191579..1194056) [2478 bp, 825 aa] {ON} simi...    36   0.22 
AER241W Chr5 (1082034..1084592) [2559 bp, 852 aa] {ON} Syntenic ...    36   0.22 
NDAI0K00210 Chr11 (31213..33975) [2763 bp, 920 aa] {ON} Anc_8.87...    36   0.22 
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    36   0.23 
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    36   0.23 
NCAS0G02720 Chr7 (487110..491003) [3894 bp, 1297 aa] {ON} Anc_2....    36   0.23 
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    36   0.23 
TBLA0G01840 Chr7 (486912..488105) [1194 bp, 397 aa] {ON} Anc_2.5...    36   0.23 
Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON...    36   0.24 
KLTH0F11396g Chr6 (967691..968962) [1272 bp, 423 aa] {ON} some s...    36   0.24 
YKL172W Chr11 (125759..127042) [1284 bp, 427 aa] {ON}  EBP2Requi...    36   0.24 
TPHA0C03010 Chr3 (658399..660078) [1680 bp, 559 aa] {ON} Anc_2.2...    36   0.26 
Suva_2.176 Chr2 complement(303607..305313) [1707 bp, 568 aa] {ON...    36   0.26 
NCAS0A08680 Chr1 complement(1716853..1718706) [1854 bp, 617 aa] ...    36   0.27 
Suva_8.324 Chr8 complement(578609..580591) [1983 bp, 660 aa] {ON...    36   0.27 
NCAS0C04210 Chr3 complement(863817..865814) [1998 bp, 665 aa] {O...    36   0.27 
Smik_4.544 Chr4 complement(984215..986239) [2025 bp, 674 aa] {ON...    36   0.27 
KAFR0F03620 Chr6 complement(716398..718497) [2100 bp, 699 aa] {O...    36   0.28 
Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON...    36   0.28 
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    36   0.28 
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...    36   0.28 
NDAI0K01710 Chr11 (381072..383606) [2535 bp, 844 aa] {ON} Anc_6....    36   0.29 
KLLA0D14707g Chr4 (1242483..1245125) [2643 bp, 880 aa] {ON} simi...    36   0.29 
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    36   0.29 
TDEL0B01520 Chr2 complement(268066..270717) [2652 bp, 883 aa] {O...    36   0.29 
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...    36   0.29 
NCAS0C00450 Chr3 (73352..76393) [3042 bp, 1013 aa] {ON} Anc_8.834      36   0.29 
Skud_11.19 Chr11 complement(47376..50876) [3501 bp, 1166 aa] {ON...    36   0.30 
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    36   0.30 
NDAI0A00740 Chr1 complement(139425..143852) [4428 bp, 1475 aa] {...    36   0.31 
NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON}              36   0.31 
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    36   0.31 
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...    36   0.32 
Smik_3.48 Chr3 complement(70262..71590) [1329 bp, 442 aa] {ON} Y...    35   0.32 
YHR066W Chr8 (229335..230696) [1362 bp, 453 aa] {ON}  SSF1Consti...    35   0.32 
TDEL0A00580 Chr1 complement(99187..100875) [1689 bp, 562 aa] {ON...    35   0.35 
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    35   0.35 
ZYRO0C05676g Chr3 complement(434420..436297) [1878 bp, 625 aa] {...    35   0.36 
TDEL0D00520 Chr4 (94918..96915) [1998 bp, 665 aa] {ON} Anc_4.364...    35   0.36 
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    35   0.37 
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    35   0.37 
TBLA0A10580 Chr1 (2617516..2619957) [2442 bp, 813 aa] {ON} Anc_4...    35   0.38 
AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,...    35   0.38 
TDEL0D03220 Chr4 (600997..603954) [2958 bp, 985 aa] {ON} Anc_3.3...    35   0.39 
YPL009C Chr16 complement(535820..538936) [3117 bp, 1038 aa] {ON}...    35   0.39 
KAFR0H00680 Chr8 complement(124249..127452) [3204 bp, 1067 aa] {...    35   0.39 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    35   0.39 
Kpol_1056.19 s1056 complement(40349..43744) [3396 bp, 1131 aa] {...    35   0.39 
SAKL0G19426g Chr7 complement(1670664..1671386) [723 bp, 240 aa] ...    35   0.40 
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    35   0.40 
TBLA0F03730 Chr6 complement(913525..914658) [1134 bp, 377 aa] {O...    35   0.40 
Kpol_1053.12 s1053 complement(15359..16558) [1200 bp, 399 aa] {O...    35   0.41 
TBLA0B09660 Chr2 (2292300..2297510) [5211 bp, 1736 aa] {ON} Anc_...    35   0.41 
TBLA0B05400 Chr2 (1268360..1269490,1269492..1273817) [5457 bp, 1...    35   0.41 
TBLA0D00990 Chr4 (258884..264577) [5694 bp, 1897 aa] {ON} Anc_8....    35   0.41 
NCAS0A11660 Chr1 (2321294..2322625) [1332 bp, 443 aa] {ON} Anc_3...    35   0.43 
Kpol_1032.20 s1032 complement(46064..47467) [1404 bp, 467 aa] {O...    35   0.43 
TPHA0N01050 Chr14 complement(222234..223046) [813 bp, 270 aa] {O...    35   0.44 
Skud_11.199 Chr11 (364625..366079) [1455 bp, 484 aa] {ON} YKL028...    35   0.44 
Kpol_340.5 s340 complement(8948..10549) [1602 bp, 533 aa] {ON} c...    35   0.45 
CAGL0G00264g Chr7 (26046..26912) [867 bp, 288 aa] {ON} similar t...    35   0.46 
YBR148W Chr2 (537876..539705) [1830 bp, 609 aa] {ON}  YSW1Protei...    35   0.47 
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    35   0.47 
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    35   0.47 
Kpol_328.3 s328 (9868..11835) [1968 bp, 655 aa] {ON} (9868..1183...    35   0.47 
AFL065C Chr6 complement(312000..313979) [1980 bp, 659 aa] {ON} S...    35   0.47 
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    35   0.48 
Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W ...    35   0.49 
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    35   0.49 
ZYRO0B06182g Chr2 complement(496610..499180) [2571 bp, 856 aa] {...    35   0.50 
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    35   0.50 
NDAI0C03980 Chr3 complement(901982..904702) [2721 bp, 906 aa] {O...    35   0.50 
TPHA0J01460 Chr10 (339107..340132) [1026 bp, 341 aa] {ON} Anc_5....    35   0.50 
TBLA0J01890 Chr10 (444942..447923) [2982 bp, 993 aa] {ON}              35   0.51 
NDAI0G01310 Chr7 complement(290871..293945) [3075 bp, 1024 aa] {...    35   0.51 
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    35   0.52 
TDEL0C04640 Chr3 complement(838217..842107) [3891 bp, 1296 aa] {...    35   0.52 
YDR259C Chr4 complement(974631..975782) [1152 bp, 383 aa] {ON}  ...    35   0.53 
Suva_7.355 Chr7 (610707..611876) [1170 bp, 389 aa] {ON} YGR072W ...    35   0.53 
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    35   0.54 
NDAI0E02340 Chr5 (489675..491027) [1353 bp, 450 aa] {ON} Anc_8.6...    35   0.56 
SAKL0D13376g Chr4 (1107715..1109154) [1440 bp, 479 aa] {ON} simi...    35   0.58 
KLLA0D02090g Chr4 (178880..180688) [1809 bp, 602 aa] {ON} some s...    35   0.61 
KLLA0B10329g Chr2 (902691..904532) [1842 bp, 613 aa] {ON} weakly...    35   0.62 
TPHA0K02200 Chr11 complement(469540..471408) [1869 bp, 622 aa] {...    35   0.62 
CAGL0F01265g Chr6 (131725..133596) [1872 bp, 623 aa] {ON} some s...    35   0.62 
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...    35   0.62 
TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa] ...    35   0.62 
NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696...    35   0.64 
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    35   0.64 
Smik_12.404 Chr12 complement(707440..709794) [2355 bp, 784 aa] {...    35   0.65 
SAKL0H21230g Chr8 complement(1849982..1852651) [2670 bp, 889 aa]...    35   0.66 
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    35   0.67 
CAGL0M01804g Chr13 (211439..214294) [2856 bp, 951 aa] {ON} highl...    35   0.67 
KNAG0F00720 Chr6 (123118..126051) [2934 bp, 977 aa] {ON} Anc_1.1...    35   0.67 
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    35   0.68 
TBLA0D03720 Chr4 complement(920546..923770) [3225 bp, 1074 aa] {...    35   0.68 
KAFR0A08660 Chr1 (1735466..1738753) [3288 bp, 1095 aa] {ON} Anc_...    35   0.68 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   0.68 
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    35   0.69 
Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL25...    35   0.69 
Kpol_2002.21 s2002 complement(42642..43778) [1137 bp, 378 aa] {O...    34   0.70 
TBLA0A03310 Chr1 (787743..792512) [4770 bp, 1589 aa] {ON} Anc_5....    35   0.70 
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    35   0.71 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    35   0.71 
TBLA0A09870 Chr1 (2426725..2427906) [1182 bp, 393 aa] {ON}             34   0.71 
Kpol_1052.29 s1052 (92118..93359) [1242 bp, 413 aa] {ON} (92118....    34   0.72 
NCAS0J01880 Chr10 complement(359583..360893) [1311 bp, 436 aa] {...    34   0.74 
NCAS0F02780 Chr6 complement(559644..561026) [1383 bp, 460 aa] {O...    34   0.75 
KAFR0D03610 Chr4 complement(704032..705414) [1383 bp, 460 aa] {O...    34   0.75 
NCAS0B08800 Chr2 complement(1690738..1692240) [1503 bp, 500 aa] ...    34   0.77 
Ecym_6065 Chr6 complement(122890..123738) [849 bp, 282 aa] {ON} ...    34   0.79 
Smik_6.457 Chr6 (751338..753281) [1944 bp, 647 aa] {ON} YPL253C ...    34   0.82 
KNAG0C00940 Chr3 complement(178596..180593) [1998 bp, 665 aa] {O...    34   0.83 
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    34   0.83 
TBLA0B04890 Chr2 complement(1152059..1154065) [2007 bp, 668 aa] ...    34   0.83 
NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {...    34   0.84 
YDR068W Chr4 (583713..584645) [933 bp, 310 aa] {ON}  DOS2Protein...    34   0.84 
KAFR0C02470 Chr3 complement(479994..482387) [2394 bp, 797 aa] {O...    34   0.85 
NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {O...    34   0.85 
Smik_12.243 Chr12 (464959..467373) [2415 bp, 804 aa] {ON} YLR182...    34   0.85 
CAGL0G02959g Chr7 (272520..275276) [2757 bp, 918 aa] {ON} simila...    34   0.87 
TDEL0A05940 Chr1 (1041627..1044863) [3237 bp, 1078 aa] {ON} Anc_...    34   0.89 
YLR223C Chr12 complement(582233..585490) [3258 bp, 1085 aa] {ON}...    34   0.89 
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    34   0.89 
NDAI0G04840 Chr7 complement(1165244..1168516) [3273 bp, 1090 aa]...    34   0.89 
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    34   0.90 
TBLA0E04730 Chr5 (1208306..1212190) [3885 bp, 1294 aa] {ON}            34   0.91 
SAKL0H15136g Chr8 complement(1312258..1316298) [4041 bp, 1346 aa...    34   0.91 
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    34   0.93 
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    34   0.94 
TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {O...    34   0.97 
AAL040W Chr1 (272459..273781) [1323 bp, 440 aa] {ON} Syntenic ho...    34   0.98 
CAGL0L02057g Chr12 (243489..244889) [1401 bp, 466 aa] {ON} highl...    34   0.99 
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...    34   1.0  
NCAS0A12590 Chr1 (2484051..2484929) [879 bp, 292 aa] {ON} Anc_2....    33   1.1  
KLTH0F04334g Chr6 complement(382773..384677) [1905 bp, 634 aa] {...    34   1.1  
TPHA0E00590 Chr5 (103667..104551) [885 bp, 294 aa] {ON} Anc_7.45...    33   1.1  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...    34   1.1  
ZYRO0C08008g Chr3 (613635..616136) [2502 bp, 833 aa] {ON} simila...    34   1.1  
KNAG0D01800 Chr4 complement(301023..303542) [2520 bp, 839 aa] {O...    34   1.1  
KAFR0C05660 Chr3 complement(1126734..1129262) [2529 bp, 842 aa] ...    34   1.1  
Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {...    34   1.1  
TDEL0B06830 Chr2 complement(1208432..1211107) [2676 bp, 891 aa] ...    34   1.1  
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    34   1.1  
TBLA0B04370 Chr2 complement(1010226..1013075) [2850 bp, 949 aa] ...    34   1.2  
TPHA0A02680 Chr1 complement(575046..578117) [3072 bp, 1023 aa] {...    34   1.2  
CAGL0H00737g Chr8 complement(70626..73754) [3129 bp, 1042 aa] {O...    34   1.2  
Ecym_4585 Chr4 (1144399..1145430) [1032 bp, 343 aa] {ON} similar...    33   1.2  
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    34   1.2  
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    34   1.2  
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    34   1.2  
CAGL0K09834g Chr11 complement(960893..964855) [3963 bp, 1320 aa]...    34   1.2  
TPHA0A01520 Chr1 complement(296953..302685) [5733 bp, 1910 aa] {...    34   1.2  
SAKL0A04620g Chr1 (426819..427997) [1179 bp, 392 aa] {ON} simila...    33   1.2  
Kthe_YGOB_Anc_5.296 Chr7 (520932..522119) [1188 bp, 395 aa] {ON}...    33   1.2  
TPHA0A02020 Chr1 complement(410848..412083) [1236 bp, 411 aa] {O...    33   1.3  
Smik_2.270 Chr2 complement(480391..481668) [1278 bp, 425 aa] {ON...    33   1.3  
KLTH0F08250g Chr6 (716337..717635) [1299 bp, 432 aa] {ON} simila...    33   1.3  
Smik_8.137 Chr8 (204616..205983) [1368 bp, 455 aa] {ON} YHR066W ...    33   1.3  
CAGL0J10890g Chr10 complement(1061847..1063241) [1395 bp, 464 aa...    33   1.3  
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    33   1.3  
KNAG0L00230 Chr12 complement(28757..29218) [462 bp, 153 aa] {ON}...    32   1.3  
KNAG0A07020 Chr1 complement(1096188..1097696) [1509 bp, 502 aa] ...    33   1.3  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    33   1.4  
TPHA0I01040 Chr9 complement(238226..239830) [1605 bp, 534 aa] {O...    33   1.4  
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    33   1.4  
Suva_7.183 Chr7 (340138..342027) [1890 bp, 629 aa] {ON} YGL086W ...    33   1.4  
TBLA0B02370 Chr2 (552419..554335) [1917 bp, 638 aa] {ON} Anc_3.1...    33   1.4  
Suva_2.461 Chr2 complement(817421..819445) [2025 bp, 674 aa] {ON...    33   1.4  
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    33   1.4  
NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.1...    33   1.4  
TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.36...    33   1.5  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...    33   1.5  
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    33   1.5  
Kpol_457.13 s457 complement(25969..26907) [939 bp, 312 aa] {ON} ...    33   1.5  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    33   1.5  
ZYRO0C12276g Chr3 (968549..971236) [2688 bp, 895 aa] {ON} simila...    33   1.5  
NCAS0G00530 Chr7 (88814..91513) [2700 bp, 899 aa] {ON} Anc_5.658...    33   1.5  
NDAI0C00600 Chr3 (113989..116799) [2811 bp, 936 aa] {ON} Anc_2.590     33   1.5  
NDAI0A03290 Chr1 complement(745888..746901) [1014 bp, 337 aa] {O...    33   1.5  
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    33   1.6  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    33   1.6  
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    33   1.6  
SAKL0A07546g Chr1 complement(665410..670134) [4725 bp, 1574 aa] ...    33   1.6  
NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {...    33   1.6  
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    33   1.6  
YGR072W Chr7 (634304..635467) [1164 bp, 387 aa] {ON}  UPF3Compon...    33   1.6  
NDAI0J02830 Chr10 (703072..704358) [1287 bp, 428 aa] {ON} Anc_4....    33   1.7  
NCAS0A01200 Chr1 (236349..237635) [1287 bp, 428 aa] {ON} Anc_5.237     33   1.7  
CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa...    33   1.7  
SAKL0B10252g Chr2 complement(879859..881256) [1398 bp, 465 aa] {...    33   1.7  
TPHA0I02600 Chr9 (572400..573818) [1419 bp, 472 aa] {ON} Anc_1.3...    33   1.7  
TBLA0E01850 Chr5 complement(450021..451448) [1428 bp, 475 aa] {O...    33   1.7  
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    33   1.8  
ZYRO0E02596g Chr5 complement(202673..204409) [1737 bp, 578 aa] {...    33   1.8  
CAGL0K02453g Chr11 complement(223090..224844) [1755 bp, 584 aa] ...    33   1.8  
TPHA0N00780 Chr14 (173788..175560) [1773 bp, 590 aa] {ON} Anc_5....    33   1.8  
Smik_15.65 Chr15 (108429..110267) [1839 bp, 612 aa] {ON} YOL091W...    33   1.9  
SAKL0H01826g Chr8 complement(183741..185594) [1854 bp, 617 aa] {...    33   1.9  
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...    33   1.9  
NCAS0I02710 Chr9 complement(502713..503594) [882 bp, 293 aa] {ON...    33   1.9  
KNAG0E04130 Chr5 (818796..820829) [2034 bp, 677 aa] {ON} Anc_7.2...    33   1.9  
YIL144W Chr9 (78074..80149) [2076 bp, 691 aa] {ON}  TID3Componen...    33   1.9  
NCAS0G00850 Chr7 (146144..148294) [2151 bp, 716 aa] {ON} Anc_5.609     33   1.9  
CAGL0F03619g Chr6 complement(352409..354565) [2157 bp, 718 aa] {...    33   1.9  
Skud_11.175 Chr11 complement(316239..318416) [2178 bp, 725 aa] {...    33   1.9  
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...    33   1.9  
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...    33   1.9  
CAGL0L01001g Chr12 complement(115884..118295) [2412 bp, 803 aa] ...    33   2.0  
TPHA0M00680 Chr13 (129702..130646) [945 bp, 314 aa] {ON} Anc_3.1...    33   2.0  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    33   2.0  
SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {O...    33   2.0  
TBLA0I02110 Chr9 (479430..482180) [2751 bp, 916 aa] {ON} Anc_3.3...    33   2.0  
Smik_2.212 Chr2 complement(377076..379970) [2895 bp, 964 aa] {ON...    33   2.0  
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    33   2.0  
YKL063C Chr11 complement(321015..321518) [504 bp, 167 aa] {ON} P...    32   2.0  
KLTH0E14784g Chr5 complement(1313245..1316493) [3249 bp, 1082 aa...    33   2.0  
Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON...    33   2.0  
Kpol_1069.6 s1069 complement(9476..12796) [3321 bp, 1106 aa] {ON...    33   2.0  
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...    33   2.1  
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...    33   2.1  
Suva_13.254 Chr13 complement(397511..401347) [3837 bp, 1278 aa] ...    33   2.1  
NCAS0A10570 Chr1 complement(2105372..2106049) [678 bp, 225 aa] {...    32   2.1  
KLTH0E06710g Chr5 complement(615944..616618,617037..617051) [690...    32   2.1  
TBLA0H02100 Chr8 (504541..511095) [6555 bp, 2184 aa] {ON}              33   2.1  
NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8...    33   2.2  
Smik_12.513 Chr12 complement(904683..905936) [1254 bp, 417 aa] {...    33   2.2  
KLLA0E24685g Chr5 complement(2189395..2189949) [555 bp, 184 aa] ...    32   2.3  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...    33   2.3  
SAKL0D05214g Chr4 (412470..414029) [1560 bp, 519 aa] {ON} simila...    33   2.4  
Kpol_1020.37 s1020 complement(79930..81597) [1668 bp, 555 aa] {O...    33   2.4  
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    33   2.4  
NCAS0J00620 Chr10 complement(93216..95240) [2025 bp, 674 aa] {ON...    33   2.5  
Suva_11.45 Chr11 complement(95306..97351) [2046 bp, 681 aa] {ON}...    33   2.5  
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    33   2.5  
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    33   2.5  
TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.1...    33   2.5  
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    33   2.5  
Smik_45.1 Chr45 complement(3..2270) [2268 bp, 756 aa] {ON}  YNL0...    33   2.5  
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    33   2.5  
TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {O...    33   2.6  
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    33   2.6  
KAFR0K02390 Chr11 complement(493521..496253) [2733 bp, 910 aa] {...    33   2.6  
TPHA0F01350 Chr6 (313270..313902) [633 bp, 210 aa] {ON} Anc_2.23...    32   2.6  
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    33   2.7  
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    33   2.7  
NCAS0A00980 Chr1 complement(193255..196776) [3522 bp, 1173 aa] {...    33   2.7  
CAGL0I07953g Chr9 (774721..778428) [3708 bp, 1235 aa] {ON} simil...    33   2.7  
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    33   2.7  
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....    33   2.7  
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...    33   2.7  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    33   2.7  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    33   2.8  
Kpol_487.5 s487 complement(32198..33313) [1116 bp, 371 aa] {ON} ...    32   2.8  
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...    32   2.8  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    32   2.8  
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...    32   2.9  
Skud_4.575 Chr4 (1029896..1031251) [1356 bp, 451 aa] {ON} YDR312...    32   3.0  
Suva_10.547 Chr10 complement(955153..956517) [1365 bp, 454 aa] {...    32   3.0  
SAKL0H07986g Chr8 complement(687202..688569) [1368 bp, 455 aa] {...    32   3.0  
NDAI0A03470 Chr1 (794669..796042) [1374 bp, 457 aa] {ON} Anc_3.1...    32   3.0  
Suva_11.197 Chr11 (367616..369040) [1425 bp, 474 aa] {ON} YKL028...    32   3.0  
Smik_11.225 Chr11 (372796..374220) [1425 bp, 474 aa] {ON} YKL028...    32   3.0  
NCAS0A00820 Chr1 complement(159145..159696) [552 bp, 183 aa] {ON...    32   3.0  
YKL028W Chr11 (385758..387206) [1449 bp, 482 aa] {ON}  TFA1TFIIE...    32   3.0  
NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {O...    32   3.1  
ZYRO0C04510g Chr3 complement(351889..353454) [1566 bp, 521 aa] {...    32   3.1  
KNAG0B05810 Chr2 (1142161..1143939) [1779 bp, 592 aa] {ON} Anc_4...    32   3.2  
TPHA0M00820 Chr13 (162278..164209) [1932 bp, 643 aa] {ON} Anc_3....    32   3.3  
TBLA0C04250 Chr3 complement(1020759..1022708) [1950 bp, 649 aa] ...    32   3.3  
CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} simila...    32   3.3  
CAGL0M13123g Chr13 complement(1289611..1291605) [1995 bp, 664 aa...    32   3.3  
TBLA0F02460 Chr6 complement(598339..600387) [2049 bp, 682 aa] {O...    32   3.3  
TPHA0E03390 Chr5 (719360..721417) [2058 bp, 685 aa] {ON} Anc_1.1...    32   3.3  
KNAG0F02120 Chr6 complement(403190..405319) [2130 bp, 709 aa] {O...    32   3.3  
Suva_4.425 Chr4 complement(748613..750856) [2244 bp, 747 aa] {ON...    32   3.3  
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    32   3.3  
TPHA0A04870 Chr1 complement(1102393..1103298) [906 bp, 301 aa] {...    32   3.4  
Kpol_483.6 s483 complement(10699..13068) [2370 bp, 789 aa] {ON} ...    32   3.4  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    32   3.4  
Kpol_2002.49 s2002 complement(104741..107146) [2406 bp, 801 aa] ...    32   3.4  
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    32   3.4  
TBLA0D00970 Chr4 (253370..255973) [2604 bp, 867 aa] {ON}               32   3.4  
TPHA0A04320 Chr1 (971586..974327) [2742 bp, 913 aa] {ON} Anc_3.1...    32   3.4  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    32   3.5  
NCAS0I01410 Chr9 (259139..262144) [3006 bp, 1001 aa] {ON} Anc_3....    32   3.5  
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    32   3.5  
Ecym_6303 Chr6 (570968..574195) [3228 bp, 1075 aa] {ON} similar ...    32   3.5  
Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}...    32   3.5  
CAGL0H00264g Chr8 (19281..20294) [1014 bp, 337 aa] {ON} similar ...    32   3.6  
Suva_5.96 Chr5 complement(143615..147583) [3969 bp, 1322 aa] {ON...    32   3.6  
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...    32   3.7  
TPHA0B04590 Chr2 complement(1080849..1081538) [690 bp, 229 aa] {...    32   3.8  
KAFR0B06640 Chr2 (1384687..1386018) [1332 bp, 443 aa] {ON} Anc_6...    32   3.9  
TPHA0J01660 Chr10 complement(382656..384029) [1374 bp, 457 aa] {...    32   4.0  
TBLA0I01440 Chr9 complement(313051..314490) [1440 bp, 479 aa] {O...    32   4.0  
SAKL0B12078g Chr2 (1040952..1042406) [1455 bp, 484 aa] {ON} some...    32   4.0  
TPHA0K02060 Chr11 complement(439779..441347) [1569 bp, 522 aa] {...    32   4.1  
Ecym_2320 Chr2 complement(628050..629636) [1587 bp, 528 aa] {ON}...    32   4.1  
CAGL0I07271g Chr9 complement(701045..702652) [1608 bp, 535 aa] {...    32   4.1  
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    32   4.2  
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    32   4.2  
TBLA0A02600 Chr1 complement(630904..632709) [1806 bp, 601 aa] {O...    32   4.2  
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...    32   4.2  
YFL049W Chr6 (36803..38674) [1872 bp, 623 aa] {ON}  SWP82Member ...    32   4.3  
TBLA0D02670 Chr4 (660404..662320) [1917 bp, 638 aa] {ON} Anc_8.7...    32   4.3  
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    32   4.3  
NDAI0C00980 Chr3 (191931..193919) [1989 bp, 662 aa] {ON} Anc_5.5...    32   4.3  
TPHA0J02260 Chr10 (502547..504697) [2151 bp, 716 aa] {ON} Anc_6....    32   4.4  
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    32   4.4  
CAGL0L04466g Chr12 (519292..521643) [2352 bp, 783 aa] {ON} simil...    32   4.4  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    32   4.4  
Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON} Y...    32   4.4  
TBLA0B04760 Chr2 complement(1118043..1120508) [2466 bp, 821 aa] ...    32   4.5  
TDEL0G02520 Chr7 complement(484488..485344,485401..485464) [921 ...    32   4.5  
Suva_8.107 Chr8 complement(197136..199787) [2652 bp, 883 aa] {ON...    32   4.5  
CAGL0H02255g Chr8 complement(202569..205325) [2757 bp, 918 aa] {...    32   4.5  
NCAS0D03610 Chr4 (671837..674632) [2796 bp, 931 aa] {ON} Anc_6.1...    32   4.5  
Smik_6.453 Chr6 (744924..747725) [2802 bp, 933 aa] {ON} YPL249C ...    32   4.5  
TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5...    32   4.5  
Smik_1.29 Chr1 (59406..62372) [2967 bp, 988 aa] {ON} YAL035W (REAL)    32   4.6  
SAKL0A05368g Chr1 complement(484027..487008) [2982 bp, 993 aa] {...    32   4.6  
TBLA0B04730 Chr2 complement(1106452..1109436) [2985 bp, 994 aa] ...    32   4.6  
Kpol_1036.98 s1036 (258065..258685) [621 bp, 206 aa] {ON} (25806...    31   4.6  
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    32   4.6  
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...    32   4.6  
Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa] ...    32   4.7  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    32   4.7  
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    32   4.7  
KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakl...    32   4.7  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    32   4.7  
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    32   4.7  
ZYRO0C08448g Chr3 (644092..645111) [1020 bp, 339 aa] {ON} some s...    32   4.7  
KAFR0L00920 Chr12 (169976..170623) [648 bp, 215 aa] {ON} Anc_7.2...    31   4.8  
NCAS0F02440 Chr6 (483373..484419) [1047 bp, 348 aa] {ON} Anc_5.2...    32   4.8  
Smik_15.376 Chr15 (648566..653428) [4863 bp, 1620 aa] {ON} YOR19...    32   4.8  
KLTH0D17424g Chr4 (1444277..1449196) [4920 bp, 1639 aa] {ON} sim...    32   4.8  
TDEL0B06740 Chr2 (1193562..1194668) [1107 bp, 368 aa] {ON} Anc_2...    32   4.9  
Kpol_2002.87 s2002 (203582..204697) [1116 bp, 371 aa] {ON} (2035...    32   4.9  
TPHA0D00510 Chr4 (91198..91872) [675 bp, 224 aa] {ON} Anc_8.54 Y...    31   4.9  
YPR133C Chr16 complement(795978..797210) [1233 bp, 410 aa] {ON} ...    32   5.1  
Kwal_23.5662 s23 complement(1259373..1260641) [1269 bp, 422 aa] ...    32   5.1  
TPHA0G02270 Chr7 (461474..462208) [735 bp, 244 aa] {ON} Anc_2.42...    31   5.2  
SAKL0H04444g Chr8 (415574..417019) [1446 bp, 481 aa] {ON} conser...    32   5.3  
CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] ...    32   5.4  
TPHA0C03120 Chr3 complement(689473..691068) [1596 bp, 531 aa] {O...    32   5.4  
YDL207W Chr4 (88248..89864) [1617 bp, 538 aa] {ON}  GLE1Cytoplas...    32   5.4  
TPHA0O00620 Chr15 (114205..115830) [1626 bp, 541 aa] {ON} Anc_1....    32   5.4  
CAGL0F08151g Chr6 complement(806209..808005) [1797 bp, 598 aa] {...    32   5.6  
Ecym_2610 Chr2 complement(1180463..1182289) [1827 bp, 608 aa] {O...    32   5.6  
SAKL0H04488g Chr8 (418323..420158) [1836 bp, 611 aa] {ON} simila...    32   5.6  
KAFR0B00360 Chr2 (81284..83215) [1932 bp, 643 aa] {ON} Anc_7.535...    32   5.6  
Kpol_1064.15 s1064 (28183..30123) [1941 bp, 646 aa] {ON} (28183....    32   5.7  
TPHA0M01780 Chr13 (368492..371146) [2655 bp, 884 aa] {ON} Anc_3....    32   5.9  
Skud_12.40 Chr12 (79588..82314) [2727 bp, 908 aa] {ON} YLL026W (...    32   6.0  
NDAI0C04350 Chr3 complement(988524..989477) [954 bp, 317 aa] {ON}      31   6.1  
Suva_4.171 Chr4 complement(306580..309732) [3153 bp, 1050 aa] {O...    32   6.1  
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    32   6.1  
KLTH0G04994g Chr7 (406086..407054) [969 bp, 322 aa] {ON} highly ...    31   6.1  
Kwal_27.9739 s27 complement(42447..46043) [3597 bp, 1198 aa] {ON...    32   6.1  
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    32   6.1  
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    32   6.1  
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    32   6.2  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    32   6.3  
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...    32   6.3  
KAFR0E00850 Chr5 complement(178580..184180) [5601 bp, 1866 aa] {...    32   6.3  
KLLA0B08261g Chr2 (735279..736346) [1068 bp, 355 aa] {ON} some s...    31   6.3  
SAKL0G13134g Chr7 (1127910..1133723) [5814 bp, 1937 aa] {ON} sim...    32   6.3  
TBLA0B03460 Chr2 complement(801699..808766) [7068 bp, 2355 aa] {...    32   6.4  
TDEL0D04400 Chr4 (802411..803079) [669 bp, 222 aa] {ON} Anc_3.18...    31   6.5  
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    32   6.5  
Suva_33.1 Chr33 complement(1..1188) [1188 bp, 395 aa] {ON} YHR06...    31   6.6  
KAFR0B03060 Chr2 (637546..638052) [507 bp, 168 aa] {ON} Anc_8.31...    30   6.6  
Kpol_1071.4 s1071 (9071..9763) [693 bp, 230 aa] {ON} (9071..9763...    31   6.7  
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...    31   6.7  
Suva_16.51 Chr16 (76488..77744) [1257 bp, 418 aa] {ON} YPL255W (...    31   6.7  
Suva_15.255 Chr15 (431022..432386) [1365 bp, 454 aa] {ON} YHR066...    31   6.9  
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    31   6.9  
NCAS0A04820 Chr1 (964818..966233) [1416 bp, 471 aa] {ON} Anc_2.5...    31   6.9  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    31   7.0  
Kpol_463.15 s463 complement(40654..42216) [1563 bp, 520 aa] {ON}...    31   7.1  
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    31   7.1  
CAGL0J07348g Chr10 (711496..713091) [1596 bp, 531 aa] {ON} weakl...    31   7.2  
NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125     31   7.2  
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    31   7.2  
TBLA0D04700 Chr4 complement(1164422..1166146) [1725 bp, 574 aa] ...    31   7.3  
Ecym_8362 Chr8 complement(727291..729057) [1767 bp, 588 aa] {ON}...    31   7.3  
TBLA0I03410 Chr9 complement(821181..822974) [1794 bp, 597 aa] {O...    31   7.3  
Smik_6.447 Chr6 complement(733938..735737) [1800 bp, 599 aa] {ON...    31   7.3  
TBLA0A10220 Chr1 (2522297..2524141) [1845 bp, 614 aa] {ON} Anc_5...    31   7.4  
Suva_6.4 Chr6 (10294..12162) [1869 bp, 622 aa] {ON} YFL049W (REAL)     31   7.4  
Smik_6.27 Chr6 (52259..54130) [1872 bp, 623 aa] {ON} YFL049W (REAL)    31   7.4  
KNAG0I01430 Chr9 complement(275687..276247) [561 bp, 186 aa] {ON...    30   7.4  
SAKL0E02618g Chr5 complement(210003..210824) [822 bp, 273 aa] {O...    31   7.4  
TBLA0I02640 Chr9 complement(617916..619922) [2007 bp, 668 aa] {O...    31   7.5  
TPHA0L00910 Chr12 (184324..186357) [2034 bp, 677 aa] {ON} Anc_8....    31   7.5  
Suva_4.175 Chr4 complement(313538..315640) [2103 bp, 700 aa] {ON...    31   7.5  
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    31   7.6  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    31   7.6  
TDEL0G02860 Chr7 (551435..552292) [858 bp, 285 aa] {ON} Anc_2.35...    31   7.6  
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...    31   7.7  
NDAI0F02430 Chr6 complement(581121..581990) [870 bp, 289 aa] {ON...    31   7.7  
YOL076W Chr15 (187024..189414) [2391 bp, 796 aa] {ON}  MDM20Non-...    31   7.7  
KAFR0F00920 Chr6 (172413..173294) [882 bp, 293 aa] {ON} Anc_6.29...    31   7.7  
TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {O...    31   7.8  
TBLA0C07080 Chr3 complement(1715053..1715958) [906 bp, 301 aa] {...    31   7.8  
KNAG0D01940 Chr4 complement(327718..328623) [906 bp, 301 aa] {ON...    31   7.8  
Skud_2.203 Chr2 complement(363149..366031) [2883 bp, 960 aa] {ON...    31   7.9  
YBR079C Chr2 complement(395383..398277) [2895 bp, 964 aa] {ON}  ...    31   7.9  
Suva_4.319 Chr4 complement(562745..565642) [2898 bp, 965 aa] {ON...    31   7.9  
KAFR0C00260 Chr3 complement(43810..46725) [2916 bp, 971 aa] {ON}...    31   7.9  
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    31   7.9  
NDAI0I01280 Chr9 complement(307589..310537) [2949 bp, 982 aa] {O...    31   7.9  
TDEL0H04010 Chr8 complement(685947..688913) [2967 bp, 988 aa] {O...    31   7.9  
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    31   7.9  
NCAS0C04050 Chr3 (825334..828396) [3063 bp, 1020 aa] {ON} Anc_8....    31   7.9  
Kwal_23.2990 s23 (102421..105822) [3402 bp, 1134 aa] {OFF} YNL09...    31   8.0  
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...    31   8.0  
Kwal_YGOB_23.2990 s23 (102421..105852) [3432 bp, 1144 aa] {ON} A...    31   8.0  
Smik_11.23 Chr11 complement(48332..51784) [3453 bp, 1150 aa] {ON...    31   8.0  
NDAI0B04030 Chr2 complement(1020592..1024095) [3504 bp, 1167 aa]...    31   8.0  
ACL086C Chr3 complement(192736..196359) [3624 bp, 1207 aa] {ON} ...    31   8.1  
Kpol_2001.40 s2001 (112171..115830) [3660 bp, 1219 aa] {ON} (112...    31   8.1  
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    31   8.1  
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....    31   8.1  
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    31   8.1  
TBLA0B08300 Chr2 complement(1980872..1985068) [4197 bp, 1398 aa]...    31   8.2  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...    31   8.2  
TBLA0C06950 Chr3 (1679512..1680522) [1011 bp, 336 aa] {ON} Anc_5...    31   8.2  
Kpol_1055.13 s1055 (30639..35297) [4659 bp, 1552 aa] {ON} (30639...    31   8.2  
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    31   8.2  
Kpol_1043.54 s1043 complement(104804..109981) [5178 bp, 1725 aa]...    31   8.3  
YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 a...    31   8.3  
Kwal_47.18293 s47 (768811..769860) [1050 bp, 349 aa] {ON} [conti...    31   8.3  
NCAS0A02730 Chr1 (522320..523381) [1062 bp, 353 aa] {ON} Anc_4.2...    31   8.4  
KNAG0H02890 Chr8 (537406..538530) [1125 bp, 374 aa] {ON} Anc_8.2...    31   8.5  
TDEL0A07050 Chr1 complement(1233300..1234427) [1128 bp, 375 aa] ...    31   8.6  
SAKL0B09592g Chr2 complement(812099..813265) [1167 bp, 388 aa] {...    31   8.7  
TPHA0I00760 Chr9 complement(159553..160773) [1221 bp, 406 aa] {O...    31   8.8  
Suva_4.378 Chr4 complement(664404..665681) [1278 bp, 425 aa] {ON...    31   8.9  
YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}  ...    31   8.9  
Skud_2.258 Chr2 complement(463205..464494) [1290 bp, 429 aa] {ON...    31   8.9  
Ecym_1260 Chr1 (534364..535662) [1299 bp, 432 aa] {ON} similar t...    31   8.9  
YCL029C Chr3 complement(68599..69921) [1323 bp, 440 aa] {ON}  BI...    31   9.0  
NDAI0F04070 Chr6 (979575..980912) [1338 bp, 445 aa] {ON} Anc_1.1...    31   9.0  
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    31   9.3  
ZYRO0B01078g Chr2 complement(91817..92560) [744 bp, 247 aa] {ON}...    30   9.3  
TBLA0H02520 Chr8 (596063..597574) [1512 bp, 503 aa] {ON}               31   9.3  
TBLA0E04130 Chr5 (1040400..1041149) [750 bp, 249 aa] {ON} Anc_8....    30   9.4  
KLTH0D08052g Chr4 (683787..684128) [342 bp, 113 aa] {ON} conserv...    29   9.4  
ZYRO0F05302g Chr6 complement(441286..442851) [1566 bp, 521 aa] {...    31   9.4  
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...    31   9.4  
NDAI0F03790 Chr6 (900580..902166) [1587 bp, 528 aa] {ON}               31   9.4  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...    31   9.4  
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    31   9.5  
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    31   9.5  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...    31   9.5  
TPHA0O00980 Chr15 (181280..182977) [1698 bp, 565 aa] {ON} Anc_1....    31   9.6  
TDEL0C01000 Chr3 (167919..169619) [1701 bp, 566 aa] {ON} Anc_8.7...    31   9.6  
KAFR0A06570 Chr1 (1331473..1333203) [1731 bp, 576 aa] {ON} Anc_4...    31   9.6  
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...    30   9.6  
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    31   9.6  
KNAG0C03880 Chr3 complement(760102..761865) [1764 bp, 587 aa] {O...    31   9.6  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...    31   9.7  
Skud_4.482 Chr4 (861765..863888) [2124 bp, 707 aa] {ON} YDR221W ...    31   10.0 
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    31   10.0 
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    31   10.0 
KLLA0F14751g Chr6 complement(1364995..1365837) [843 bp, 280 aa] ...    30   10.0 

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
            YOR177C (REAL)
          Length = 465

 Score =  877 bits (2267), Expect = 0.0
 Identities = 440/465 (94%), Positives = 440/465 (94%)
 Frame = +1

Query: 1    MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 180
            MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1    MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 181  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 360
            KNSSIRRG                         DCGFDYERRFETRDDTFKEVNDAVNRC
Sbjct: 61   KNSSIRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVNDAVNRC 120

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 540
            YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD
Sbjct: 121  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
            LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL
Sbjct: 181  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
            LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN
Sbjct: 241  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
            TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE
Sbjct: 301  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
            RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD
Sbjct: 361  RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420

Query: 1261 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
            NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN
Sbjct: 421  NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
            MPC54Component of the meiotic outer plaque, a
            membrane-organizing center which is assembled on the
            cytoplasmic face of the spindle pole body during meiosis
            II and triggers the formation of the prospore membrane;
            potential Cdc28p substrate
          Length = 464

 Score =  708 bits (1827), Expect = 0.0
 Identities = 349/465 (75%), Positives = 395/465 (84%)
 Frame = +1

Query: 1    MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 180
            MPED SY+  FE++ NN SH ISP+KDS++K+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1    MPEDTSYSNSFEDYYNN-SHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59

Query: 181  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 360
            KN++++R                             FD E + E++++T KEVNDAVNRC
Sbjct: 60   KNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 540
            YALCNIPTKH+SI+SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 120  YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
            LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETE LKSFI+EIEEV+DNKISINSL+QQL
Sbjct: 180  LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
            LEEKTANNILRRDYYKLQERG+RLCHEFQ+LQDDYSK+MKQKEYEVQKLKNE+K L NMN
Sbjct: 240  LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
             NLKA+K  +SQKEKQY QKY YIEKYM+HVK+EYN+KEDEC +L F++DK+MKKI+HLE
Sbjct: 300  DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
            RSLQ Q  AQNSFS   +Q+E  KDAHL+DRYHKVKEFMEQKLQTSK NDPSCSEAEALD
Sbjct: 360  RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419

Query: 1261 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
            NVL LIE++MKTL+ NSK Y   TKKC+KYVT S RLKENEH+TN
Sbjct: 420  NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464

>Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {ON}
            YOR177C (REAL)
          Length = 465

 Score =  702 bits (1813), Expect = 0.0
 Identities = 348/465 (74%), Positives = 394/465 (84%)
 Frame = +1

Query: 1    MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 180
            MP+DI+Y+  FEEF+N+N+  +SP+KD +FK+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1    MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 181  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 360
            KNSSI+R                             F+Y  + ETR++TFK+VNDAVNRC
Sbjct: 61   KNSSIKRTFQTSTSTTTTPNKSSLKSPKSKKTSKDIFNYGNKSETREETFKDVNDAVNRC 120

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 540
            YALCNIPTKHISI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121  YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
            LNEKSLQMAIDHLLKVTKQN RQ D  +KL++TEVLKSFI+EIEEV+DNKISINSLEQQL
Sbjct: 181  LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
             EEKTANNILRRDYYKLQERG+RLCH+FQDLQDDYSK+MKQKEYEVQKLKNE+K L  MN
Sbjct: 241  FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
             NLKAD+T  SQKEKQY QK  YIEKYM+HVK+EYN+KE+ECN+LK+++DK+MK+I+HLE
Sbjct: 301  DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
            RSLQ+Q+  QNSFS  T+ +E  KD  LEDRYHKVKEFMEQKLQTSK +D SCSE EALD
Sbjct: 361  RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420

Query: 1261 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
            NVLGLIENTMK L+ N+KY  TT KKC+KYVTGSSR  ENEHITN
Sbjct: 421  NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
            YOR177C (REAL)
          Length = 465

 Score =  700 bits (1806), Expect = 0.0
 Identities = 346/465 (74%), Positives = 392/465 (84%)
 Frame = +1

Query: 1    MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 180
            MPED  Y+  + E +N+N + +SP+KDS+FK++TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1    MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 181  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 360
            K+S I++                            GFDY  + E+ D+TFK+VNDAVNRC
Sbjct: 61   KSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 540
            YALCNIPTKH+SI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121  YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
            LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETEVLKSF +EIEEV+DNKISIN+LEQQL
Sbjct: 181  LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
            LEEK ANNILRRDYYKLQERG+RLCHEFQDLQ+DY++++K KEYE+QKLKNE+K L NMN
Sbjct: 241  LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
             NLKADKTQFSQ EKQY QKY YIEKYM+HVK+EYNKKEDEC++LKF++D N+KKIDHLE
Sbjct: 301  NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
            R+LQ+Q   QNSFS   +Q+ED  DAHLEDRY KVKEFMEQKLQTSK +DP  SE EALD
Sbjct: 361  RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420

Query: 1261 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
            NVLGLIENTMKTL+ NSKY  TTTKKC+KYV GSSRLKENEHITN
Sbjct: 421  NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
            complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 68.6 bits (166), Expect = 1e-11
 Identities = 86/403 (21%), Positives = 161/403 (39%), Gaps = 37/403 (9%)
 Frame = +1

Query: 112  PNVRFGDDDVNIFDQRKKVNE------INKNSSIRRGXXXXXXXXXXXXXXXXXXXXXXX 273
            P +RF  + + IFDQ K+V++      + K+SS ++                        
Sbjct: 72   PKIRFDCNRILIFDQDKEVSKSGIQKILTKSSSSQKSILKKRED---------------- 115

Query: 274  XXDCGFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGIT 453
                  D E +   +DD   E+   V R + LC +  KHI   S     +  E L+V IT
Sbjct: 116  ------DIEDKLYPQDD---EITQIVKRMFTLCGVNLKHIEGISFK---EQLERLSVSIT 163

Query: 454  HETNRKAECER-SKNAIDS------------------LYYHEQLEKKDLNEKSLQMAIDH 576
            +  N K  C +  K  ++S                  L+    +  K+L +  +QMA   
Sbjct: 164  NAFNTKEMCSKYIKQKLESQLNDKILEQQETVKYWKNLFDESTVRLKELEKSQIQMASGK 223

Query: 577  LLKVTKQNQRQVDGRDKLE-ETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILR 753
            L +  ++ Q+  +    L+ E    K  +KE       K ++     +L+E    N+  R
Sbjct: 224  LKETVQEQQKLAELNSSLKNELAETKLVLKEA------KCNLEFTRAKLIEFDNNNSAYR 277

Query: 754  RDYYK-----------LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
             D  K           ++E+ +++  E  D ++ + K  K+     + L+ +V  L   N
Sbjct: 278  TDLQKNKKTLKAMEDRIKEKEEKI-RELGDSEEKFKKCNKKLSANCEILEQKVSALNVQN 336

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
              L      F+Q   +  ++    E    ++K E++K + E   LK  + K  KKI   E
Sbjct: 337  ILLSEMNETFTQTNSETLKRLQVTEFESENIKNEFDKTKSELTSLKKKLSKANKKIVSKE 396

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
              L+      N  +   + + +Q+   L+ +Y ++ + +E+K+
Sbjct: 397  VDLK-NLRQDNELTQDKLIEVNQELGVLKMKYCQLSKDIEEKI 438

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
            Anc_4.46 YLR309C
          Length = 960

 Score = 65.5 bits (158), Expect = 2e-10
 Identities = 83/367 (22%), Positives = 160/367 (43%), Gaps = 17/367 (4%)
 Frame = +1

Query: 298  ERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAE 477
            E +   +  T +E+ + +N+  +   +PTK ++ + I+ L  T  +       + NRK  
Sbjct: 282  EEQLVEKAKTIQELQEQLNKSTSAIELPTKTVTETEITTLKTTPMSKN---QKKRNRKKN 338

Query: 478  CERSKNAIDSLYYHEQLEKK--------DLNEKSLQMAIDHLLKVTKQNQRQ----VDGR 621
             +++     +    EQ EK         + +   L    + LLK  +  Q +     D  
Sbjct: 339  KKQNNAPTVATKEEEQAEKNPQPSTEEDNADTSGLLERYNTLLKDFEAFQSEHKDCKDWE 398

Query: 622  DKLEET----EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKR 789
            +K  ET    E LK   +++ E+E+ K   N+L  +L + K A      +  + +E  + 
Sbjct: 399  EKYNETKSHLEELKDVSEKLAELEEEK---NNLGAELSKTKEALTAKNTEVEEQREMMRE 455

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD-KTQFSQKEKQYSQKYI 966
            + ++    +D   +    K  E+ +   +V+ L N N  + ++ KT+ S+ EK  +    
Sbjct: 456  IGNDLVAAKDQIKESSLGKNEEIARWTAQVENLKNENEKIISENKTKQSELEKNTAALTD 515

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED 1146
             IEK  +       + +D   R+    ++ + KI +    L  Q    NS     +Q E 
Sbjct: 516  EIEKLKTKYMDASKRLKDNEARM----NEALSKIQNENNRLSNQMRDYNSVKTNVLQKE- 570

Query: 1147 QKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYST 1326
            +  ++LE++   +K + E+K++T K+ D    E   L N L L++   +TL  N K  S 
Sbjct: 571  KTISYLENQ---IKGYTEEKIKTEKSIDMLKRENGILTNRLDLLKKENQTLHDNVKKNSN 627

Query: 1327 TTKKCLK 1347
            + +  LK
Sbjct: 628  SYENYLK 634

 Score = 37.7 bits (86), Expect = 0.074
 Identities = 68/322 (21%), Positives = 127/322 (39%), Gaps = 19/322 (5%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK---LEETEV 645
            E +  +N ++ +      E+  L E   +       ++ + N+R  D   K   LEE  V
Sbjct: 227  EKDDKQNKLEKVEKQYDEEQAQLLESQAREVTTLKTQLDESNKRLGDITSKMKPLEEQLV 286

Query: 646  LKS-FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
             K+  I+E++E  +   S   L  + + E     +      K Q++  R           
Sbjct: 287  EKAKTIQELQEQLNKSTSAIELPTKTVTETEITTLKTTPMSKNQKKRNR----------- 335

Query: 823  YSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK-- 996
              K  KQ        K E +   N   + + D    S   ++Y+      E + S  K  
Sbjct: 336  -KKNKKQNNAPTVATKEEEQAEKNPQPSTEEDNADTSGLLERYNTLLKDFEAFQSEHKDC 394

Query: 997  ----QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQ-TNAQNSFSAVTVQDEDQKDAH 1161
                ++YN+ +     LK V +K + +++  + +L A+ +  + + +A   + E+Q++  
Sbjct: 395  KDWEEKYNETKSHLEELKDVSEK-LAELEEEKNNLGAELSKTKEALTAKNTEVEEQREMM 453

Query: 1162 LE---DRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKT----LEGNSKYY 1320
             E   D      +  E  L  ++      ++ E L N    I +  KT    LE N+   
Sbjct: 454  REIGNDLVAAKDQIKESSLGKNEEIARWTAQVENLKNENEKIISENKTKQSELEKNTAAL 513

Query: 1321 STTTKKC-LKYVTGSSRLKENE 1383
            +   +K   KY+  S RLK+NE
Sbjct: 514  TDEIEKLKTKYMDASKRLKDNE 535

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
            YNL250W
          Length = 1306

 Score = 64.7 bits (156), Expect = 3e-10
 Identities = 81/370 (21%), Positives = 165/370 (44%), Gaps = 24/370 (6%)
 Frame = +1

Query: 337  VNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHE-TNRKAECERSKNAIDSLY 513
            VN+     + L  +    IS+ +I +  +  E L   +  E T+ KA  E  +N+   L 
Sbjct: 716  VNEEKEFLHNLRTMEKDIISLRNIKEQVKKLEELKPCLVEEHTSTKASLEEIENSNRKLK 775

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI 693
                 EK+++ EK+L+  I+ ++  +K+          L E E  K   K++E   ++  
Sbjct: 776  -----EKREVCEKTLRRTIEQIVDNSKELN--------LLEAE-FKGLSKQLEMYNNSSG 821

Query: 694  SINSLEQQLLEEKTANNILRR---DYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK 864
            ++ ++++   E+K  N++LR+   D   LQE  +R   E   L +     +K+K   +++
Sbjct: 822  TLQTVDELRAEQKQKNDLLRKLRKDINDLQEERERKTKEHNSLIN----MVKEKTLSIRE 877

Query: 865  LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR---- 1032
            +++ V    N+     A KT+ +  E         IEK     K E  KK+ + NR    
Sbjct: 878  MESSVASEKNIQREYSAKKTELNDIEHHIQSIKSEIEK----TKGEKEKKQSQYNRQKLG 933

Query: 1033 LKFVVDKNMKKIDHLERSL--------QAQTNAQNSFSAV-----TVQDEDQKDAHLEDR 1173
            LK + +K+   I ++ ++         + +   Q  F+A+     T++  D    ++E +
Sbjct: 934  LKLLTEKSQTDIINITKACDKLGGILDKVRQYEQQDFNALEKCQDTIKQADSTLKNIEKQ 993

Query: 1174 YHKVKEFM---EQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCL 1344
             ++  E++    QKLQ S N   +  +   L N+   +++ +  ++      + T ++  
Sbjct: 994  LNEKTEYLYMGRQKLQDSNNEKRNLRDNIELLNLKDKLQSIIDNIKRLDVRNAETERE-- 1051

Query: 1345 KYVTGSSRLK 1374
            KY   S +L+
Sbjct: 1052 KYQQESEKLR 1061

 Score = 35.0 bits (79), Expect = 0.53
 Identities = 66/304 (21%), Positives = 129/304 (42%), Gaps = 38/304 (12%)
 Frame = +1

Query: 496  AIDSLYYHEQLEKKDL--NEKSLQMAIDHLL------KVTKQNQRQVDGRDKLEETEV-- 645
            AID+L    ++ KKD+    K LQ +++HL       K TK   +Q++ + +    +V  
Sbjct: 187  AIDNL----KVIKKDMAVEIKLLQQSVEHLKIDRDRSKTTKIKIQQLEAKIEQFRQQVKN 242

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEE----KTANNILRRDYYKLQERGKRLC---HEF 804
            ++S I +I    D     N   Q++L +    KT       +  +L    + L     E 
Sbjct: 243  IESQILDITGQSDRLFKSNQTFQEVLSKVENLKTLKLATSNEIERLSATIELLDLPKDEL 302

Query: 805  QDLQDDYS-------KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQ-- 957
              L D++S        K+ Q +YE+ +LKN+++       +L   + + + K   Y Q  
Sbjct: 303  SSLLDNFSLTLQQQESKLDQTQYEINQLKNQLQNAYIEKDDLIRKEAELTSKRHDYEQLK 362

Query: 958  --KYIYIEKYMSHVKQEYNKK-EDECNRL------KFVVDKNMKKIDHLERSLQAQTNAQ 1110
              +   IE++      + +     EC RL          D  M K +   +  + + +  
Sbjct: 363  HDRLTLIEEFKQKFPLDLSSDYPTECLRLLRDYKKTLESDAQMVKAEGESKLAKIENHVA 422

Query: 1111 NSFSAVTVQDEDQKDAHLEDRYHKVK--EFMEQKLQTSKNNDPSC-SEAEALDNVLGLIE 1281
                  TVQ++ + +  + D+    K  +++E +L++S  ++ +   E +AL  + G + 
Sbjct: 423  EQVYEETVQNQ-KLEYCIRDKTDLKKRIDWLETELKSSDVSEETLEDEKKALTELNGQLA 481

Query: 1282 NTMK 1293
            N  K
Sbjct: 482  NFEK 485

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 63.5 bits (153), Expect = 8e-10
 Identities = 78/371 (21%), Positives = 153/371 (41%), Gaps = 5/371 (1%)
 Frame = +1

Query: 292  DYER-RFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNR 468
            D ER R +T  +++KE  +  N      N    +I    I        TL   IT     
Sbjct: 1034 DTERERLQTLTESYKEKLNEANSSIDEKNKDLNNIQ-QQIEGSQSEISTLKAEITQLKTS 1092

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
              E + ++ A++ L        K+ NE  +Q A D LL++ K             E ++L
Sbjct: 1093 LNEEKSTRKALEKL--------KEENETYIQSAQDELLQLQK-------------EVDLL 1131

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            KS   E ++  DN  S+     +L++E    N+  +   +L +    L  + + L+ D  
Sbjct: 1132 KS---ENKDALDNNSSLKQKYDELVKELELKNLESK---QLSDNSLNLNSKIEQLEGDIK 1185

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
             K    +   +KL   ++       N+   + + + KE+QY+++   +E+    ++  + 
Sbjct: 1186 SKYNTIKELEEKLSTSLQEREENIANIADIELKLNSKEEQYTEQTNKLEE----LRISFE 1241

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVK 1188
            KK+ EC  L+  +  +   +    R  +      +S      + E    + LED+  + K
Sbjct: 1242 KKQSECKELESKLKSSNDDLQEKNRLTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEK 1301

Query: 1189 EFMEQKLQTSKNNDPSCSEAE----ALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVT 1356
            ++ E+  Q  K N+    + +     L++    I+   + L+  +   ++T KK LK   
Sbjct: 1302 KYKEEIDQLGKENEDITKQNKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEE 1361

Query: 1357 GSSRLKENEHI 1389
                L++ +HI
Sbjct: 1362 KIKDLEDTQHI 1372

 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 92/383 (24%), Positives = 168/383 (43%), Gaps = 24/383 (6%)
 Frame = +1

Query: 292  DYERRFETRD----DTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHE 459
            DY ++ + ++    +  KE+  A N   AL N   K   I +  DL  T  T+       
Sbjct: 1507 DYNQKIKEQETKATEKEKEIQVAKN---ALKNAEKKKKDIEN--DLRTTIATVE---KEN 1558

Query: 460  TNRKAECERSKNAIDS------LYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            T  K E +    +ID       L   E  ++K+L +K      D + K+ K+N + +D  
Sbjct: 1559 TTLKRENQLKSESIDKHQNNIHLLQEELSKQKELADKKH----DEIRKLEKENSKMIDRI 1614

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ---ERGKRL 792
            DKLE+ +   +  ++I  +E    S+ S E++ L EK  N   + +   L+   E+   L
Sbjct: 1615 DKLEKQKADTN--EKIANIEKENSSLIS-ERKTLVEKVEN--FQDEITNLKSSLEKNDSL 1669

Query: 793  CHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYI 972
                 +L+D ++      E E +  +N    LT +N  L+++  Q S K  ++ +K   +
Sbjct: 1670 SSSHDELKDKFN------ELETELKRN----LTELN-KLESENKQLSDKVIEHEEKVSMV 1718

Query: 973  EKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF-SAVTVQDED- 1146
            EK +S  ++   ++ED  N+LK   D N    + L +++      +  +  ++T +D D 
Sbjct: 1719 EKELSTAQKTLKEREDVINKLK---DSN----NELNKTIDKHGATEKHYEESITKKDSDI 1771

Query: 1147 -QKDAHLEDRYHKVKEFMEQKLQTS--------KNNDPSCSEAEALDNVLGLIENTMKTL 1299
             Q    ++D   K+   +E+K + +           D   SE+E L   L    +   +L
Sbjct: 1772 AQLKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTDLKNSESE-LKQELEHYRSKYSSL 1830

Query: 1300 EGNSKYYSTTTKKCLKYVTGSSR 1368
            E   K    +T++  K+V   SR
Sbjct: 1831 ESKLK----STEEAKKHVEEESR 1849

 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 75/281 (26%), Positives = 127/281 (45%), Gaps = 35/281 (12%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK----VTKQNQR----------QVDG 618
            E+++ ++ SL     LE K   EK  +  ID L K    +TKQN+           ++D 
Sbjct: 1283 EKTEGSLQSL-----LEDKKQEEKKYKEEIDQLGKENEDITKQNKELNLRLEDYSAKIDA 1337

Query: 619  RD---KLEETEVL---KSFIK---EIEEVEDN----KISINSLEQQLLEEKTANNILRRD 759
            +D   KL    V    K  +K   +I+++ED     K S NSL+ +L +     N LR D
Sbjct: 1338 KDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSLKSELEKTALEMNELRSD 1397

Query: 760  YYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
               + +    L      L ++  +  ++   EV KLK+E+K  T  +T  K  K      
Sbjct: 1398 NDNIIKLKNELQRTNDKLIEENKRTEEKLRSEVAKLKDELK--TKSDTFEKERKLMNEDS 1455

Query: 940  E---KQYSQKYIYIEKYMSHVKQEYNKK----EDECNRLKF-VVDKNMKKIDHLERSLQA 1095
                K+YS+K   +E+ +  +K EY+K+    ED+   L+  + DK  + ID+ ++  + 
Sbjct: 1456 STIIKEYSEKISSLEEKVETIKSEYDKEINILEDKKEVLESELSDKKQEIIDYNQKIKEQ 1515

Query: 1096 QTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS 1218
            +T A      + V     K+A       K K+ +E  L+T+
Sbjct: 1516 ETKATEKEKEIQVAKNALKNA------EKKKKDIENDLRTT 1550

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 57/233 (24%), Positives = 104/233 (44%), Gaps = 9/233 (3%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKV-TKQNQRQVDGRDKL----EETEVLKSFIKEIEE--- 675
            ++LE K+L  K L    D+ L + +K  Q + D + K     E  E L + ++E EE   
Sbjct: 1154 KELELKNLESKQLS---DNSLNLNSKIEQLEGDIKSKYNTIKELEEKLSTSLQEREENIA 1210

Query: 676  -VEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEY 852
             + D ++ +NS E+Q  E+      LR  + K Q   K L  + +   DD  +K +  + 
Sbjct: 1211 NIADIELKLNSKEEQYTEQTNKLEELRISFEKKQSECKELESKLKSSNDDLQEKNRLTKE 1270

Query: 853  EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR 1032
              + L + +K       +L++      Q+EK+Y ++   + K    + ++ NK+      
Sbjct: 1271 LQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENEDITKQ-NKE------ 1323

Query: 1033 LKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
            L   ++    KID  +  L+   +A  S     ++ E +K   LED  H  K+
Sbjct: 1324 LNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLE-EKIKDLEDTQHIFKD 1375

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 61/313 (19%), Positives = 133/313 (42%), Gaps = 27/313 (8%)
 Frame = +1

Query: 460  TNRKAECERSKNAIDSLYYHEQLEKK-DLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE 636
            TN K+  E++ +   S   H++L+ K +  E  L+  +  L K+  +N++     DK+ E
Sbjct: 1657 TNLKSSLEKNDSLSSS---HDELKDKFNELETELKRNLTELNKLESENKQL---SDKVIE 1710

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ 816
             E   S +++  E+   + ++   E  + + K +NN L +    + + G    H      
Sbjct: 1711 HEEKVSMVEK--ELSTAQKTLKEREDVINKLKDSNNELNKT---IDKHGATEKH------ 1759

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTN--------------MNTNLKADKTQFSQKEKQ-- 948
              Y + + +K+ ++ +LK ++K + +              + T L+ DKT     E +  
Sbjct: 1760 --YEESITKKDSDIAQLKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTDLKNSESELK 1817

Query: 949  -----YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK----KIDHLERSLQAQT 1101
                 Y  KY  +E  +   ++     E+E       +  ++K    K+   E S+    
Sbjct: 1818 QELEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEISISEMD 1877

Query: 1102 NAQNSFSAVTVQDEDQKD-AHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLI 1278
              +     +T ++ D K  ++  D   K+K  +++  + ++      ++   LD+++ L+
Sbjct: 1878 AIKKQVELLTKENVDLKSKSNKADNSAKLKSELDELKKENEKLQLKVNDRSELDDLMLLV 1937

Query: 1279 ENTMKTLEGNSKY 1317
                +  E NSKY
Sbjct: 1938 ---TELDEKNSKY 1947

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 60.8 bits (146), Expect = 6e-09
 Identities = 84/362 (23%), Positives = 150/362 (41%), Gaps = 33/362 (9%)
 Frame = +1

Query: 403  SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMA--IDH 576
            + S+L + FE +        + K EC  ++              KD+NEK  Q    I  
Sbjct: 1187 NFSNLQEQFENITA---ENKSLKEECSGTEEKF-----------KDVNEKLDQYGETISS 1232

Query: 577  LLKVTKQNQRQVDGRDKLEET--EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
            L     +    +D ++K+     E L+S  ++I+ +E  K   N LE++L    +  N  
Sbjct: 1233 LSDEKDKLNGIIDDKEKIISNLNEKLESISEDIDIIEKAK---NLLEEKLATMTSELNDS 1289

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
                 +L+     L  EF++LQ    K    K   +++L+N+   LT     L  DK + 
Sbjct: 1290 ENGSSELRSLYDSLKIEFEELQ----KTNSDKSANLKELENKHTSLTETQEILLEDKKKM 1345

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQA----- 1095
                  Y +    +EK    +  +YN  ED+ ++L+ ++++N   I  LE S+ A     
Sbjct: 1346 ESSINDYVKIKDDLEKEKEDLLNKYNVLEDKKDKLEIILEENNSSIKVLEHSIDALKKEN 1405

Query: 1096 ------------QTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ----TSKN- 1224
                        Q  + NS       ++++K + L++  +K+K   E+K++     SKN 
Sbjct: 1406 EIYKNEIHDMKLQMESSNSEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNL 1465

Query: 1225 ---NDPSCSEAE----ALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
               +D    + E    +L   +  IE + K  E   K    T +K L+ +       ENE
Sbjct: 1466 SLGHDTEKKQFEDKITSLKQEIISIEKSKKQDEKVLKNQKNTLQKELEELKDQFTNSENE 1525

Query: 1384 HI 1389
            +I
Sbjct: 1526 YI 1527

 Score = 57.4 bits (137), Expect = 7e-08
 Identities = 59/280 (21%), Positives = 129/280 (46%), Gaps = 25/280 (8%)
 Frame = +1

Query: 487  SKNAIDSLYY--HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRD-KLEETEVLKSF 657
            SK+ ++ L    +EQL++ +  +++     D L K       Q+  +D KL E E L   
Sbjct: 1019 SKDELEELVIDLNEQLKELETQKETTSKNADELNKSIANLNTQLKQKDSKLIELEELVEV 1078

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ---DDYS 828
             K    + D++  +++L  ++ E    N  ++ +  KL+     + +  +  Q   D   
Sbjct: 1079 TKN--NLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKETDTLQ 1136

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY- 1005
             K+ + E  +Q  K E+  L N  ++  +DK      EK+ S+K   +EK  S++++++ 
Sbjct: 1137 TKLDETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEKNFSNLQEQFE 1196

Query: 1006 -----NKK-EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
                 NK  ++EC+  +       +K+D    ++ + ++ ++  + + + D+++  ++L 
Sbjct: 1197 NITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGI-IDDKEKIISNLN 1255

Query: 1168 DR----------YHKVKEFMEQKL--QTSKNNDPSCSEAE 1251
            ++            K K  +E+KL   TS+ ND     +E
Sbjct: 1256 EKLESISEDIDIIEKAKNLLEEKLATMTSELNDSENGSSE 1295

 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 67/296 (22%), Positives = 133/296 (44%), Gaps = 5/296 (1%)
 Frame = +1

Query: 430  ETLAVGITHETNR-KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR 606
            +TL + + +E    K E     + I +L    +L     N + +Q+  D L    K+ + 
Sbjct: 1605 DTLTMNLNNEIKGLKEEINSKVDQIGNL--KTELNTVSENMEDIQVRYDQL----KEEKS 1658

Query: 607  QVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGK 786
            ++   DKL E+E  +   +    + D   S+ SLE  ++ +     +L++++ +++   +
Sbjct: 1659 EIS--DKLIESE--EKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVKISKQ 1714

Query: 787  RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI 966
             L ++   L ++YS   +  E +++ L+NE          L +   +F ++ K       
Sbjct: 1715 ELDNQKDKLLEEYSIMKRTNESKLKDLRNE----------LDSKIIKFDKERK------- 1757

Query: 967  YIEKYMSHVKQEYNKK----EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
             + +   ++ QEY++K    E+E    K   D    KI  LE +++++ NA    S + +
Sbjct: 1758 LLNEGSDNIAQEYSEKVTSLEEELRNQKIYSD---DKISELEENIKSKNNALTEKSNL-L 1813

Query: 1135 QDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            Q   ++   LE    K K  +E    T KN+D    E E +   L + EN +K +E
Sbjct: 1814 QKRLEEIKELESTLSKYKADLE---ATMKNSDLKNDEFENVCKELSVKENEIKKIE 1866

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 70/328 (21%), Positives = 131/328 (39%), Gaps = 40/328 (12%)
 Frame = +1

Query: 520  EQLEKKDLNE-------KSLQMAIDHLLKVTKQNQRQVDGR--DKLEETEVLKSFIKEIE 672
            EQL KK   +       KS  +A   L +  K + +Q+     +  E+ E+    +K++ 
Sbjct: 2143 EQLNKKLAEKCAEYDSIKSELVASSKLSESEKNDMKQLSDEINELKEQLELKNENLKKV- 2201

Query: 673  EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQD------DYSKK 834
               D +I+ N+ ++   E K ANN +R    K+    K+L  +  +  D      D  KK
Sbjct: 2202 -TSDLQIANNTSDKYNDELKVANNTIREIESKIPNLQKQLDLKEIEYNDTLSSKKDLDKK 2260

Query: 835  MKQKEYEVQKLKNEVKFL-------------------------TNMNTNLKADKTQFSQK 939
            +     E + L  EVK L                          ++N  LK ++   S+ 
Sbjct: 2261 LDNFSKESEILSKEVKSLKKEKLDLEKEKNDLIVELDKYKNDIIDLNNTLKENEKNGSEV 2320

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF 1119
            E +       IE Y  +V Q   +K    + +K +V +   K+   +  +   TN   SF
Sbjct: 2321 ETEIIGLKDKIEFYKLNVSQLNEEKGKLESDIKTLVGERDDKLKSSQSEIIELTNKLESF 2380

Query: 1120 SAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTL 1299
              ++V  E+ K    +   +K+ E  +   ++++N D +  E   L  +   +++    L
Sbjct: 2381 KDISVAYEESK-VESDGLKNKLSEIEKSLEESNENVDSANKEISDLKVMNDKLQSHNLEL 2439

Query: 1300 EGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
            E   +     T +  + +   ++LKE E
Sbjct: 2440 EDKFQQLKNDTTETNRKIQDINKLKEEE 2467

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 69/337 (20%), Positives = 139/337 (41%), Gaps = 62/337 (18%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQ----RQVDGRDKLEE------- 636
            +N +DS       E+K LNE S  +A ++  KVT   +    +++   DK+ E       
Sbjct: 1742 RNELDSKIIKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQKIYSDDKISELEENIKS 1801

Query: 637  -----TEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYY------------ 765
                 TE      K +EE+++ + +++  +  L E    N+ L+ D +            
Sbjct: 1802 KNNALTEKSNLLQKRLEEIKELESTLSKYKADL-EATMKNSDLKNDEFENVCKELSVKEN 1860

Query: 766  ---KLQE---RGKRLCHEFQDLQDDYSKKMKQK----------------EYEVQK--LKN 873
               K++E     + L  E +  +D+   ++ +K                + EVQK  L+ 
Sbjct: 1861 EIKKIEEILSSKEDLIAEIESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKENLQK 1920

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
            ++    N+   +  D  +  + EKQ     + +E   +H+K++  K E    +L+F   +
Sbjct: 1921 KITEYDNLQKLMSLDNKKLVKCEKQIEDLELKLESSSNHLKEQEGKYE----KLEFESGE 1976

Query: 1054 NMKKIDHLERSLQA-QTNAQNSFSAV--------TVQDEDQKDAHLEDRYHKVKEFMEQK 1206
            N K I   +  +Q  Q +  N+   +        T+Q+  +      +   K+ + +  K
Sbjct: 1977 NKKLISEKDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSK 2036

Query: 1207 LQTSKNNDPSCSEAEALDNVLGLIENTM-KTLEGNSK 1314
            LQ  +      ++ E L+  L  ++ T+ K LE +S+
Sbjct: 2037 LQEKE------AQVETLELDLNKLKETLDKELESSSE 2067

>Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356W
            (REAL)
          Length = 947

 Score = 60.5 bits (145), Expect = 6e-09
 Identities = 79/374 (21%), Positives = 158/374 (42%), Gaps = 32/374 (8%)
 Frame = +1

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 540
            YA  ++ +K + I+ I  L            HE     E  + KN  D+L  ++ LE++ 
Sbjct: 153  YAQSDLSSKEVYINEIKSLK-----------HEIK---ELRKEKN--DTLNNYDNLEEET 196

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
                 L+  +  L K      R V+ R+  + +  ++   K   ++ D +    ++  Q+
Sbjct: 197  ---DDLRNKLQELEKELDVKNRMVNSREAEDHSGCIEEREKIERKLNDLEKKFKTVNDQV 253

Query: 721  LEEKTANNILRRDYYKLQERGKRLCH---EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
             E +   N+ + +    +++ K   +   EF++  D+   +++ K  E++ L N++  L 
Sbjct: 254  RELENRANVQKSELKSKEDQLKESMNQLNEFKNNTDENVSQLESKRIELRNLTNQLNALK 313

Query: 892  NMNTNLKADKTQFSQKE---KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK 1062
            N +       +Q  QKE   K+ + K   +EK ++    + + KE E    K  + +  +
Sbjct: 314  NESDE---KDSQLQQKESELKRLTNKLNELEKRLNENSSQSSAKESELKESKSQITELEE 370

Query: 1063 KIDHLERSLQAQTNAQNSFSAVTVQDE---DQKDAHL---EDRYHKVKEFMEQKLQTSKN 1224
            KI+     L+ + N   S  A   Q E   +QKD+ L   ED    + E +++ ++ ++ 
Sbjct: 371  KINKKNSQLETKENELKSLMAQLTQLENRLNQKDSQLGSKEDELKTINEKLQRDIKIARQ 430

Query: 1225 NDPSCSE--------AEALDNVLGLIE---NTMKTLEGNSKYYSTTTKKCL--------- 1344
               S  E         + L+N L +++   N  K++  +     +   K L         
Sbjct: 431  ETASKDERIYALQMKIQNLENDLSMMKKTHNESKSVTNDELESKSKVIKILETDLEVAQE 490

Query: 1345 KYVTGSSRLKENEH 1386
            KY+   S LKE E+
Sbjct: 491  KYLKLQSELKEREN 504

 Score = 38.9 bits (89), Expect = 0.032
 Identities = 64/335 (19%), Positives = 140/335 (41%), Gaps = 32/335 (9%)
 Frame = +1

Query: 313  TRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSK 492
            +++D  K +N+ + R   +    T        +   +    L + I +  N  +  +++ 
Sbjct: 409  SKEDELKTINEKLQRDIKIARQET--------ASKDERIYALQMKIQNLENDLSMMKKTH 460

Query: 493  NAIDSLYYHEQLEKKD----LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            N   S+  +++LE K     + E  L++A +  LK+  + + + + R K+ E+ +    I
Sbjct: 461  NESKSVT-NDELESKSKVIKILETDLEVAQEKYLKLQSELKER-ENRYKISESNLEDENI 518

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYY----------------------KLQ 774
            +  E + D     + L+  + ++ TA   ++  Y                       K++
Sbjct: 519  RLNERISDLARENSRLKSTVDDKSTAVYRMKESYEARLDSLRKEVEEYKVNAEKSESKVE 578

Query: 775  ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKA----DKTQFSQKE 942
            E    +      + +  SK+MK+KE + ++L + +K   +  ++LKA     K +FSQ +
Sbjct: 579  ELRIMITENSARVSEKRSKEMKEKERKNKELTDNLKMQEDEISSLKAMIEKYKKEFSQSK 638

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS 1122
             + S     +   + +++ +  + EDE   LK + D    +ID+ +R      + +N   
Sbjct: 639  SEQSNIQRTLNLQILNLENKLIESEDE---LKSLRDSQETEIDNWKRKYN-NLSLENDRL 694

Query: 1123 AVTVQDEDQKDAHLEDRYHKVKEFMEQK--LQTSK 1221
                     K+  +     K+ E  ++K  LQ SK
Sbjct: 695  LEEKASASDKEHEVSILNRKIDELEKEKWNLQASK 729

>TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] {ON}
            Anc_6.188 YGL086W
          Length = 652

 Score = 59.3 bits (142), Expect = 1e-08
 Identities = 61/293 (20%), Positives = 125/293 (42%), Gaps = 8/293 (2%)
 Frame = +1

Query: 412  DLAQTFETLAVGIT-HETNRKAECERSKNAIDSLYYHEQLE-KKDLNEKSLQMAIDHLLK 585
            DL QT+E      T H +N + E  +    I S     Q +  + L   SLQ+  ++   
Sbjct: 168  DLMQTYENEITKQTKHISNLQQELSKRDEIIASFKNSNQTQVTQTLGSTSLQLQSEYWGN 227

Query: 586  VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE-DNKISINSLEQQLLEEKTANNILRRDY 762
              ++++                S+IKE+E++       I +L+  L  EK  +N +  + 
Sbjct: 228  AIQEHE----------------SYIKELEKINLQQSNEIENLKLSLKNEKNLSNEIEEEL 271

Query: 763  YKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE 942
              +  +     +   DLQ   +K +    +E ++L++      N+N++   ++ +  Q E
Sbjct: 272  VSVNTKLNNALNYNDDLQAQVNKLL----FENERLQSNSIDNINLNSDFAKERNKLLQME 327

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS 1122
            K Y    I ++K    ++Q+     +EC  L+       ++++HL+  LQ   N QN+ +
Sbjct: 328  KNYELNIINLKKLNHEIEQQKLLSFEECKLLR-------EELEHLQNQLQ---NNQNNAN 377

Query: 1123 AVTVQD-----EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNV 1266
              T  +      D      +D  +++K+  +Q L   K ++ +  +    DN+
Sbjct: 378  IKTENNTFKTLADDYKNRTKDLTNELKKLNDQLLNVHKEDNGTSKKRRMSDNI 430

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
            conserved hypothetical protein
          Length = 611

 Score = 58.9 bits (141), Expect = 2e-08
 Identities = 77/418 (18%), Positives = 156/418 (37%), Gaps = 39/418 (9%)
 Frame = +1

Query: 88   FKDMTPSKPNVRFGDDDVNIFDQRKKVNEINKNSSIRRGXXXXXXXXXXXXXXXXXXXXX 267
            F  +   K NV+FGD ++ IF++ +++    K +S                         
Sbjct: 68   FSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANSSVDNVILPLPILKISQKGASDIKYM 127

Query: 268  XXXXDCGFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVG 447
                      ER FE              RCY LCN+P   +S    ++  ++ + L  G
Sbjct: 128  EPDNKMATQQERLFEV-----------FRRCYTLCNLP---MSQFDENNPFKSLKKLCEG 173

Query: 448  ITHETNRKAEC---------ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK----- 585
            I      K EC          R    I  L    Q  K D +   + + I+ L K     
Sbjct: 174  IKKSFKAKDECYKYIRYEENRRLSQEIRKLKDTIQELKDDRHNSLVLLQINKLQKHNNEY 233

Query: 586  ----------VTKQNQRQVDGRDKLEETEVLKS-FIKEIEEVEDNKISINSLEQQLLEEK 732
                      VT  N    + R  + E +  K+  ++++       + + + +++ +E  
Sbjct: 234  RNEIKDLTAQVTSTNYENSELRSNISELQTTKNQLMEKLGTALARSVELENNQEEKIELT 293

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKE---YEVQKLKNEVKFLTNMNT 903
              N  L  D+ KL +  +RL  +++ L+++Y+K     E    +V  L   V+  T+ ++
Sbjct: 294  KQNTKLNNDHGKLNDEHERLTKKYESLEEEYTKVTHSNESLTAKVDALTTTVQGWTHDHS 353

Query: 904  NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDEC--------NRLKFVVDKNM 1059
             LK+         K  + K       +  ++ E +K + +          +L+ ++D+N+
Sbjct: 354  ELKSAHDILKSINKDLNSKLSKESTNVGELEAENSKLQRDSQDSKIAFKTKLQELIDENI 413

Query: 1060 KKIDHLERSLQAQTNAQNSFSAVTVQDED---QKDAHLEDRYHKVKEFMEQKLQTSKN 1224
                 +E+        Q  +  + ++  +   Q++    D     K+ +E +LQ  ++
Sbjct: 414  DLKSQVEKWRVEFEQVQTKYDKLNLEQREIVKQREKFRRDSDQTFKKTVELQLQLDQH 471

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
            YDR356W
          Length = 989

 Score = 58.9 bits (141), Expect = 2e-08
 Identities = 82/383 (21%), Positives = 167/383 (43%), Gaps = 32/383 (8%)
 Frame = +1

Query: 310  ETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDL-AQTFETLAVGITHETNRKAECER 486
            +  ++ F  V D +N    L  I    + ++ + DL  +  E+L       TN  +E E+
Sbjct: 330  DDNNEQFMLVQDELNM--KLSEIENLELELNDLKDLNTKLKESLNDKENELTNVSSEYEK 387

Query: 487  -----------SKNAIDSLYYHE-QLEKK--DLNEKSLQM------AIDHLLKVTKQNQR 606
                        K++ D L     ++ KK  +LN K LQM        D L+ +    ++
Sbjct: 388  YKLDAEAHMGIMKDSDDKLKNQVIEIRKKNIELNSKLLQMNEVNENLNDELMSLKDIIEK 447

Query: 607  -QVDGRDKLEETEVLKSF-IKEIEEVEDNKISINSLEQQLLEEKTAN-NILRRDYYKLQE 777
             + D + KL+E + LKS  I +IE+++ N +++    ++ L+EK    N LRR +  +Q+
Sbjct: 448  LEQDKKAKLQELKSLKSSDISQIEDLKQNNLTLERKLKENLDEKNVEINKLRRQHVDMQK 507

Query: 778  RGK----RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV---KFLTNMNTNLKADKTQFSQ 936
                   +L  E Q L+ +Y  K+   E +++    ++   K L  +  N K DK     
Sbjct: 508  TNSALVDKLTKESQSLRKEYEDKINDLENQLKSNITDLSTNKDLLAVEYNSKMDKLNKEL 567

Query: 937  KEKQYSQKYIYIEKYMSHVKQEYNKK-EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQN 1113
            +E +++ K    E+ +  +K +  +   +   +L  + +    +I+ L   +++  N   
Sbjct: 568  EENKHALKTS--EEIIKDLKNQLIENVTNSSQKLAKLTEAKNSEIESLLSQMESLRNKYR 625

Query: 1114 SFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMK 1293
              +   + +++      E+R   +++  E+KL T +  D         ++    I N+ K
Sbjct: 626  KKTETLINEQE------EERQSYIRKLREEKLSTEREKDNYDKLLLQFNSEKNAIINSKK 679

Query: 1294 TLEGNSKYYSTTTKKCLKYVTGS 1362
             LE N      + +K L+  + +
Sbjct: 680  ELEDNLNNKINSLEKLLQQTSST 702

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 69/353 (19%), Positives = 146/353 (41%), Gaps = 20/353 (5%)
 Frame = +1

Query: 388  HISISSISDLAQTFETLAVGITHETNRKAECERSK--NAIDSLY--YHEQLEKKDLNEKS 555
            +++IS ++DL          I +    K   E+ K  NA D L       LE+     ++
Sbjct: 251  NMTISELNDLK---------IRYNKFEKTIMEKDKLINAKDDLISSLEGNLEEITTEVEN 301

Query: 556  LQMAIDHLLKVTKQNQRQVDGR-DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEK 732
            LQ  +    +V K+ + + +   +K  + +  + F+   +E+      I +LE +L + K
Sbjct: 302  LQDLLRKKEEVIKEYKDKCNTMLEKNHDDDNNEQFMLVQDELNMKLSEIENLELELNDLK 361

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
              N  L+      +     +  E++  + D    M   +    KLKN+V  +   N  L 
Sbjct: 362  DLNTKLKESLNDKENELTNVSSEYEKYKLDAEAHMGIMKDSDDKLKNQVIEIRKKNIELN 421

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
            +   Q ++  +  + + + ++  +  ++Q+   K  E   LK     ++ +I+ L+    
Sbjct: 422  SKLLQMNEVNENLNDELMSLKDIIEKLEQDKKAKLQELKSLK---SSDISQIEDLK---- 474

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN----DPSCSEAEAL- 1257
                 QN+ +      E +   +L+++  ++ +   Q +   K N    D    E+++L 
Sbjct: 475  -----QNNLTL-----ERKLKENLDEKNVEINKLRRQHVDMQKTNSALVDKLTKESQSLR 524

Query: 1258 ---DNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSR-------LKENEH 1386
               ++ +  +EN +K     S     +T K L  V  +S+       L+EN+H
Sbjct: 525  KEYEDKINDLENQLK-----SNITDLSTNKDLLAVEYNSKMDKLNKELEENKH 572

 Score = 34.3 bits (77), Expect = 0.88
 Identities = 37/185 (20%), Positives = 76/185 (41%), Gaps = 5/185 (2%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDL--NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE 642
            K   ER K+  D L      EK  +  ++K L+  +++ +   ++  +Q    D   E E
Sbjct: 650  KLSTEREKDNYDKLLLQFNSEKNAIINSKKELEDNLNNKINSLEKLLQQTSSTDV--ELE 707

Query: 643  VLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
             LKS      E+   ++ I  L +++     +   L  DY K++   + L  E + + D+
Sbjct: 708  TLKS------ELRGKELEIKELYKKVKSVTDSKEELNSDYLKIRSINRELKVELKKIVDE 761

Query: 823  Y---SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
            Y   +KK +    E          L     NL   +++++  +K +  +   + K    +
Sbjct: 762  YNDIAKKYRTLNDEFINNSKAKNGLEEAKANLLILQSKYNMMKKDFLNRLEELGKENVEL 821

Query: 994  KQEYN 1008
            + + N
Sbjct: 822  ENKVN 826

>Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa] {ON}
            YDL058W (USO1) - Integrin analogue gene [contig 72]
            PARTIAL
          Length = 1215

 Score = 58.9 bits (141), Expect = 2e-08
 Identities = 80/291 (27%), Positives = 131/291 (45%), Gaps = 9/291 (3%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR--DKLEETE 642
            K E E ++ A+ +    EQLEKK    K  Q+ +++ LK       + DG+    +EE  
Sbjct: 729  KLESEHAEVALRA----EQLEKKLAGSKEKQLELENGLKEAVDQGMEKDGKVTKLIEEIA 784

Query: 643  VLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
              K+ +KE  E    +I I SLE+  LE+    ++     YK     +R     Q L+++
Sbjct: 785  EAKADLKEKAE----EIRILSLEKSKLEDSYKRSMEELSRYKSSASDER-----QGLENE 835

Query: 823  YS---KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
             +    K+K K  E +K   E K L   +T++  D          YS K   +EK +  +
Sbjct: 836  VTMLRNKLKDKCLEFEK---ERKLLNEGSTSVTED----------YSNKVSSLEKKLDSL 882

Query: 994  KQEYNKKE----DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
            + EY+ K     +E N L+ ++ K+ K     +  LQ    A+   S V        +  
Sbjct: 883  EAEYSSKRRDFANEQNELRALLAKSEKAASKTDAELQL---AERKLSDV--------EKM 931

Query: 1162 LEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
            +E + ++VKE     LQ SK+     SE   ++  LG ++ T+K  E NSK
Sbjct: 932  METKENEVKE-----LQISKD-----SEVAEVNKSLGKLKQTIK--EKNSK 970

 Score = 39.3 bits (90), Expect = 0.026
 Identities = 45/204 (22%), Positives = 84/204 (41%), Gaps = 17/204 (8%)
 Frame = +1

Query: 463  NRKAECERS-------KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            + K EC++         ++ D+L     ++ K+L EK   + I  + K  +  +     +
Sbjct: 415  SEKEECQKEILKLKARLDSQDALVAKLTVKLKELAEKCKGLEIAKVAKDQEMEKLTDKNK 474

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHE 801
            ++L + E     +K+   VE+ + +    E   L      N   +D  KL   GK L  +
Sbjct: 475  EQLSKLEDKAQKLKDQLAVEERQKNDAKSEVGQLIRTIEENAQMQD--KLGLEGKALRAD 532

Query: 802  FQDL----------QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY 951
               L          ++D   K+ Q    +  L  E+K  T+ +  +  +    S K  + 
Sbjct: 533  IDRLSAEVKASESQRNDAKNKLSQAMERIASLDKELKDTTHSHDKIVGELGMTSTKLDKV 592

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDE 1023
            ++K I IEK  + +  E  KKE+E
Sbjct: 593  NEKLITIEKEKTALADECKKKEEE 616

>KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa] {ON}
            similar to uniprot|Q756L3 Ashbya gossypii AER241W
            AER241Wp and weakly similar to YDR356W uniprot|P32380
            Saccharomyces cerevisiae YDR356W SPC110 Inner plaque
            spindle pole body (SPB) component ortholog of human
            kendrin involved in connecting nuclear microtubules to
            SPB interacts with Tub4p-complex and calmodulin
            phosphorylated by Mps1p in cell cycle-dependent manner
          Length = 858

 Score = 57.8 bits (138), Expect = 4e-08
 Identities = 72/345 (20%), Positives = 149/345 (43%), Gaps = 39/345 (11%)
 Frame = +1

Query: 430  ETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQ 609
            ET+  GI  E    +     KN +D L   +Q   ++L    L+     L K+  +N   
Sbjct: 80   ETVPEGIIQERRPNSR----KNLVDDLLIKDQETTENLTSNPLKETESSLKKLQMENYNL 135

Query: 610  VDGRDKL--------EETEVLKSFIKEIEEVEDNKISINSLE------QQLLEEKTANNI 747
                  L        ++ E++K+ ++ ++E++D K+    L       Q+  +     N 
Sbjct: 136  RIKCTSLLKFLNNISDDGEIVKN-LEILDELDDLKVRYRQLNLDYTALQKQCDRIEDQND 194

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ 927
               D  KL+E   +L  E +  +++    +   + ++Q+LK+ +K L N   N++ ++T+
Sbjct: 195  EHEDIAKLKESNDKLKEELRSTKEN----LIDTDAQLQQLKDTIKSLENKIFNMRTEQTE 250

Query: 928  FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVV---DKNMKKIDH-------L 1077
               KE Q+  +   ++  ++        KE EC+ LK  +      +++ DH       L
Sbjct: 251  ---KECQHGMQVDLLQSKINETSTSLTSKERECSDLKEKIKWLTSQLQEFDHQSGSLLDL 307

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKD------AHLEDRYHKVKEFMEQKLQTSKN----- 1224
            + +L ++  A  +  A   ++E Q+       + L++    ++E   QK+ T K+     
Sbjct: 308  QSTLDSKNEAIRNLEAQLQRNEHQRQSLEREVSLLQEELSSIRE-THQKIITHKDQQIKQ 366

Query: 1225 --NDPSCSEAEALDNVLGLIENTMKTLEGNS--KYYSTTTKKCLK 1347
               + S S++EA+  +  L    ++ LE N   K+     K+ +K
Sbjct: 367  LTENLSSSDSEAVKRLNELSSERLRLLETNKSLKFSEKDLKQTVK 411

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 55/238 (23%), Positives = 108/238 (45%), Gaps = 27/238 (11%)
 Frame = +1

Query: 631  EETEVLKSFIKEIEEVEDNKIS--INSLEQQLLEEKTANNILRR---DYYKLQERGKRLC 795
            E  E+ KS   +I + E+N +S  +++L +Q   +K+    ++R   +   L+   K L 
Sbjct: 456  ELLEMRKS--NDILKTENNSLSRRLDNLIRQSPSKKSVEVDIQRKNNEIRALRSTVKDLE 513

Query: 796  HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQ------------- 936
            HE QD+  + SK  +  + E+QKL+ +V    ++ T++  +K++                
Sbjct: 514  HELQDVTSNVSKLKENHKEEIQKLRKQVN--PDLPTDVLEEKSKLQNRISLLQMELNSIK 571

Query: 937  --KEKQ---YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
              KEK+   + +KY  I +    + QE   +  + + +    DK + ++     SL  + 
Sbjct: 572  DTKEKELAMWRRKYETIRRSNEELLQEGKDQSGQLSNILNEKDKEILQLQSRFNSLLTEK 631

Query: 1102 NA-QNSFSAVTVQDEDQKDAHLEDRYHK---VKEFMEQKLQTSKNNDPSCSEAEALDN 1263
            N+  N  S V    +D K+   +++       KEF++ K   SK  + S    + L+N
Sbjct: 632  NSLLNELSKVRSHKDDYKEELKKNQSRLEFITKEFVKLK-DASKQAENSEDAKDILNN 688

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 62/325 (19%), Positives = 140/325 (43%), Gaps = 11/325 (3%)
 Frame = +1

Query: 406  ISDLAQTFETLAVGITHET-----NRKAECERSKNAIDSL----YYHEQLEKKDLNEKSL 558
            +S+L +  + L   I+H+       RK    + K     +       E+     +N +  
Sbjct: 263  LSELEKKMKELPKAISHQNVGNNNRRKKNRNKGKKNKGGITTGDISEEETVDNSINTEEY 322

Query: 559  QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIE--EVEDNKISINSLEQQLLEEK 732
                ++L ++ ++ +   D + K E+ E      KE+E  ++E +   + +L  +L++ K
Sbjct: 323  DKLKENLQELQEKYKDCEDWKQKYEDIEAELKDAKELENSQLEKSAKELETLNTELIDTK 382

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
             +      +  ++++  + + +E  D +D+  +   ++  EV+ +K E+  L + N  + 
Sbjct: 383  KSLKEKNSELEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLRHKNATMI 442

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
                 +  K  +   K   + K + H+K    +KE E    +  V K  ++I  L     
Sbjct: 443  E---AYEAKNTELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEISQLTYEKS 499

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLG 1272
              T    S    + + +++  ++LE++   VK+F EQK    K+ +    +   + N L 
Sbjct: 500  NITKELTSLRT-SYKQKEKTVSYLEEQ---VKQFSEQKDVAEKSTEQLRKDHAKISNRLD 555

Query: 1273 LIENTMKTLEGNSKYYSTTTKKCLK 1347
            L++   +TL  +    S + ++ LK
Sbjct: 556  LLKKENETLHNDIAKNSNSYEEYLK 580

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 76/321 (23%), Positives = 127/321 (39%), Gaps = 39/321 (12%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKS 555
            I TK       S+L +  + L        + K E + S +  +      +LE  DL  K+
Sbjct: 379  IDTKKSLKEKNSELEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLRHKN 438

Query: 556  LQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS-INSLEQQLLEEK 732
              M   +  K T+   +      K+E  + L +  ++ +    NK++ +N    QL  EK
Sbjct: 439  ATMIEAYEAKNTELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEISQLTYEK 498

Query: 733  TANNILR-----RDYYKLQERGKRLCHE----FQDLQDDYSKKMKQKEYEVQKLKNEVKF 885
            +  NI +     R  YK +E+      E    F + +D   K  +Q   +  K+ N +  
Sbjct: 499  S--NITKELTSLRTSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQLRKDHAKISNRLDL 556

Query: 886  LTNMNTNLKADKTQFSQKEKQYSQKY--------IYIEKY--MSHVKQEYNKKED----E 1023
            L   N  L  D  + S   ++Y ++         I  EKY  + +VK   N+  D    +
Sbjct: 557  LKKENETLHNDIAKNSNSYEEYLKENGKLSERLNILQEKYNTLQNVKSNSNEHIDSIKRQ 616

Query: 1024 CNRLKFVVDKNMKKIDHLERSL-------QAQTNAQNSFSAV---TVQDEDQKDAHLEDR 1173
            C  L   + ++ KKI  LE  L       Q +T   N+   +   +  D+  K   LE++
Sbjct: 617  CEELNVKLKESTKKILSLEDELNEYANIVQDKTREANTLRRLVSDSQTDDSSKQKELENK 676

Query: 1174 Y-----HKVKEFMEQKLQTSK 1221
                   K K   E  LQTS+
Sbjct: 677  LAYLTDEKNKLEAELDLQTSR 697

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 69/350 (19%), Positives = 142/350 (40%), Gaps = 11/350 (3%)
 Frame = +1

Query: 337  VNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYY 516
            +ND + R     +   +  S  ++ D  + F      +  E N K + +  K  +++L  
Sbjct: 112  LNDEIKRLTKQNSEIPESASSETLKDKEEEF------LKKEQNYKNDIDDLKKKMEALNI 165

Query: 517  HEQLEKKDLNE-----KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE 681
                 +K+ N+     +   +A++++LK  ++ ++Q   ++++  +E+ +    +   +E
Sbjct: 166  ELDTVQKEKNDTVSGLREKIVALENILKEEREAKKQ---KEEVSISELKEELAIKNHSLE 222

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ--KEYE 855
            D+++ I  LEQ L  + T   I+     +L E    L  + + L  +  KKMK+  K   
Sbjct: 223  DSRMKITELEQNLSSKST---IMEEKSSELAELNITLKEKERKL-SELEKKMKELPKAIS 278

Query: 856  VQKLKNEVKFLTNMNTNL--KADKTQFSQKEKQYSQKYIYIEKY--MSHVKQEYNKKEDE 1023
             Q + N  +   N N     K   T     E++     I  E+Y  +    QE  +K  +
Sbjct: 279  HQNVGNNNRRKKNRNKGKKNKGGITTGDISEEETVDNSINTEEYDKLKENLQELQEKYKD 338

Query: 1024 CNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQ 1203
            C   K       +K + +E  L+     +NS               LE    +++    +
Sbjct: 339  CEDWK-------QKYEDIEAELKDAKELENS--------------QLEKSAKELETLNTE 377

Query: 1204 KLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYV 1353
             + T K+     SE E + ++L  + N +   +   K  S+   + +K V
Sbjct: 378  LIDTKKSLKEKNSELEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTV 427

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 70/303 (23%), Positives = 117/303 (38%), Gaps = 30/303 (9%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE 642
            N   E  +SK   + +   E L+ KDLNEK ++        V K NQ        ++E  
Sbjct: 858  NSTKEINKSKKFSEKIKSLE-LQIKDLNEKLIKSETTDKENVLKLNQ-------SMDEIN 909

Query: 643  VLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
             LK+ I E  + E +KI + S            +   + +  L E    L  + + + D 
Sbjct: 910  SLKNHILEKND-ELDKIKLES------------DATLKKWESLNETNNTLTKDLKSMTD- 955

Query: 823  YSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY------SQKYIYIEKYM 984
               KM+ +E E++ LKN+   +  +NT LK  K +  QK+K+       +     +E  +
Sbjct: 956  ---KMETREKEIETLKNDTTKIDEINTQLKEAKEKILQKDKEIITLKNDTSAADKLESQL 1012

Query: 985  SHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED------ 1146
              ++     K+ +    K ++D    KI  LE SL  +     +    T  ++D      
Sbjct: 1013 KDLQANLISKDKKSKDDKSLIDSLNTKITKLEESLTKRDKEIITLKTNTKTNDDLTNKLK 1072

Query: 1147 -----------------QKDAHLEDRYHKVKEFMEQKLQTSKN-NDPSCSEAEALDNVLG 1272
                               +  LE   H +K+ +  K    KN ND    +   LD  L 
Sbjct: 1073 KLETELSTKEKSYKLLFDSNKSLETEIHSIKKVVASKDSQIKNLNDTLSKKENNLDGKLS 1132

Query: 1273 LIE 1281
            L+E
Sbjct: 1133 LLE 1135

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 68/338 (20%), Positives = 142/338 (42%), Gaps = 50/338 (14%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK-LEETEVLKSFIKEIEEVEDNKIS 696
            E + K D + ++ ++ I +L ++ K + + V    K LEE  + ++ + +  ++ +  + 
Sbjct: 1481 ESISKYDEDLRAYRLEILNLKEIMKNSDKGVATLQKRLEEKSLNENLLLDRIKILEKDLD 1540

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE 876
                + +LL  KT  +  ++    L E      H+++    DY+  +KQ + ++Q++ + 
Sbjct: 1541 TTEHQNELLS-KTLTSQKQQIENNLNE-----IHQYELQLKDYAYALKQSDEDIQQMVSN 1594

Query: 877  VKFLTNM-----------------------NTNLKADKTQFSQK---------------E 942
            + FL +                        +T+L+  K+Q + K                
Sbjct: 1595 INFLKDQIKDNEQALFDHENEKNSLIMELNDTSLELKKSQDAIKLYTSEISHLKERIVDA 1654

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNR----LKFVVDKNMKKIDHLERSLQAQTNAQ 1110
            +  +++Y  I++  S +KQ Y K E E N+    L F ++   K  ++    L  QTN  
Sbjct: 1655 QDRTKEYEEIDQLRSQLKQ-YMKIESELNKEISVLNFKLNTLTKDSEYKIEELLKQTNHY 1713

Query: 1111 NSFSAVTVQDEDQKDA---HLEDRYHKVK---EFMEQKLQTSKNNDPSCS-EAEALDNVL 1269
                     + D  D+   +L+  Y  V      +   +++  N +   S E E L+N  
Sbjct: 1714 TELVEKLGSERDMLDSTGQNLKQLYENVSTEASTLSDNMKSLINENTMLSGEVERLEN-- 1771

Query: 1270 GLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
             L+E+  K L    KY +  +K  +KY+  +  L+  +
Sbjct: 1772 -LLEDKNKLL-NEIKYENNDSKNSIKYLQETLELRNKQ 1807

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 36/176 (20%), Positives = 73/176 (41%), Gaps = 4/176 (2%)
 Frame = +1

Query: 628  LEETEVLKSFIKEIEEV-EDNKISINSLEQQLLEEKTANNILRRDYY---KLQERGKRLC 795
            + E  +L   ++ +E + ED    +N ++ +  + K +   L+       K  ER + L 
Sbjct: 1756 INENTMLSGEVERLENLLEDKNKLLNEIKYENNDSKNSIKYLQETLELRNKQTERNEELL 1815

Query: 796  HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE 975
               QD  D++ +   +++    + + E + +  +N  L         +     ++  ++ 
Sbjct: 1816 KSLQDQLDEFKENYNEEKQNALEFEEEYRSVDKLNHQLTLKYNTLRDRLNDTRERDQWLA 1875

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            K       E   K  E   LK+   K  KK++H+   LQ + N  +S  A  V+DE
Sbjct: 1876 KI-----HELETKISEETELKYEEIKKNKKLEHIIGDLQRE-NLMSSSIADKVEDE 1925

 Score = 34.7 bits (78), Expect = 0.71
 Identities = 67/281 (23%), Positives = 117/281 (41%), Gaps = 29/281 (10%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHL-LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS 705
            +KK  ++KSL   ID L  K+TK  +  +  RDK  E   LK+  K  +++ +    +  
Sbjct: 1023 DKKSKDDKSL---IDSLNTKITKLEE-SLTKRDK--EIITLKTNTKTNDDLTNK---LKK 1073

Query: 706  LEQQL-LEEKT------ANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK---------- 834
            LE +L  +EK+      +N  L  + + +++       + ++L D  SKK          
Sbjct: 1074 LETELSTKEKSYKLLFDSNKSLETEIHSIKKVVASKDSQIKNLNDTLSKKENNLDGKLSL 1133

Query: 835  -----------MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY 981
                       MK    +  KLKN+++ LT  N +L          EK+ S+K   +E  
Sbjct: 1134 LEKECHSALTKMKTLLLDNSKLKNQIEQLTESNNSL----------EKKLSKKDDELENL 1183

Query: 982  MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
                K   ++     N     +++N K I  L+ S       + S+S             
Sbjct: 1184 KGISKIHSDELTTITNERDSFIEENEKLITELKSS-------RASYS------------E 1224

Query: 1162 LEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIEN 1284
            L   ++K+ E M +KLQ++ ++D S S  E    +  L +N
Sbjct: 1225 LNKNFNKLSEKM-KKLQSASSDDESLSNEELHVKIKSLEKN 1264

>NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] {ON}
            Anc_4.46 YLR309C
          Length = 920

 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 65/320 (20%), Positives = 136/320 (42%), Gaps = 7/320 (2%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK-------DLNEKSLQMA 567
            SD   +  T  +  + +   K +  + +NA+ +     Q+EK+       +LN K   + 
Sbjct: 283  SDTEPSVSTTPISKSKKKRNKKK-NKKQNALSTAETISQIEKEVPTNSSGELNIKYEALL 341

Query: 568  IDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
             D+    T  +  Q       E +E LK     +EE++  K     ++ +LL+ K A   
Sbjct: 342  KDYTELKTAHSNCQKWESQYNEVSEKLKDSKSLLEEMQALKNEHEKIQAELLDSKKALKS 401

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ 927
               +  ++++  + + +E  + +D      K  + E+   +NE++ L   N   +A  + 
Sbjct: 402  KSVEVEEVRDMLRDVGNELVEAKDQLKDSSKIDKEELTNARNEIEKLKKDN---EAVVST 458

Query: 928  FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA 1107
            +  K  + + K  Y+   ++  K   ++++ +        +  + K+     ++ +Q   
Sbjct: 459  YRMKHVELTNKIDYLNNELTKFKASSDEQKKQLQESVNNANDIINKLKIENSNITSQFRD 518

Query: 1108 QNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENT 1287
             N+    T+Q E +  A+LE +   +KE+ E K + +K  D    E   L N LGL++  
Sbjct: 519  YNNLKNATIQKE-KTIAYLEKQ---IKEYTEAKDKLNKEIDIQKKENIQLTNRLGLLKKE 574

Query: 1288 MKTLEGNSKYYSTTTKKCLK 1347
             + L  N    S + +  LK
Sbjct: 575  NQNLHDNESKNSQSFENYLK 594

 Score = 34.7 bits (78), Expect = 0.66
 Identities = 57/293 (19%), Positives = 122/293 (41%), Gaps = 21/293 (7%)
 Frame = +1

Query: 487  SKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK----- 651
            +K A D     E  +K +   K LQ  +D   + T  N    +  ++L++   LK     
Sbjct: 130  AKQATDGDSLKELKKKHEEEIKELQTQLDLTKENTPVNTSNNEDNEELKKMFELKEQEYK 189

Query: 652  SFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            S I ++E EVE     + + E+QL+ E+  +          Q+    L   +Q  +D  +
Sbjct: 190  SNISKLETEVEKINAELGAKEEQLVLERNGS----------QKEKAELLESYQKERDVLN 239

Query: 829  KKMKQKEYE-------VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS 987
            +++K    E       ++ L+ ++K  +   +    +  +  Q + + S     I K   
Sbjct: 240  EQLKATTEELKINIEKIESLEKQLKEKSIPPSGNGVEDVEAPQSDTEPSVSTTPISKSKK 299

Query: 988  HVKQEYNKKEDECNRLKFV--VDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
               ++ NKK++  +  + +  ++K +      E +++ +   ++     T     QK   
Sbjct: 300  KRNKKKNKKQNALSTAETISQIEKEVPTNSSGELNIKYEALLKDYTELKTAHSNCQK--- 356

Query: 1162 LEDRYHKVKEFME------QKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
             E +Y++V E ++      +++Q  KN      +AE LD+   L   +++  E
Sbjct: 357  WESQYNEVSEKLKDSKSLLEEMQALKNEHEKI-QAELLDSKKALKSKSVEVEE 408

>ZYRO0G08250g Chr7 (671493..673457) [1965 bp, 654 aa] {ON} similar to
            uniprot|P40957 Saccharomyces cerevisiae YGL086W MAD1
            Coiled-coil protein involved in the spindle- assembly
            checkpoint phosphorylated by Mps1p upon checkpoint
            activation which leads to inhibition of the activity of
            the anaphase promoting complex forms a complex with Mad2p
          Length = 654

 Score = 55.1 bits (131), Expect = 3e-07
 Identities = 62/292 (21%), Positives = 120/292 (41%), Gaps = 10/292 (3%)
 Frame = +1

Query: 511  YYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNK 690
            Y  E L++  +  K LQ  + +  ++ + N +Q     +L  T   ++F K   E   NK
Sbjct: 197  YSTEDLQELTVTNKMLQDQLQYSKELEEANMQQAGELKRLRMTSESQNFWKSENEKLQNK 256

Query: 691  IS-INSLEQQLLEEKTANNILRRDY--YKLQERGKRLCHEFQDLQDDYSKKMKQ---KEY 852
            +  +N LE+Q  + +  N  L+     + L   GK+     +D+  D++   K+      
Sbjct: 257  VEQLNLLEKQFQDSQLENVQLKSQIASWGLYTDGKQ---SPEDIVRDWTLTKKECIVLND 313

Query: 853  EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR 1032
            E +K++ ++  L N+N  L  ++ Q  +  K Y    I ++K    V+Q+     +EC  
Sbjct: 314  ENKKIRFDLMNLKNLNDELAHERNQLLELNKNYEANIINLKKLNHEVEQQKQLSFEECRL 373

Query: 1033 LKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ 1212
            L+  +++  K                  FS  + +D D     L D Y    E +  +L+
Sbjct: 374  LRIEMEELSK------------------FSKDSNRDADAGYGSLVDSYKNQTEDLTGELK 415

Query: 1213 TSKN----NDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVT 1356
               +     +P+  + +A D +       +  L+  +   S   KKC   +T
Sbjct: 416  KLNDQLLAREPATKKRKASDQLGLNYSQRLNELQLENVSLSRELKKCQDTIT 467

>CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023w MYO1
          Length = 1884

 Score = 55.1 bits (131), Expect = 3e-07
 Identities = 56/232 (24%), Positives = 112/232 (48%), Gaps = 5/232 (2%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYH-EQLEKKDLNEKSLQMAID-HLL 582
            S+L  + E     + H  +     ++ +N  ++L    EQ E+ +   KS+QM ++ + +
Sbjct: 1651 SELGNSTEQFNATVKHNVDVN---DKLRNLEETLRLQTEQNERNEQLVKSIQMDLESYKM 1707

Query: 583  KVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDY 762
            K  ++ Q+ +D    +EE E LKS    +EE      +I  L+Q+L +       LR+ +
Sbjct: 1708 KYDEEKQKNID---LVEEAETLKSVTVRLEE------TIKDLDQRLSDTSEKEAWLRKIH 1758

Query: 763  YKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE 942
                   + L ++ +D++ +  KK K  E  + +L+        +      D+T+F +  
Sbjct: 1759 -----EVETLLNDERDMKIEEMKKSKALERTINELEARNASQVEVIETANGDRTKFEETV 1813

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNM---KKIDHLERSL 1089
             +Y+++   +EKY+S  +QE + K+        VV +NM   +K++ +ER L
Sbjct: 1814 MKYNEQMHQLEKYIS--QQEIDMKK--------VVRENMEYQEKMNEMEREL 1855

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 64/345 (18%), Positives = 139/345 (40%), Gaps = 15/345 (4%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAECE--RSKNAIDSLY--YHEQLEKKDLNEKSLQMA 567
            S + ++   F ++  G +     K E +  R+   I +++  Y+E+++    N   + M 
Sbjct: 764  SILFEITVRFNSIIRGWSQRKRTKGEIQKMRASEMIGNVFRKYNEKMQDPWFN---MYMK 820

Query: 568  IDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
            I  LL     +Q  VD R   E+ +VL+   +++  VE  K    +    LL E      
Sbjct: 821  IKPLLA---SSQNIVDSRKYTEKIKVLE---QKLTAVETEKKIHTAKHNDLLNE------ 868

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ 927
                            ++ ++L D   +K+K+ E  + K   + + +  M   ++ DK+ 
Sbjct: 869  ---------------LNDVKNLLDVEKEKLKRNEQLLSKSNEQQREIETMIKEIREDKST 913

Query: 928  FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA 1107
               +++    K   +E     ++++ N+K+     L   +     +   + R +   T  
Sbjct: 914  LLSEKEAAISKIQELELVRQKLEEKNNEKDASIAELTRKLSSLESEKGDITRQISMDTEV 973

Query: 1108 QNSFSAVTVQDED--QKDAH-LEDRYHKVKEFMEQKLQTSKNNDPSCSEAE-----ALDN 1263
                    ++ E   +K +H +++R H + E  +++  ++K+ D      E     AL  
Sbjct: 974  LKKLENEKMEKERVIEKLSHDIKERDHIIDELKQKEHISNKDLDIKLQTLEKNCNVALTK 1033

Query: 1264 VLGLIENTMKTLE---GNSKYYSTTTKKCLKYVTGSSRLKENEHI 1389
            +  L+    +  E    N K ++ T ++       SS+ KE E +
Sbjct: 1034 LKSLLNENAELREEVGKNKKLHANTIQQV------SSKEKEIERL 1072

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
            some similarities with uniprot|Q22X91 Tetrahymena
            thermophila SB210 TTHERM_00561660 Viral A-type inclusion
            protein repeat containing protein
          Length = 698

 Score = 54.7 bits (130), Expect = 4e-07
 Identities = 86/445 (19%), Positives = 175/445 (39%), Gaps = 39/445 (8%)
 Frame = +1

Query: 46   NNNSHGISPFK----DSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEINKNSSIRRGXXX 213
            ++  HG  P      ++YF + T  +  +RFG+++   FD  ++V ++    +  +    
Sbjct: 57   SHRDHGFYPDPKIPYEAYFANETEEREKLRFGENETITFDINEEVGKLVMKEAEYKPASQ 116

Query: 214  XXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKHI 393
                                       Y        D  +EV   + +CY +C I   ++
Sbjct: 117  HGALDQKNTKNKSILKTNPRTV---IPYRPHANPYIDACQEV---MIKCYNMCGISVDYL 170

Query: 394  SISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID 573
             I  + D   +   L  GI++E   K  C     A +   + E  EK+DL     Q   +
Sbjct: 171  DIDKMFD---SLGKLMFGISNEFKMKELCFNYVLAAEKRKWFE--EKEDLKASVEQFKTE 225

Query: 574  HL----------LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL- 720
             L          +K+ ++++R  + +  L + E      +E   +      + S   QL 
Sbjct: 226  RLGLCELNVELGIKLQQESKRVENLQKLLVKLEQFDKVQQENTGLALVNTDLTSKNDQLT 285

Query: 721  -----LEEKTAN-NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK------ 864
                 LE K    + + R   +L ++   L  + + L DDY K  K+K+    K      
Sbjct: 286  SKLLNLEAKVLQLSDVDRTNVELNDKISALTSKNESLSDDYDKLFKEKQELESKNSELLQ 345

Query: 865  ----LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK--KEDE- 1023
                L++E +     N NL  + T F+ K ++ + K  ++E  + ++K +Y++  K D  
Sbjct: 346  NNNELRSERERWLERNENLIINSTDFNVKMEERNAKIKFLEAQIENIKAKYDRDTKSDMK 405

Query: 1024 --CNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED---QKDAHLEDRYHKVK 1188
               N++  ++ +N+ +   +E+ +     A      +   +E      +    D   K+K
Sbjct: 406  YFKNKINDMLRENVNQTSQMEKVIVNLNQANYKVDELLKDNESLRVDNNNMRADLQQKLK 465

Query: 1189 EFMEQKLQTSKNNDPSCSEAEALDN 1263
            +  + +LQ  K +  + ++ E L+N
Sbjct: 466  DIKDLQLQL-KQDKVTFTKYEKLEN 489

>ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} similar to
            uniprot|P08964 Saccharomyces cerevisiae YHR023W MYO1 Type
            II myosin heavy chain required for wild- type cytokinesis
            and cell separation localizes to the actomyosin ring
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1918

 Score = 53.9 bits (128), Expect = 8e-07
 Identities = 64/309 (20%), Positives = 134/309 (43%), Gaps = 15/309 (4%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI 693
            + EQL+     + SLQ  +D   K+ +Q +++   +++  E        K + E+   K 
Sbjct: 886  HKEQLDAAKEQQLSLQKKLDDATKLKEQIEQEKQKKEEQHE--------KALGELLSIKQ 937

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQER---GKRLCHEFQDLQDDYSKK---MKQKEY- 852
            S N+ E Q+ E +T N+ L +   +L+ +    +R  H  +  +   SK+   +K +E  
Sbjct: 938  SSNNGEAQMKELETKNSELAKQVEQLKNQVSEKERALHSLEQSKSQVSKELVSLKSRESS 997

Query: 853  ---EVQKLKNEVKFLTNMNTNLK----ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
               E+QKLK++   +      L+    A + +F + +   + K    +K +S ++   + 
Sbjct: 998  VHDELQKLKSQESAMKREMEKLRSAESARRKEFDKMKADETSK----DKEISTLRGRLSS 1053

Query: 1012 KEDECNRLKFVVDKNMK-KIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVK 1188
             E + N     ++KN +  +  L+  ++  T+  N  S +    E +K+ +  D   K +
Sbjct: 1054 SEKDVNIKLNNLEKNCEAAMKRLKTLVEENTDLNNKISTL----EKEKNNYTRDVSTKER 1109

Query: 1189 EFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSR 1368
            E+   + +  ++ +     A   DNV+   +  ++ L+           K          
Sbjct: 1110 EYTRMRERIDQHQEEMSVLASQRDNVVAEHDQVIQELKDARAQLMDYKTKLQNLEKEYDA 1169

Query: 1369 LKENEHITN 1395
            LKEN+ +TN
Sbjct: 1170 LKENQTLTN 1178

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 67/285 (23%), Positives = 127/285 (44%), Gaps = 28/285 (9%)
 Frame = +1

Query: 319  DDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNA 498
            D+  K+V        AL N   + I+ ++  DL +  E + +             R KN 
Sbjct: 1620 DELLKQVQHYEKVVAALSN--ERDIADAAEKDLTKKLEVMILRTDTLAETVEAVSRDKNQ 1677

Query: 499  IDSLY--YHEQLEKKDLN-EKSLQMAID-----HLLKVTKQNQRQVDGRDKL------EE 636
            +++      ++L K   N E +LQ   D       L+ T + QR  + R++       ++
Sbjct: 1678 LEAELEKMRDELVKSTANFEDTLQENHDIANNVSYLEDTLKLQRDQNARNEALVKQLQDD 1737

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQLLEE--KTANNILRRDYYKLQERGKR--LCHEF 804
             ++LK+ +KE    E  K      E Q LE+    ANN +     +L +  ++     + 
Sbjct: 1738 VDLLKATLKE----EKQKFIELDEESQALEKINNQANNRIEFLETQLADTSEKDAWLSKM 1793

Query: 805  QDLQDDYSKKMKQKEYEVQKLKNEVKFLTNM---NTN-------LKADKTQFSQKEKQYS 954
             +L++  +K+ + K  E++++KN   F+ N+   N N         ADK QF  +  QY+
Sbjct: 1794 HELENLVTKETQAKYEEMKRVKNLELFVENLKEKNANQTEIIDIANADKEQFDSRLLQYN 1853

Query: 955  QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 1089
            ++ + +EK++S  KQE + K+   +   +       K++ LER +
Sbjct: 1854 EQLMLMEKHIS--KQEMDLKKCMRDNANY-----QNKVEGLEREV 1891

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 57/286 (19%), Positives = 116/286 (40%), Gaps = 30/286 (10%)
 Frame = +1

Query: 502  DSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE 681
            D L +  + EK +L E  LQ A   L ++  Q+  ++ G D       LK  + + EE  
Sbjct: 1522 DKLIWQRETEKNEL-EMQLQEASLELKRI--QDINEMLGADLTH----LKERLAKREEDA 1574

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
             +   I+SL+Q L     +   ++++    + + + L HE +   D+  K+++  E  V 
Sbjct: 1575 QSIAIIDSLKQDLNTFMKSETAMKKEISTYRYQLESLAHESEIKLDELLKQVQHYEKVVA 1634

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
             L NE         +L         +    ++    + +  + ++ E  K  DE  +   
Sbjct: 1635 ALSNERDIADAAEKDLTKKLEVMILRTDTLAETVEAVSRDKNQLEAELEKMRDELVKSTA 1694

Query: 1042 VVDKNMKK-------IDHLERSLQAQT--NAQNS-----------FSAVTVQDEDQKDAH 1161
              +  +++       + +LE +L+ Q   NA+N                T+++E QK   
Sbjct: 1695 NFEDTLQENHDIANNVSYLEDTLKLQRDQNARNEALVKQLQDDVDLLKATLKEEKQKFIE 1754

Query: 1162 LEDRYHKVK----------EFMEQKLQTSKNNDPSCSEAEALDNVL 1269
            L++    ++          EF+E +L  +   D   S+   L+N++
Sbjct: 1755 LDEESQALEKINNQANNRIEFLETQLADTSEKDAWLSKMHELENLV 1800

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 63/310 (20%), Positives = 131/310 (42%), Gaps = 5/310 (1%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMA---IDHL 579
            +D+++ ++ L       T   A C  ++ ++ +    +  E +++ +    +    ++  
Sbjct: 261  NDMSEKYDKLIADFEKLTEEHANCSETQGSLQNQLNTKSSEVEEVRDMLRDVGNELVEAK 320

Query: 580  LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN-KISINSLEQQLLEEKTANNILRR 756
             K+ + NQ      + + +   L++ I  I+E  DN K  I++  Q+    KT  + L+ 
Sbjct: 321  DKIKEFNQSSNANDELISKNSNLENEITRIKEENDNVKNEISAARQENENLKTEISTLKT 380

Query: 757  DYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQ 936
            D   L    + + ++   L+++     K+      KL+ EVK   N    L +   Q   
Sbjct: 381  DTDNLNGHIQSIKNDNNKLENEIQLVKKENS----KLETEVKTSKNETDKLSSQLNQVKN 436

Query: 937  KEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNS 1116
            K  Q  +  IY+EK +    +     +   + LK    +   +ID L+   ++  N    
Sbjct: 437  KLIQKEKTVIYLEKQIKEYAENQEPVKQAMDLLKRENKQLSNRIDLLKNENESLNNDLKK 496

Query: 1117 FSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIEN-TMK 1293
             S+ T +D  +++  L +R   ++E  +  LQ  KNN      ++ +D++    E   +K
Sbjct: 497  NSS-TYEDYLKENGKLTERIDILQEKYD-TLQNLKNN-----SSDHMDSIKKQCEELNVK 549

Query: 1294 TLEGNSKYYS 1323
              E N K  S
Sbjct: 550  LREANKKIIS 559

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 59/325 (18%), Positives = 136/325 (41%), Gaps = 18/325 (5%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR-QVDGRDKLEET 639
            N K E    K   D+L  H Q  K D N+   ++ +     V K+N + + + +    ET
Sbjct: 370  NLKTEISTLKTDTDNLNGHIQSIKNDNNKLENEIQL-----VKKENSKLETEVKTSKNET 424

Query: 640  EVLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ 816
            + L S + +++ ++   + ++  LE+Q+ E       +++    L+   K+L +    L+
Sbjct: 425  DKLSSQLNQVKNKLIQKEKTVIYLEKQIKEYAENQEPVKQAMDLLKRENKQLSNRIDLLK 484

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK 996
            +           E + L N++K  ++   +   +  + +++     +KY  ++   ++  
Sbjct: 485  N-----------ENESLNNDLKKNSSTYEDYLKENGKLTERIDILQEKYDTLQNLKNNSS 533

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTN--------AQNSFSAVTVQDEDQK 1152
               +  + +C  L   + +  KKI  LE  L   T+        A      ++  + D+K
Sbjct: 534  DHMDSIKKQCEELNVKLREANKKIISLEDELSDYTSIIQDKAREADTMRRLLSESNNDEK 593

Query: 1153 DAHLEDRYHKVKEFMEQ--------KLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGN 1308
            +  L++   K+   +++         LQ+S+N      E + L ++    +N +K+L+ N
Sbjct: 594  N-KLDEMETKLNSMIDENNNLKSELNLQSSRNK----IELQNLQSLNDQSQNEIKSLQLN 648

Query: 1309 SKYYSTTTKKCLKYVTGSSRLKENE 1383
                 +  +   K      + K+N+
Sbjct: 649  KLQLLSEIETLNKLNENFKKHKDND 673

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 72/346 (20%), Positives = 149/346 (43%), Gaps = 15/346 (4%)
 Frame = +1

Query: 310  ETRDDTFKEVNDAVNRCYALCNIPTKHISI--SSISDLAQTFETLAVGITHETNRKAECE 483
            +T+ +   +V D   R   +    T+++S+    I D+  +   +++ +  E + +   E
Sbjct: 631  KTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAE 690

Query: 484  RSKNAIDSLYYHEQLEKKDLNEKS--LQMAIDHLLKVTKQNQRQ-VDGRDKLEETEVLKS 654
                 + +     + E   L ++S  LQ +I      T +   + +  + KL  TE   S
Sbjct: 691  ERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALS 750

Query: 655  FIKEIEEVE-DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK 831
             +K  ++++ D++ S+     +L  EKT+  I+      LQ+       E +DL D+  K
Sbjct: 751  NLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQK-------EREDLLDEARK 803

Query: 832  KMKQKEYEVQKLKNEVKFLTNMN----TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 999
              + K  EV++  NE+K  T+        L+ D T    K + Y  K   ++K    V  
Sbjct: 804  SCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNT---SKIEWYQNKIETLKKDNDSVMN 860

Query: 1000 EYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE-DQKDAHLEDRY 1176
              N+K+ E  +L++ V    K+I+  +  L        + +  +++ E +    +L + Y
Sbjct: 861  LVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKELEMSKINLTEAY 920

Query: 1177 HKVKEF---MEQKLQTSKNNDPSCSEA-EALDNVLGLIENTMKTLE 1302
             +++E+    E   Q+ +  +    E+ EA  N +  + +    LE
Sbjct: 921  SQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLE 966

 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 63/312 (20%), Positives = 136/312 (43%), Gaps = 25/312 (8%)
 Frame = +1

Query: 385  KHISIS-SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQ---LEKKDLNEK 552
            KH  +S +IS+L +   T    +   T  ++E E      +  +  ++   LE+ DL+  
Sbjct: 1049 KHADVSKTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNS 1108

Query: 553  SLQ-------MAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLE 711
             ++       +  + +   T       D R+       +   ++   ++ D K+++   +
Sbjct: 1109 RIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERD 1168

Query: 712  QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
             ++L +K    I   D  +LQ+   +L +   +  D+ S  ++Q +  ++KL N++  L 
Sbjct: 1169 AKMLRQK----ITLMDV-ELQDARTKLNNSRVE-NDERSSIVQQHDVIMEKL-NQLNLLR 1221

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIY-------IEKYMSHVKQEYNKKEDECNRLKFVVD 1050
              N  L+ +    S+K K+   + +        IE  +S +K    +KE E    K  V 
Sbjct: 1222 ESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVH 1281

Query: 1051 KNMKKI-DHLERSLQAQTNAQNSFSA------VTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
            +  K+  D LE+  Q  +N      +        ++D+ Q+    E+R+++++   ++KL
Sbjct: 1282 RWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKL 1341

Query: 1210 QTSKNNDPSCSE 1245
            +TSK    + +E
Sbjct: 1342 KTSKLTQETLTE 1353

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 46/198 (23%), Positives = 86/198 (43%), Gaps = 31/198 (15%)
 Frame = +1

Query: 529  EKKDL--NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISIN 702
            EKK++  N++     +D  LK  +    +V+      E   L+S + E+E  +   I+ +
Sbjct: 133  EKKEIQSNQQRTLKILDERLKEVEM--AKVENNRTNNECRNLRSTVVELETKQQTYITND 190

Query: 703  SLEQQLLEEKTAN-NILRRD--------------YYKLQERG-----------KRLCHEF 804
               +  LE KT   N+L+ +              Y   ++R             RL ++F
Sbjct: 191  LNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDF 250

Query: 805  QDLQDDYSKKMKQKEYEVQK-LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY 981
            Q L+   +  +KQK  E+   L+ +V  L N++ +L  +K +FS +     +    +E  
Sbjct: 251  Q-LEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQ 309

Query: 982  MSHVKQEYN--KKEDECN 1029
            ++ VK+E    +K D  N
Sbjct: 310  LNAVKEELKSIRKSDSSN 327

>KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {ON}
            similar to uniprot|Q12234 YOR216C Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 462

 Score = 51.6 bits (122), Expect = 3e-06
 Identities = 47/223 (21%), Positives = 101/223 (45%)
 Frame = +1

Query: 670  EEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKE 849
            EE +  ++  N+L  ++   KT  + +++   +L+   ++L +E+++   +  +K+K  +
Sbjct: 110  EERDQYELKYNTLLSKISSMKTVFSQMKQAQQELENTREQL-NEYENQNINLKQKLKSAD 168

Query: 850  YEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECN 1029
             E+Q+ K  +  L +   NL  +    S +  ++  K   I++  S + +  N++ +  +
Sbjct: 169  SEIQEDKQTISILNDEIVNLNKECENLSNECSEFKSK---IKELESKLNEASNEESNITS 225

Query: 1030 RLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
             LK  V     +ID+LE               + + +E Q    LE++    K+ +EQ  
Sbjct: 226  CLKSEVKSLKSQIDNLE---------------IIINNEAQDKRDLEEQIADYKQQLEQSD 270

Query: 1210 QTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
            +T K           LDN++  +E   K +  N+    T TK+
Sbjct: 271  ETKKQ----------LDNIMSNLE---KQINDNNTTIETLTKQ 300

 Score = 39.7 bits (91), Expect = 0.015
 Identities = 41/181 (22%), Positives = 71/181 (39%)
 Frame = +1

Query: 400 SSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHL 579
           S +  L    + L + I +E   K + E          Y +QLE+ D  +K L   + +L
Sbjct: 229 SEVKSLKSQIDNLEIIINNEAQDKRDLEEQ-----IADYKQQLEQSDETKKQLDNIMSNL 283

Query: 580 LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRD 759
            K    N   ++   K   TEV   F +EI ++  N            E+ T  N LR  
Sbjct: 284 EKQINDNNTTIETLTKQRTTEV-NQFTEEIAQLTKNN----------EEKATEINSLRAK 332

Query: 760 YYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
              + E           L++ + +++K++  ++ KL++E   L    T   A   Q +  
Sbjct: 333 VASMSED--------VALKEKFEREVKERVLQIGKLRHEAIILNEHLTKALAMLKQNNDS 384

Query: 940 E 942
           E
Sbjct: 385 E 385

>NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.414
            YDR356W
          Length = 962

 Score = 52.0 bits (123), Expect = 3e-06
 Identities = 84/383 (21%), Positives = 154/383 (40%), Gaps = 23/383 (6%)
 Frame = +1

Query: 313  TRDDTFKEVNDAVNRCYALCNI--PTKHISISSISDLAQTFETLAVGITHETNRKAECER 486
            T++ T  E+   ++   +  N+   TK      IS L    E     I    N+ +E E+
Sbjct: 280  TKETTLNELKKQIDSLLSELNVGGETKLAYDDKISSLRIDTERQEKEIKELKNKCSEWEK 339

Query: 487  --------SKNAIDSLYYHE-QLE--KKDLNEKSLQMAI-------DHLLKVTKQNQRQV 612
                    SKN  D L   E QLE  KK+++EK             D+L  +  Q ++ +
Sbjct: 340  LNTDLEMKSKNLNDDLRDIEMQLEQSKKEMHEKLSSRERQFQNEHDDNLELINLQKKQII 399

Query: 613  DGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL--RRDYYKLQE-RG 783
            D   KL +     S + E+E+    K S+N   ++  EE++ N  L  R D  + +E +G
Sbjct: 400  DLETKLTKLSEDASNVDELEKT--TKESLNEYRKKYEEERSKNRDLTNRLDLMEAREAKG 457

Query: 784  KRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
                 +++ +Q D              L++ +K L  +NT+L       ++K +  S++ 
Sbjct: 458  SNWKTQYEHIQKDNLD-----------LQSSLKTLNVLNTDL-------TKKLRDLSKRL 499

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
              +E     + +E NK  D    L    +++  +I  LE  L +  N          +  
Sbjct: 500  NELEIVNDRLTEERNKLSDTVTSLNNKSEESELQITKLEEELDSIKNDHKEEILKFNEQL 559

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
            +QK + L    +++K   +Q     KN+  S +  +AL      I+     L+  +    
Sbjct: 560  EQKTSELTKATNQIKTLQKQLFDNIKNSTESKTSEDALQKRYKQIKKLQTELDDVTLKLQ 619

Query: 1324 TTTKKCLKYVTGSSRLKENEHIT 1392
               +   K +    R  +N++ T
Sbjct: 620  LEEENHRKILNSKIRELDNKYST 642

>NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.636
            YOR216C
          Length = 518

 Score = 51.6 bits (122), Expect = 3e-06
 Identities = 76/356 (21%), Positives = 141/356 (39%), Gaps = 44/356 (12%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAI-DHLLKVTKQNQRQ----VDGR 621
            E  +  E    +N+ DS    EQ+EK       L+  + D   K+ K +       VD  
Sbjct: 86   EDTKTRENNDIRNSFDSSEKDEQIEKLQTEMADLKKELKDTQEKLAKSSSTSSSPSVDEM 145

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHE 801
            +K EE +  +   K  EE +  +   NSL  ++   K   N       K++E  + L   
Sbjct: 146  EKSEENDKNEELEKLKEERDHFESQYNSLLNRISSMKNVFN-------KMKESQRDL--- 195

Query: 802  FQDLQDDYSKKMKQKEYEVQ--KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE 975
             + +QD  +      EYE Q  KLKN+V+ +T   T L       +++      KY  +E
Sbjct: 196  -EIVQDQVA------EYESQNLKLKNKVELITKEKTELATTMVTLNKELSSLEDKYEALE 248

Query: 976  -KYMSHVKQ--EYNKKEDE----------------------CNRLKFVVDKNMKKI---- 1068
             K M + KQ  ++ ++E E                         L  ++D N + I    
Sbjct: 249  NKSMKYEKQLKDFKRQEKENSNTYTHQLEGYRKEKELLDTQLQELLIILDNNKQDIVNLK 308

Query: 1069 ---DHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSC 1239
               + ++++L A  N + +F     Q   + +    D    ++E  ++    S   + S 
Sbjct: 309  DEKEEMKQALHASENEKTAFEESLQQLSSKLEEQENDYAQSLREKAQEIKALSVQLESSA 368

Query: 1240 SEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKE-----NEHIT 1392
             + +AL   L  +++ +++L+ NS       ++  +      +L+      NEH+T
Sbjct: 369  DKNKALQTELQSLKDDIQSLKENSSLKDKLEQETKEQALQIGKLRHESIVLNEHLT 424

>NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1.110
            YNL250W
          Length = 1304

 Score = 52.0 bits (123), Expect = 3e-06
 Identities = 77/330 (23%), Positives = 128/330 (38%), Gaps = 5/330 (1%)
 Frame = +1

Query: 328  FKEVNDAVNRCYALCNIPT-KHISISSISDLAQTFETLAVGITHETNRKAECERSKNAID 504
            F E+  A+    A+ N+   K      I  L Q+ E L V        K    + +  ID
Sbjct: 175  FDEIFQAMKFTKAIDNLKAIKKDMTVDIKLLKQSVEHLRVDRDRSRGTKMNIVQLQAQID 234

Query: 505  SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVED 684
                  Q++ KD+ E  LQ   +   K+ K NQ       K++   +L   +KE  E   
Sbjct: 235  EY----QMKVKDV-EIELQKITEQSDKLFKSNQEFQQVLSKIQNLRMLDKHLKEEIENVS 289

Query: 685  NKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK 864
            N + + SL +Q LEE  AN                    F    D+  +++K+ E E+  
Sbjct: 290  NSVELISLPKQELEELLAN--------------------FSKSFDENEQEVKKIEVEIDI 329

Query: 865  LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFV 1044
            LK +     +  T L     +   +E+ Y +  I +E         YN        L +V
Sbjct: 330  LKRDANQSQSKYTGLVRKMGELQAREEAYKKNVITLESLSMAFSDRYN--------LGYV 381

Query: 1045 VDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKV---KEFMEQKLQT 1215
             +K     +  E+S +   +   SFS    +  ++  + LE+   ++   +    Q+L+ 
Sbjct: 382  GNKPQ---EFFEKSKKFNDDLNTSFSNFEKESRNRLKS-LENELSEITNSETIQNQRLEY 437

Query: 1216 SKNNDPSCS-EAEALDNVLGLIENTMKTLE 1302
            SK +    S E E L + L + E T   LE
Sbjct: 438  SKADQQKISAEIEKLTSELTINEFTHSDLE 467

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 52.0 bits (123), Expect = 3e-06
 Identities = 75/290 (25%), Positives = 119/290 (41%), Gaps = 18/290 (6%)
 Frame = +1

Query: 448  ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMA-------IDHLLKVTKQNQR 606
            I H     AE E     I   Y  ++LE K   EKSL  +       I++L K  ++   
Sbjct: 1479 IDHSNKLLAEKEAE---IKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYE 1535

Query: 607  QVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGK 786
            Q   +   E  E+L+  I+   E + NKI I + +++L EE  A         KLQ+R  
Sbjct: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKI-IENRKRELDEEFEA---------KLQQRTS 1585

Query: 787  RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNL-KADKTQFSQKEKQYSQKY 963
             L  E + L   +++ MK+ + EV+KLK ++K    M+  + +A K  F + ++Q S K 
Sbjct: 1586 ELAGE-KPLPATFTEVMKRHKQEVEKLKADMK--REMDEEVAQAKKKAFDEGKQQASMKS 1642

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            +++EK                            KI  LE   +A     +     TV   
Sbjct: 1643 MFLEK----------------------------KIAKLEAQAKAAAEKPDD---TTVNSP 1671

Query: 1144 DQKD----------AHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDN 1263
            D+K           +H ED+ H  +E  E     + +  P  S  E +DN
Sbjct: 1672 DRKQLDKPSPIAEISHQEDKTHIAEELAEGPRPITTSPIPPSSSGELIDN 1721

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 55/264 (20%), Positives = 106/264 (40%), Gaps = 1/264 (0%)
 Frame = +1

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ 774
            + QR ++  D L          K++ E   N ++      QLL EK        D   LQ
Sbjct: 109  ERQRSINDSDTLRARNEALEQQKQVLEANKNDVA------QLLNEKIG------DIATLQ 156

Query: 775  ERGKRLCHEFQDL-QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY 951
            +  +RL  E + L Q +   + + + Y+ ++LK+            KAD  Q SQK    
Sbjct: 157  QETERLLQEARTLRQQNLELEGQARVYKSEELKH------------KADFHQLSQKVSLL 204

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVT 1131
            +    ++E  ++    E+N       R +  +    ++++  E  LQA T    +     
Sbjct: 205  NTNNEWLESQLNQKNSEFNAYRQ---RTQSELASVSQRLETCEGDLQAATKTIKTLR--- 258

Query: 1132 VQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
             +   QK++ LE ++  VK+  ++ L ++K       E      ++ L+E  +  L+   
Sbjct: 259  -EQNGQKESELEGQFQAVKKLTDE-LTSAKQE--FTREMSLKQRLVELLEGQVSALKSEL 314

Query: 1312 KYYSTTTKKCLKYVTGSSRLKENE 1383
            ++ ++         T S    E+E
Sbjct: 315  EFKNSPQASTDAATTESQSQIEDE 338

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 51/258 (19%), Positives = 112/258 (43%), Gaps = 23/258 (8%)
 Frame = +1

Query: 580  LKVTKQNQRQVDGRDKLEETE----VLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
            L++ K+++  +  + KLE TE    V KS I++ +   D +  +     ++LE+    N+
Sbjct: 1162 LELAKRDESNL--KQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNL 1219

Query: 748  LRRDYYKLQERGKRLCHEFQDLQ---DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD 918
            LR     L+   +R     QDL+   ++  + +K  E ++  L+  V       + +  +
Sbjct: 1220 LRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEE 1279

Query: 919  KTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE------ 1080
              ++ Q+ +    KY  ++       +E+ K  +E ++ +     N ++   LE      
Sbjct: 1280 VNRWKQRSQDILLKYERVD------PEEHKKLAEELSQARAEAAANAQQRSELEDRFQRL 1333

Query: 1081 -----RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE---FMEQKLQTSKNNDPS 1236
                   L      QN+ +A   +  + + A LED   K +E    +++ ++ ++ N+  
Sbjct: 1334 KKQARERLDNARTTQNTLNAELTEARESQKA-LEDALDKEREKTRSLQESIKATEENEIE 1392

Query: 1237 CSEA--EALDNVLGLIEN 1284
             S A  + L + L  +E+
Sbjct: 1393 NSSATRDQLQDALQKLED 1410

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 64/325 (19%), Positives = 134/325 (41%), Gaps = 15/325 (4%)
 Frame = +1

Query: 394  SISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEK--KDLNEKSLQ-- 561
            +I ++ D  Q  ET    IT E +       +  AI S   HE      +D+N K+ +  
Sbjct: 582  AIVTLQDHIQELETRIDVITRERD-------AYKAIQSQTSHEGSNGGLRDVNAKASENS 634

Query: 562  -MAIDHLLKVTKQNQRQVDGRDKL---EETEVLKSFIKEIEEVEDNKISINSLEQQLLEE 729
             + I  L ++    +R+ +   KL   E  E+ +S  + +  VE  K S    E++L   
Sbjct: 635  DLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKIS 694

Query: 730  KTANNILRRDYYKLQERG----KRLCHEFQDLQDDYSKKMKQKEYEVQ---KLKNEVKFL 888
            K++  + +++  +L +RG      L  +    Q+  S+ +  K        +LKN +   
Sbjct: 695  KSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKE 754

Query: 889  TNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKI 1068
              +NT+ +  K    Q  K+ ++  I + +  +  K+     +D  +  K  +D    +I
Sbjct: 755  NLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEI 814

Query: 1069 DHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA 1248
              L   L  +    + F + +    D +    +++   + E ++    T+ + +      
Sbjct: 815  SQLRTLLSQKATELSDFMSTS----DSRSRWYQEKIDALNECLK---STTSDLNSKTQMI 867

Query: 1249 EALDNVLGLIENTMKTLEGNSKYYS 1323
            + L +   L+ + ++  E  S+ YS
Sbjct: 868  QELQSQQSLLTSKLRDAETKSQSYS 892

 Score = 36.2 bits (82), Expect = 0.24
 Identities = 70/330 (21%), Positives = 127/330 (38%), Gaps = 41/330 (12%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHL---LKVTKQNQR--QVDGRDKLEETEVLKS 654
            K   D L    +L K+D  E +L+  ++     L V K   R  QV    +    E    
Sbjct: 1152 KRECDILQTKLELAKRD--ESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSK 1209

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK 834
             ++++ +V   + S  +L  +L  +   N  L R+  +LQE  K L ++   LQ     K
Sbjct: 1210 ILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAK 1269

Query: 835  MKQKEY---EVQKLKN---------------EVKFLTNMNTNLKADKTQFSQKEKQYSQK 960
             KQ      EV + K                E K L    +  +A+    +Q+  +   +
Sbjct: 1270 DKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDR 1329

Query: 961  YIYIEKY-----------MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA 1107
            +  ++K             + +  E  +  +    L+  +DK  +K   L+ S++A    
Sbjct: 1330 FQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEEN 1389

Query: 1108 QNSFSAVT---VQDEDQKDAHLEDRYHKVKEFM---EQKLQTSKNN-DPSCSEAEALDNV 1266
            +   S+ T   +QD  QK   LED   ++ E      Q+ QT +   + +    + L+  
Sbjct: 1390 EIENSSATRDQLQDALQK---LEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEH 1446

Query: 1267 LGLIENTMKTLEGNSKYYSTTTKKCLKYVT 1356
            L   +N ++ LE      S T  +  +  T
Sbjct: 1447 LAKTQNEVRVLEEAKNQVSGTEAEIARVKT 1476

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 54/223 (24%), Positives = 97/223 (43%), Gaps = 12/223 (5%)
 Frame = +1

Query: 670  EEVEDNKISINSLEQQLLEE--KTANNILRRDYY--KLQERGKRLCHEFQDLQD--DYSK 831
            EEV+ NK ++ S++ Q   E  K   ++ ++  Y  K QE  +      Q+LQ   D SK
Sbjct: 1004 EEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYE------QELQRHADVSK 1057

Query: 832  KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
             + Q   E QK KN+V  L    T LK  K+    +    +QK    ++Y +       +
Sbjct: 1058 TISQLREEAQKHKNKVHSLEASITELK--KSLEENESCWAAQK----QEYETQASLSSQR 1111

Query: 1012 KEDECNRLKFVVDK-NMKKIDHLERSLQAQTNAQNSFSAV-----TVQDEDQKDAHLEDR 1173
             ED   + + + D+ ++K  D +  + + ++ A+   S +      +Q + +     E  
Sbjct: 1112 IEDLSTQNRLLFDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESN 1171

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
              +  EF EQ+L  +K+            ++  +IE   K LE
Sbjct: 1172 LKQKLEFTEQELSVAKSEIRKSQVTSDTRSI--MIEENSKILE 1212

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 47/241 (19%), Positives = 94/241 (39%), Gaps = 1/241 (0%)
 Frame = +1

Query: 505  SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-RDKLEETEVLKSFIKEIEEVE 681
            S +Y E+++  +   KS    ++   ++ ++ Q Q      KL + E        + + +
Sbjct: 839  SRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTD 898

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
            D     ++L  +L  EKT  N+  +D +   +  K L   +   ++  +      E+  Q
Sbjct: 899  DVLTQTDALRSEL--EKTRINL--KDAFSQVDEYKGL---YASTKETLTAMTTALEHSKQ 951

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
                EV+ L      L  D      +    + +  Y +  +  +K E+NK E+E    K 
Sbjct: 952  DHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKT 1011

Query: 1042 VVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK 1221
             +  +MK    LE S   +   Q +  A   Q+  +++        K    + ++ Q  K
Sbjct: 1012 AL-ASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHK 1070

Query: 1222 N 1224
            N
Sbjct: 1071 N 1071

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 52.0 bits (123), Expect = 3e-06
 Identities = 67/341 (19%), Positives = 137/341 (40%), Gaps = 8/341 (2%)
 Frame = +1

Query: 325  TFKEVNDAVNRCYALCNI--PTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNA 498
            +F+   +  NRC AL        H + +SI  L    +T++      +   A  +   + 
Sbjct: 698  SFEAFEELQNRCIALKEELETLHHDNKASIDSLQNQLKTISGEYEDSSTELASLKTEHSL 757

Query: 499  IDSLYYHEQLEKKDLNE--KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIE 672
            +   Y   ++E  D+    K +    D L  + K+N+ +++  +     E+LK + ++++
Sbjct: 758  LSDKYDTIKVELSDMTTSLKQITEERDTLDALKKENENKIEKNE-----ELLKEYKEKLQ 812

Query: 673  EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHE----FQDLQDDYSKKMK 840
             +E    +I  L +Q  EE    N + R+ + L    + L        +DLQ   +   K
Sbjct: 813  NIETQLQTI-ILAKQKAEEGV--NKMNRELFALSREKQELEGNQKIALKDLQKKTAVLEK 869

Query: 841  QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED 1020
            +K     KL  + K +T +N  L   +      E + ++K   +E++ S  +   N    
Sbjct: 870  EKRQLSDKLNEKEKDITRLNEELATLENTVKSLESEKNEKRKEVEEWKSKFQNHDN---- 925

Query: 1021 ECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFME 1200
                   +V K   K+  L  S +     ++S      + E    +H  +  + +K+  E
Sbjct: 926  -------LVPKLTDKLKSLATSFKELEKERDSLQEQLTELESANLSHETELKNNIKQMTE 978

Query: 1201 QKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
              +  +  N    S+   + N+   I+N  K+ +  S  +S
Sbjct: 979  NNVTLTTENKGLISK---ISNLELTIDNLKKSNDAKSAQFS 1016

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 76/359 (21%), Positives = 145/359 (40%), Gaps = 45/359 (12%)
 Frame = +1

Query: 397  ISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYH--EQLEK----KDLNEKSL 558
            IS IS+L  T + L         + A+    KN ++    H  EQL +    K++NE+ +
Sbjct: 991  ISKISNLELTIDNLKKS---NDAKSAQFSDDKNELEESIMHLNEQLNEIEAEKEINERKV 1047

Query: 559  QMAIDHLLKVTKQNQRQVD------------------GRDKLEETEVLKSFIKEIEEVED 684
                  L  V  +  + +D                   + KL E+E  K  + ++ E   
Sbjct: 1048 NDLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELSKLLENSK 1107

Query: 685  NKI--SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            N +  S N LE+  L+  T    L + Y  L++ G+     F D  D+   ++++KE + 
Sbjct: 1108 NAMIDSNNKLEESTLKYDT----LLKKYDSLEKNGQANEKSFHDQVDELKLQLQEKELQY 1163

Query: 859  QKLKNEV----KFLTNMNTNLK---ADKTQFSQKEKQYSQKYIYIE-------KYMSHVK 996
              L+  +    K + ++ T L+   A+K +        S++ + +E       + +  V+
Sbjct: 1164 TTLETSIEEKEKNIQSIQTQLESLAAEKERIQGIANTSSEEVVSLENRIKDLNEQLDSVR 1223

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQ---KDAHLE 1167
            + Y K + E N+     +++   +   E  L       ++ ++  V+ E Q       L+
Sbjct: 1224 ELYEKSKQELNKKN---EEHQSMLAKYESDLADSLAKADTATSTNVELESQIKVMKNELD 1280

Query: 1168 DRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIE--NTMKTLEGNSKYYSTTTKK 1338
                K  E +E   +  KN +  C E+   D V+   E   + K L+   + +S   KK
Sbjct: 1281 LNKEKHTEALEILKKEIKNIEEEC-ESTKSDTVVAKNEFAKSQKELKKLQESFSINEKK 1338

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8.604
            YOR195W
          Length = 804

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 51/244 (20%), Positives = 112/244 (45%), Gaps = 17/244 (6%)
 Frame = +1

Query: 412  DLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEK------------- 552
            DL +  E L + +   +N   + E   + I+     + LE K++NEK             
Sbjct: 424  DLQKLQEQLDLKLKELSNNSLKLEELNDLIE----RKDLEIKEINEKYQGTINLNEGKHD 479

Query: 553  SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEK 732
             L   ++ L+    + + Q+D +DK +  E+++   KE+ ++E++K   NS E Q++E +
Sbjct: 480  DLVKQVEELIMKRIELETQLDQQDK-DTKEIIEQIKKELNKMEEDK---NSKEYQIIEFE 535

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
               + L+       +   +L   +  + D++    + K  EV +L  E+K L +   NLK
Sbjct: 536  KKIDELQGKINNQNDELLKLKESYDKINDNF----EIKNAEVIQLNEEIKELRSNEINLK 591

Query: 913  A----DKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
                 D+   +  + +Y    I  EK +    + ++ K +E N      + ++K+++++ 
Sbjct: 592  EKISNDEKNSNDWKAKYESSKIENEKILIEKSENHSMKINELN------EDHLKELENIH 645

Query: 1081 RSLQ 1092
             +++
Sbjct: 646  ETMK 649

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 60/319 (18%), Positives = 138/319 (43%), Gaps = 32/319 (10%)
 Frame = +1

Query: 424  TFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQ 603
            TFE   +      N  +     +N+   L   E  E ++L +++ ++  D L  + KQ  
Sbjct: 238  TFELQKLTPIRNANHNSINNEEQNSFMKLIEAEHREYQELIQRNEEIT-DRLHCLDKQYN 296

Query: 604  RQVDGRD---------KLEETEVLKSFIKEI----EEVEDNKISINSL-------EQQLL 723
            + +   +         K +   + K F  +I    +E+E+ KI +  L       +++LL
Sbjct: 297  QLLSKHEQTNYQYQIIKNKNDTINKKFDNKILQLNKEIENYKIKVEKLNNKLQTNKKRLL 356

Query: 724  EEKTANNILRRDYYKLQERGKRLCHEFQDLQD----------DYSKKMKQKEYEVQKLKN 873
            E +    +L ++   LQE+  +  HE  +L++          +   K+K K+ E     N
Sbjct: 357  ETRDEVKMLNQNQSILQEKFDKQSHEILELRNIDDSKEKYKFELENKLKVKDDENLSKTN 416

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
            E+  LT+   +L+  + Q   K K+ S   + +E+    ++++  + ++   + +  ++ 
Sbjct: 417  EINLLTD---DLQKLQEQLDLKLKELSNNSLKLEELNDLIERKDLEIKEINEKYQGTINL 473

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDE-DQKDAHLEDRYHKVKEFMEQKLQTSKNND 1230
            N  K D L + ++     +     + ++ + DQ+D   ++   ++K+ + +  +   + +
Sbjct: 474  NEGKHDDLVKQVE-----ELIMKRIELETQLDQQDKDTKEIIEQIKKELNKMEEDKNSKE 528

Query: 1231 PSCSEAE-ALDNVLGLIEN 1284
                E E  +D + G I N
Sbjct: 529  YQIIEFEKKIDELQGKINN 547

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 66/272 (24%), Positives = 122/272 (44%), Gaps = 19/272 (6%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL 723
            N   LQ ++ ++ +  ++  +Q++ R + E + + +  I+  E+V  N   I   E ++ 
Sbjct: 1179 NNAILQKSLKNVTEKNREIYKQLNDRQE-EISRLQRDLIQTKEQVSINSNKILVYESEME 1237

Query: 724  EEKTANNILRRDYYKLQERG-KRLCHEFQDL--------------QDDYSKKMKQKEYEV 858
            + K     L +     Q++  ++L +E  DL              ++ +++  KQ   ++
Sbjct: 1238 QCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKL 1297

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE-KYMSHVKQEYNKKEDECNRL 1035
               K +   LTN    LKA K +  Q     + K I ++ K  +H  Q  +   D     
Sbjct: 1298 DASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRD---HE 1354

Query: 1036 KFVVDKNMKKIDHLERSLQAQTNAQNS---FSAVTVQDEDQKDAHLEDRYHKVKEFMEQK 1206
            K      M++I+ L++ LQ    A +S   F  + V  E +KD  +++R    KEF E+K
Sbjct: 1355 KDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDER---TKEF-EKK 1410

Query: 1207 LQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            LQ + N   S SEAE   ++  L +  +K  E
Sbjct: 1411 LQETLNKSTS-SEAEYSKDIETLKKEWLKEYE 1441

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 72/346 (20%), Positives = 138/346 (39%), Gaps = 12/346 (3%)
 Frame = +1

Query: 310  ETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERS 489
            +  + T KE  DA+             I + +I+   +T   + +         A  E +
Sbjct: 553  KVENQTIKEAKDAI-------------IELENINAKMETRINILLRERDSYKLLASTEEN 599

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMA---------IDHLLK-VTKQNQRQVDGRDKLEET 639
            K   +S+   E   +K + E   +++         I +L K +    + Q   +  LE+ 
Sbjct: 600  KANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDF 659

Query: 640  EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQD 819
            E  K   KE E + +   +I+ L+ +L ++K+        Y  +++  +R   E    + 
Sbjct: 660  ENFKGLAKEKERMLEE--AIDHLKAELEKQKS----WVPSYIHVEK--ERASTELSQSRI 711

Query: 820  DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 999
                K+K  EYE+ KLK E         +L  D  Q  +++K+   +    E   +  K 
Sbjct: 712  ----KIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKM 767

Query: 1000 EYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH--LEDR 1173
            +++ KE +       ++ N++++    RS   Q+  Q   S  + +D   K A   ++D 
Sbjct: 768  DFSSKEGQYKAKIKELENNLERL----RS-DLQSKIQEIESIRSCKDSQLKWAQNTIDDT 822

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
              K+K  + +        +   SE E LD  L   +   K L+ NS
Sbjct: 823  EMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNS 868

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 72/330 (21%), Positives = 126/330 (38%), Gaps = 41/330 (12%)
 Frame = +1

Query: 427  FETLAVGITHETNRK-----AECERSKNAIDSL----------YYH----------EQLE 531
            FE+L  G+T+   RK     A+ ERS+  +  L          YY           E  E
Sbjct: 13   FESLQ-GVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLDESSE 71

Query: 532  KKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK--------LEETEVLKSFIKEIEEVEDN 687
            +K+  ++ L    D L +   + +R++D   K        + E    K   +E +  +  
Sbjct: 72   QKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQSR 131

Query: 688  KISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKL 867
                +SL   L +E   N +LRR   +++   +R       LQ  Y   +++KE  +Q  
Sbjct: 132  DQGNDSLNDDLNKE---NKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSK 188

Query: 868  KN-EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFV 1044
            K  E K  +     L  + T+ S  E    + Y     Y S     YNK         F+
Sbjct: 189  KLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFT--YNK---------FL 237

Query: 1045 VDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS-- 1218
            +++N +    +E  +    N +++ S      E  K+  L+   + +       L+    
Sbjct: 238  LNQNKQLSQSVEEKVLEMKNLKDTASVEKA--EFSKEMTLQKNMNDLLRSQLTSLEKDCS 295

Query: 1219 -----KNNDPSCSEAEALDNVLGLIENTMK 1293
                 KN+D SC   E  D +  LI+  ++
Sbjct: 296  LRAIEKNDDNSCRNPEHTDVIDELIDTKLR 325

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 61/277 (22%), Positives = 116/277 (41%), Gaps = 18/277 (6%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS 696
            +E  E+K +N K +    D L +   ++ R++D  +K  +       IK++E+ E  K  
Sbjct: 67   NESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNK--QLNASHETIKKLEDEEGAKEE 124

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ-------DLQDDYSKKMKQKEYE 855
             +S +  L  + +  ++L ++   LQ +   + +  Q        LQ  Y    ++KE  
Sbjct: 125  ASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQEKELW 184

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
            +Q  K   + L++ N     D+            K  Y++     + Q   + E      
Sbjct: 185  LQNKKWTEERLSSCNQKALVDEVT----------KTSYLQNLEEKLNQTQTENESVSTYN 234

Query: 1036 KFVVDKNMKKIDHL-ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ 1212
            KF++D+N KK+ HL E  L    N ++  +A T + E  K+  L+    K+ + +  +L 
Sbjct: 235  KFLLDQN-KKLSHLVEEKLLEIKNLKD--TANTEKSEFSKEMTLQ---KKMNDLLRSQLT 288

Query: 1213 T----------SKNNDPSCSEAEALDNVLGLIENTMK 1293
            +           K +D  C   E +D    LI+  +K
Sbjct: 289  SFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLK 325

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 70/283 (24%), Positives = 120/283 (42%), Gaps = 10/283 (3%)
 Frame = +1

Query: 484  RSKNAIDSLYYHEQLEKKDLNEKSL---QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS 654
            R  NAI         EK +   K L   Q  I  L     Q + QV     +   +VL +
Sbjct: 1178 RENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVS----INANKVL-A 1232

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK 834
            +  EIE+ +     ++  +QQ L  K     L      L+ +   + +   DL++ +++ 
Sbjct: 1233 YESEIEQCKQRYQDLS--QQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRL 1290

Query: 835  MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE-KYMSHVKQ--EY 1005
             KQ   ++   K +   LTN    LK  K +  +       K + +E K   H  Q  E 
Sbjct: 1291 KKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEV 1350

Query: 1006 NKKEDECNRLKFVVDKNMKKIDHLERSLQAQTN---AQNSFSAVTVQDEDQKDAHLEDRY 1176
            +K  D      FV     ++I+ L++ LQ   N   A ++F  +    E++K+  +++  
Sbjct: 1351 SKDHDSIAFKPFV-----EEIESLKKELQVFRNANDASDAFEKIKNNMEEEKNKIIDE-- 1403

Query: 1177 HKVKEFMEQKLQTSKNNDPSC-SEAEALDNVLGLIENTMKTLE 1302
             K K+F E+KLQ + N   S  SE E  +++  L +  +K  E
Sbjct: 1404 -KTKDF-EKKLQDAVNKSKSNESEVENSEHIEALKKEWLKEYE 1444

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 55/271 (20%), Positives = 110/271 (40%), Gaps = 35/271 (12%)
 Frame = +1

Query: 607  QVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYY------- 765
            Q DG+  L+E E  K  + E E +   +I  N L+ QL +++ +     +DY        
Sbjct: 649  QTDGKIALQEFENFKVLVAEKEAMLQERI--NHLKTQLEKQRLSAAPPVQDYKYSNLTDL 706

Query: 766  -KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ----- 927
               + +   L +E  +L+ + +  +  KE   + L+   K    ++  L   +T      
Sbjct: 707  SHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQN 766

Query: 928  --FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK----KIDHLERSL 1089
              F  KE QYS +   +EK +  +      KE E   L+   +  +K     ID  E++L
Sbjct: 767  LIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNL 826

Query: 1090 QA----QTNAQNSFSAVTVQDEDQKD------------AHLEDRYHKVKEFMEQKLQTSK 1221
            ++     +N + +   ++++ E+  +            ++  D         ++  QT  
Sbjct: 827  KSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQI 886

Query: 1222 NNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
                + S+ +A + ++   EN +K L G  K
Sbjct: 887  ELKDAHSQIKAYEEIISTNENVLKELNGELK 917

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 41/208 (19%), Positives = 99/208 (47%), Gaps = 9/208 (4%)
 Frame = +1

Query: 538  DLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQ 717
            +L  KS  + ++  + + ++N   +  +   +  ++ +     I E++D+++ ++++E +
Sbjct: 176  ELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESE 235

Query: 718  LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY-------SKKMKQKEYEVQKLKNE 876
            L   +T+N  L++  + L E+ ++   E ++++D+Y       +K+M  K+  +  L+  
Sbjct: 236  LEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKH 295

Query: 877  VKFLTNM--NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
            ++ L      T    D + F++KE+        + + ++ VK   +  E  C +LK  +D
Sbjct: 296  MESLKKEMDATKNNMDSSYFTEKERD------ELIEELNAVKYRLDASESNCIKLKETID 349

Query: 1051 KNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
            +    I  LE S    T A +  S   +
Sbjct: 350  ELTSNI-KLEDSEVGNTTASSEKSVSVI 376

 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 64/280 (22%), Positives = 124/280 (44%), Gaps = 50/280 (17%)
 Frame = +1

Query: 613  DGRDKLEETEV-LKSFIKEIEEVEDNKISINS-LEQQLLE-------EKTANNILRRDYY 765
            D  DK+++ E  L + I+E E       S NS L ++L E       EKT+  +      
Sbjct: 629  DNDDKVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLN 688

Query: 766  KLQ---ERGKRLCHEFQ----DLQDDYSKKMKQK-----------------EYEVQKLKN 873
             LQ   E  KR C E Q    DLQD  +K+ K+                  + E+  LK+
Sbjct: 689  LLQSTLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKS 748

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH----VKQEYNKKEDECNRLKF 1041
            E +F+  +   LKA+  +FS++  +Y      ++         +K+  N  +++  +L+ 
Sbjct: 749  EKQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEI 808

Query: 1042 VVDKNMKKIDHLERSLQA-QTNAQNSFSAVTVQ-DEDQKDAHLEDRYHKVKEFMEQKLQT 1215
             +  ++++++ +E++     +N ++ ++    + D+   +A  +    + KE   QK+Q+
Sbjct: 809  ELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQS 868

Query: 1216 SKNNDPS-CSEAEA----------LDNVLGLIENTMKTLE 1302
            + N   +   EAEA          +D+   L+E   + LE
Sbjct: 869  TINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELE 908

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 69/310 (22%), Positives = 132/310 (42%), Gaps = 42/310 (13%)
 Frame = +1

Query: 466  RKAECERSKNAIDSLYYHEQLEKKDLNE--KSLQMAIDH----LLKVTKQNQRQVDGRDK 627
            +++E E  +N +  L    +L++K+L+E  KSL  A +      +++ K      D ++K
Sbjct: 1368 QESEYELLENRLKMLEEDVKLKEKELSEHKKSLLEAQEQEKSSTIELAKLKSAAADEKNK 1427

Query: 628  LEE---------------------------TEVLKSFIKEIEEVEDNKISINSLEQQLLE 726
            LEE                           + + K + +++ E+ED   ++NS  Q  LE
Sbjct: 1428 LEEEIKSCKVELKNKAQAFEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQSKLE 1487

Query: 727  E--KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
            E      N++  +  K  E+ K+       L++  SK+ K    ++  L +EV+      
Sbjct: 1488 ELDSLKTNMIELE-NKNSEQLKKEKASIVILEETISKQKK----DIDNLHSEVEDSQEKC 1542

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
             N+  D T+  ++ +  S+ Y    K M    +E N +          ++K+ K I+ LE
Sbjct: 1543 KNINKDLTKKLREMQSASETYDSNLKRMEETIEEKNVE----------IEKSSKSIEELE 1592

Query: 1081 RSLQAQ----TNAQNSFSAVTVQDE---DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSC 1239
            + L +Q     + QN  + V  +++   D+K + + +   K +   E+    SK+ D   
Sbjct: 1593 KELGSQQLKLKDLQNENTEVIKKNKDILDEKISEIGNLKEKNESLSEENETLSKSADQLK 1652

Query: 1240 SEAEALDNVL 1269
            SE    D  L
Sbjct: 1653 SEVSKRDEAL 1662

 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 69/338 (20%), Positives = 142/338 (42%), Gaps = 4/338 (1%)
 Frame = +1

Query: 319  DDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK-AECERSKN 495
            D+   EV D+  +C  +    TK   +  +   ++T+++    +      K  E E+S  
Sbjct: 1529 DNLHSEVEDSQEKCKNINKDLTK--KLREMQSASETYDSNLKRMEETIEEKNVEIEKSSK 1586

Query: 496  AIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI-E 672
            +I+ L   ++L  + L  K LQ   +   +V K+N+  +D  +K+ E   LK   + + E
Sbjct: 1587 SIEEL--EKELGSQQLKLKDLQ---NENTEVIKKNKDILD--EKISEIGNLKEKNESLSE 1639

Query: 673  EVEDNKISINSLEQQLLEEKTANNILRR--DYYKLQERGKRLCHEFQDLQDDYSKKMKQK 846
            E E    S + L+ ++ +   A  I ++  D YK+++       +   LQ   ++  K+ 
Sbjct: 1640 ENETLSKSADQLKSEVSKRDEALKISKKVIDEYKVKDE------QLSKLQSQLAQVNKEY 1693

Query: 847  EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDEC 1026
                Q +++  K + +   N K    QF+  +K    K   +EK +  +K +    E   
Sbjct: 1694 SDSKQAMEDLQKRIGDAEENTK----QFNNTKKDDEDKIKQLEKEVEDMKAKLELSESSV 1749

Query: 1027 NRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQK 1206
               +  + +  K I+  +  L A+              E +K   +E++    ++  E+ 
Sbjct: 1750 ANDQLKISELEKIIEDNKEILLAEKEVNQKQEKSIQSLELEKKTVVEEKRKLEEKLDEES 1809

Query: 1207 LQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYY 1320
             Q  K  +    E E   + L  ++  +KTLE  ++ +
Sbjct: 1810 AQHIKKTETFAKENEEQKDELETLKEKLKTLEEQNQKF 1847

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 51.2 bits (121), Expect = 6e-06
 Identities = 63/288 (21%), Positives = 132/288 (45%), Gaps = 36/288 (12%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLN----EKSLQM-AIDHLLKVTKQNQRQVDGR-----D 624
            E    K  ++SL  + +   KDL     +K +++ +++  LKV K N ++ D +     D
Sbjct: 1232 EISSEKLKLNSLLQNTETNLKDLEKVNEDKEIRIQSLEKELKVVKSNSKETDNKLQELSD 1291

Query: 625  KLE----ETEVLK--------SFIKEIEEVEDNKISINSLEQ---QLLEEKT---AN-NI 747
            K +    E E+LK        S  K  ++  DN   IN+ E+   QL +EKT   AN   
Sbjct: 1292 KHDQMSREYEILKADKESLLNSKEKLYKQYNDNVEKINNYEESLKQLKKEKTTLQANLKT 1351

Query: 748  LRRDYYKLQERGKRLCHEFQDL---QDDYSKKMKQKEYEVQKLK----NEVKFLTNMNTN 906
               +   LQE+     + + D+   +D  ++++K  + ++++L+     + K +TN N  
Sbjct: 1352 TEAELNDLQEKYSANVNSYNDIISEKDKLTEEIKLSDDKIKELELVLEEKDKVITNQNAE 1411

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS 1086
            +K  K  F +K   Y +  + ++  +S + +E  +        K +++K +K ++    +
Sbjct: 1412 IKNIKLDFEEKGNDYKRTIVDLKAKLSDLTKESAES-------KLLMEKTIKDLEKNMET 1464

Query: 1087 LQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNND 1230
            L++++   ++ S   +   + + A L +         E+K+  +  ND
Sbjct: 1465 LKSESVISSNLSTERITSLELEIAKLTE---------EKKINQTNFND 1503

 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 73/358 (20%), Positives = 154/358 (43%), Gaps = 31/358 (8%)
 Frame = +1

Query: 322  DTFKEVNDAVNRCYALCNIPTKHISI--------SSISDLAQTFETLAVGITHETNRKAE 477
            + F  VND +        + +K+++I        +SI++   T + L   I+  TN    
Sbjct: 1144 EKFNSVNDDLEE------LNSKYVTIEEEKRTLENSINENQFTIKELKDNISGLTNDYNA 1197

Query: 478  CERSKNAIDSLYYHE--QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK 651
             E SK  ++     +  +L++KD +   L   ++ +      +  ++     L+ TE   
Sbjct: 1198 LESSKLDLEEELSSQTTELDQKDTSLAELSKKLEEI------SSEKLKLNSLLQNTE--- 1248

Query: 652  SFIKEIEEV-EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY- 825
            + +K++E+V ED +I I SLE++L   K+ +        +L ++  ++  E++ L+ D  
Sbjct: 1249 TNLKDLEKVNEDKEIRIQSLEKELKVVKSNSKETDNKLQELSDKHDQMSREYEILKADKE 1308

Query: 826  ----SKKMKQKEYE--VQKLKNEVKFL-------TNMNTNLKADKTQFSQKEKQYS---Q 957
                SK+   K+Y   V+K+ N  + L       T +  NLK  + + +  +++YS    
Sbjct: 1309 SLLNSKEKLYKQYNDNVEKINNYEESLKQLKKEKTTLQANLKTTEAELNDLQEKYSANVN 1368

Query: 958  KYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE---RSLQAQTNAQNSFSAV 1128
             Y  I      + +E    +D+   L+ V+++  K I +     ++++     + +    
Sbjct: 1369 SYNDIISEKDKLTEEIKLSDDKIKELELVLEEKDKVITNQNAEIKNIKLDFEEKGNDYKR 1428

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            T+ D   K + L     + K  ME+ ++  + N  +      + + L     T   LE
Sbjct: 1429 TIVDLKAKLSDLTKESAESKLLMEKTIKDLEKNMETLKSESVISSNLSTERITSLELE 1486

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 60/294 (20%), Positives = 123/294 (41%), Gaps = 12/294 (4%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            +++C   KN++ +L      +   L EK  ++  D  +   K +    D        E +
Sbjct: 707  QSDCTNLKNSLSALENDSSSKIDTLEEKLTELQNDFNILSEKHSILSGDNISLNSNYENI 766

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL--RRDYYKLQERGKRLCHEFQDLQDD 822
            K+ +  I E    ++S+ S E + L+   A+  +  +    +L E+ K +    + L   
Sbjct: 767  KNELNSISE----QLSMASKENENLKATNASQEVDVKSLNKELNEKEKSIYELEKQLNLT 822

Query: 823  YSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQE 1002
             ++K K +E  + K+ NE++ L      L  DK   S+ + +   + I ++   + +  E
Sbjct: 823  KTEKDKAQE-GINKMNNELRKLMTSIDTLNEDK---SRLQNEIKLQKIELDDKETKINSE 878

Query: 1003 YNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHK 1182
              K   E + LK ++    ++I+ L+  L         +     Q  D     L ++   
Sbjct: 879  MEKTSKEYDNLKKLLALKEEEIEELKSKLLISARDLKEYKG-KFQSHDSLVPKLTEKLKT 937

Query: 1183 V----------KEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
            +          ++ + Q L+T++ N  + SE   L + L +I++   TLE N K
Sbjct: 938  LATSFKELEIERDALLQSLKTNEEN--TSSELSLLTSKLDIIKSENATLEKNKK 989

>Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar to
            Ashbya gossypii AGR229W
          Length = 717

 Score = 50.8 bits (120), Expect = 6e-06
 Identities = 53/240 (22%), Positives = 107/240 (44%), Gaps = 25/240 (10%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVD-GRDKLEETEV-----------LKSFIKE 666
            Q+  K+ + KSL+  ++H     KQ   Q++  RDK+ E E             KS  ++
Sbjct: 318  QISDKEDSVKSLETKLEHSQAQIKQLSHQLEQARDKVAEVEQNLMDGKRAYDHQKSNAQQ 377

Query: 667  IE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            +E ++ +    I  L   + + K A N   R   +L+ +   L  E   L+ +Y K +K 
Sbjct: 378  LESQLSEKTAKIEELTHTIEQSKDAQN---RSSSELESKITDLTEENLILEKEYQKLLKD 434

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKAD-----------KTQFSQKEKQYSQKYIYIEKYMSH 990
             + E + L+N++K +   N +L++            KTQ ++ EKQ       +E+    
Sbjct: 435  YDSETKALRNQIKDIYEENKSLESKYEVDCKELVSLKTQRTEFEKQIKNLISELEE---- 490

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQA-QTNAQNSFSAVTVQDEDQKDAHLE 1167
               E   K+ E N L   + +  +   +L+ S+   + + ++  S + +++E+ +  + E
Sbjct: 491  ANNELVSKKAEVNELNSTITELKQSEKYLQESIGGREQSVKDWHSKLDIKEEELRRLNAE 550

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 50/248 (20%), Positives = 100/248 (40%), Gaps = 13/248 (5%)
 Frame = +1

Query: 631  EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            E+   ++    EI  V+D+   +   ++        +N ++ +  +L++ GK    E++ 
Sbjct: 209  EKNATIRQLTLEIRNVQDSLWEVTKTKESF----EVSNCMQAE--ELKDIGK----EYEQ 258

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            +Q  Y+    QK+    KL+  V  L   ++ LK + T   Q  +   +KY         
Sbjct: 259  IQAQYTDVCGQKD----KLEQRVDKLKARSSELKNELTMAMQNSQILQEKYHTQVTKNEE 314

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTN-----AQNSFSAVTVQDE---- 1143
            ++ + + KED    L+  ++ +  +I  L   L+   +      QN        D     
Sbjct: 315  LEHQISDKEDSVKSLETKLEHSQAQIKQLSHQLEQARDKVAEVEQNLMDGKRAYDHQKSN 374

Query: 1144 -DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTM---KTLEGNS 1311
              Q ++ L ++  K++E      Q+    + S SE E+   +  L E  +   K  +   
Sbjct: 375  AQQLESQLSEKTAKIEELTHTIEQSKDAQNRSSSELES--KITDLTEENLILEKEYQKLL 432

Query: 1312 KYYSTTTK 1335
            K Y + TK
Sbjct: 433  KDYDSETK 440

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309c IMH1
          Length = 867

 Score = 50.8 bits (120), Expect = 6e-06
 Identities = 63/284 (22%), Positives = 120/284 (42%), Gaps = 27/284 (9%)
 Frame = +1

Query: 457  ETNRKAECERSKNA-IDSLYYHEQLEKK----DLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            E  ++ +  RSKNA +   Y   QLE K     LN +  +M ++    + ++     D  
Sbjct: 393  EVKKELDNLRSKNATMIETYEKTQLELKAKIASLNGEISEMKLNQTTILKEKEIASKDAI 452

Query: 622  DKL-EETEVLKSFIKEIEEVE----DNKISINSLEQQLLEEKTANNILRRDYYKLQERGK 786
            +KL +E + LK+ +K+I  ++      + +I  LE+Q+ +    N +++    KL++  K
Sbjct: 453  EKLSDENKTLKAQLKDINAIKLTLTQREKTIGYLEEQVKQYNEKNAVVQATIEKLEKELK 512

Query: 787  RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI 966
                +   +Q+           E + LK E K       N   +  + S++     +KY 
Sbjct: 513  SKESQLTTIQN-----------ENESLKKEAKTNVVSLENYLKENGKLSERLSILQEKYD 561

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA------------- 1107
              +   S+  ++ +  + +CN L   + ++ K+I  LE  L    N              
Sbjct: 562  TAQNLKSNSNEQVDSIKRQCNELNVKLKESNKRIMSLEDELNEYMNTLQEKSRECDTMRR 621

Query: 1108 ----QNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
                Q +  +   Q+ + K A L D  +K++   E  LQTS+ N
Sbjct: 622  LISDQQNEESSGRQEIENKLALLTDERNKMES--ELALQTSRKN 663

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 49/218 (22%), Positives = 85/218 (38%), Gaps = 10/218 (4%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG--RDKLEE 636
            N   + E   N +    Y ++  K       LQ   D    +   +  QVD   R   E 
Sbjct: 525  NESLKKEAKTNVVSLENYLKENGKLSERLSILQEKYDTAQNLKSNSNEQVDSIKRQCNEL 584

Query: 637  TEVLKSFIKEIEEVEDNKIS-INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL 813
               LK   K I  +ED     +N+L+++  E  T   ++     +     + + ++   L
Sbjct: 585  NVKLKESNKRIMSLEDELNEYMNTLQEKSRECDTMRRLISDQQNEESSGRQEIENKLALL 644

Query: 814  QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
             D+ +K   +   +  +   E++   NMN +LK+   Q   +EKQ   +   +      +
Sbjct: 645  TDERNKMESELALQTSRKNREIQNWKNMNDDLKSQLNQLQFREKQLLSQIEDLNNISQTL 704

Query: 994  KQEYNKKEDECNRLKFV-------VDKNMKKIDHLERS 1086
            K+  N  EDE   LK V       + K  K+I  L+ S
Sbjct: 705  KRSTNNDEDESGELKKVAGNLKEALQKADKRISELQES 742

>Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {ON}
            complement(71225..74242) [3018 nt, 1006 aa]
          Length = 1005

 Score = 50.8 bits (120), Expect = 6e-06
 Identities = 52/248 (20%), Positives = 118/248 (47%), Gaps = 10/248 (4%)
 Frame = +1

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN-KISINSLEQQLLEEKTANNILRRDYY 765
            T++ + + +  + +++ EV+K   KE++  ++   +S +SL+Q+  E +   ++LR    
Sbjct: 426  TEKEKYETETTNNIKDLEVVK---KELDSAKEALSVSNSSLKQKSTELEEVKDMLRD--- 479

Query: 766  KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK 945
                    + +E  + +D   +   ++  E++ LK ++  LT+    L+A+   F  K+K
Sbjct: 480  --------VGNELVEAKDQLKQAGSKQGEEIEILKKDLMKLTSEKEKLQAE---FESKQK 528

Query: 946  QYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVV---DKNMKKIDHLERSLQAQT----- 1101
            + +     + K +S +K+  +  E + N+L+  V   ++++ K+ +   SL +Q      
Sbjct: 529  ELNISIDSLTKNVSELKKSLDAAETQKNKLQQDVLKSNESLSKLKNDNNSLSSQVRELTL 588

Query: 1102 -NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLI 1278
                 +     V  +++  A+LED   +VK++ EQ      + D    E E L N + L+
Sbjct: 589  LKKSEANLKTNVNQKEKTIAYLED---QVKKYNEQSNSNKTSLDIMQKETEQLKNKIDLM 645

Query: 1279 ENTMKTLE 1302
            +     L+
Sbjct: 646  KKQNNELQ 653

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 71/325 (21%), Positives = 130/325 (40%), Gaps = 34/325 (10%)
 Frame = +1

Query: 430  ETLAVGITHETNRKAECE----RSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQ 597
            ETL   I  +T +  E E      K  ++ L   ++L K +     L   + + L + K 
Sbjct: 204  ETLKSEIKDKTEKFIELETKSIEDKQKVELL--EKELTKSEGKVNELNAEVKNQLDLIKM 261

Query: 598  NQRQVDGRDKL----------EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
             + + + +DKL          +  +VLK  +K   E +D ++S  SLE+++  +    N 
Sbjct: 262  LEEKSNTKDKLILELESEVKDKTDDVLK--LKATIEGKDERLS--SLEEEMTAKSEKINK 317

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNT-NLKADKT 924
            L  D  K    GK +     +     +        + +  KN+ K   N N  N   D  
Sbjct: 318  LEHDLEKNSNIGKLVEETTNETNIPTNNVQSTGGGKKKNKKNKKKISNNNNAANSNDDSL 377

Query: 925  QFSQKEKQY-----SQKYIYIEKYMSHVKQ--EYNKKEDECNRLKFVVD----------- 1050
            Q      +      S K+   EKY   +K+  E+ +K  EC++LKF  +           
Sbjct: 378  QIISPSVESGLDANSSKFTS-EKYNDLLKEYNEFKEKHTECDKLKFEYETEKEKYETETT 436

Query: 1051 KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKV-KEFMEQKLQTSKNN 1227
             N+K ++ +++ L +   A  S S  +++ +  +   ++D    V  E +E K Q  +  
Sbjct: 437  NNIKDLEVVKKELDSAKEAL-SVSNSSLKQKSTELEEVKDMLRDVGNELVEAKDQLKQAG 495

Query: 1228 DPSCSEAEALDNVLGLIENTMKTLE 1302
                 E E L   L  + +  + L+
Sbjct: 496  SKQGEEIEILKKDLMKLTSEKEKLQ 520

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 50.8 bits (120), Expect = 7e-06
 Identities = 73/340 (21%), Positives = 146/340 (42%), Gaps = 32/340 (9%)
 Frame = +1

Query: 403  SISDLAQTFETLAVGITHETNRKAECERSKNAIDS------LYYHEQ----LEKKDLNEK 552
            SI  L+   E+L      + NR +  ER KN+++S       + +++    LEK  L + 
Sbjct: 313  SIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQY 372

Query: 553  SLQM----AIDHLLKVTKQNQRQVDGRDKLEE--------TEVLKSFIKEIEEVEDNKIS 696
            +L        D L K T   Q Q    D+  +        T  L     ++E+V   +++
Sbjct: 373  NLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVN 432

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE 876
            ++  ++ L  +K  N  +  +   L  + K    + + LQD    K+   + E+Q +  E
Sbjct: 433  LSKTKRTLENKKVENEQIVNN---LDSKRKEFEEQSKILQD----KINSTDQEIQTIIEE 485

Query: 877  VKFL----TNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFV 1044
               L    T ++TNL  +K +    + +  +K  ++   ++  ++E +   ++  +LK  
Sbjct: 486  QSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKE 545

Query: 1045 VDKNMKKIDHLERSLQA-QTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQK---LQ 1212
            +     ++  +E + +  + +     +A+  Q  D     LE +  ++K  +EQK   +Q
Sbjct: 546  IKITESELSIIEENRKGLENDIAGLENAILSQKRD-----LEVQEQEIKSLLEQKTKVIQ 600

Query: 1213 TSKNNDPSCSEAEA-LDNVLGLIEN-TMKTLEGNSKYYST 1326
              +  +  C  A+A L NV   +E    K +E  S Y +T
Sbjct: 601  ERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSAT 640

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 50.8 bits (120), Expect = 7e-06
 Identities = 58/262 (22%), Positives = 113/262 (43%), Gaps = 20/262 (7%)
 Frame = +1

Query: 430  ETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNE-----KSLQMAIDHLLKVTK 594
            E L V       +KAE E+SK  + +L    +  +K+L       K     ++   K  +
Sbjct: 1485 EGLKVIEQKSATQKAELEKSKETVKTLESTIKCNEKELKSSMKVMKESDEKLEQCRKSAE 1544

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEVE-------DNKISINSLEQQLLEEKTANNILR 753
            +  + +       ET++ +S  KEIEE+E        +   + ++EQQL +     N+ R
Sbjct: 1545 EEIKNLQNEKSTLETQIKESK-KEIEELERKLKIEAKSTTELETIEQQLSKANEKLNVNR 1603

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNL-------K 912
            ++   L+ + K L  E ++ Q      +++KE    +LK   + L N            K
Sbjct: 1604 KEDALLKSKLKDLERELKEKQVKIKNNIEEKELLTSQLKTLEQELDNAQQKTQKCEEESK 1663

Query: 913  ADKTQFSQKEKQYSQKYIYIE-KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 1089
             +  +   ++ +  ++ + +E KY + V +E N K+DE + +    D    +I+ L   L
Sbjct: 1664 IEVRKLQAEKTESDERVVQLETKYNNLVAKEENWKKDE-DAINKTTDSQKTEIEKLVIEL 1722

Query: 1090 QAQTNAQNSFSAVTVQDEDQKD 1155
            + +   +NS      +D  + D
Sbjct: 1723 E-KLKTENSKLKEVNKDRSEID 1743

 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 61/309 (19%), Positives = 131/309 (42%), Gaps = 44/309 (14%)
 Frame = +1

Query: 544  NEKSLQMAI--DHLLKVTKQNQRQVDGRDKLEET-EVLKSFIKEIEEVEDNKIS------ 696
            +EK++Q++   D +  +++Q +  +  R+ LE++ + L+  I  IE+ ++  IS      
Sbjct: 991  SEKTMQLSALQDEIDSLSRQKENFLTERESLEQSIKQLRETISAIEKAKEEAISRFNSSK 1050

Query: 697  ------INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD---LQDDYSKKMKQKE 849
                  +  L +QL   + A +       +L +  K L  E +    L+D    K++  E
Sbjct: 1051 DNYESQLGLLREQLENTRNAKDESVNRISELIQNSKNLEAELETCRHLKDGLEAKIETFE 1110

Query: 850  YEVQKLKNEVKFLTNMNTNLKADKTQFSQK-----------EKQYSQKYIYIEKYMSHV- 993
              +  +K   + L      L+ + T   Q+           EK++      IEKY  H+ 
Sbjct: 1111 KALDVIKKSEQHLKEEKMQLEKEVTDTKQQTEILRSNLKSLEKEHEDSIALIEKYKKHII 1170

Query: 994  --KQEYNKKEDECN-----------RLKFVVDKNMKKIDHLERSLQAQTNAQNS-FSAVT 1131
              + EYN++  E N            ++   DK    I  ++ +L  Q+N++ S   A+ 
Sbjct: 1171 DKEGEYNERASELNDEINSLQQEKETIRLKSDKLEGDIKEMKNTLGVQSNSKESEIRALN 1230

Query: 1132 VQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
            +Q ++ ++   ++  + ++     + +T+K  +    E +     +G +E  +K  E  +
Sbjct: 1231 MQIKELEEKSQKNEANLLQSVKSLESETTKVRELQ-EECDLKRKKIGELEKKIKASEDKN 1289

Query: 1312 KYYSTTTKK 1338
               S   K+
Sbjct: 1290 SQISELQKE 1298

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 71/318 (22%), Positives = 134/318 (42%), Gaps = 31/318 (9%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE 633
            H  +++ E     + ++      Q EK+ +  KS ++  D  +K  K N   V    K  
Sbjct: 1168 HIIDKEGEYNERASELNDEINSLQQEKETIRLKSDKLEGD--IKEMK-NTLGVQSNSKES 1224

Query: 634  ETEVLKSFIKEIEEV----EDNKI-SINSLEQQLLEEKTANNILRRDYYKLQERGKRLC- 795
            E   L   IKE+EE     E N + S+ SLE +  + +           K+ E  K++  
Sbjct: 1225 EIRALNMQIKELEEKSQKNEANLLQSVKSLESETTKVRELQEECDLKRKKIGELEKKIKA 1284

Query: 796  -----HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQK 960
                  +  +LQ +  +  ++ E +  ++KN+++ ++N+N   +    +F++ +K +S+ 
Sbjct: 1285 SEDKNSQISELQKESEETKRELEAKTAEVKNQLEKISNLNELKEKSDIEFTRLKKTWSED 1344

Query: 961  YIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN--------MKKIDHLERSLQAQTNAQNS 1116
               +E+ +  VK E   K     + + ++++          +KI+ LE  L    N   S
Sbjct: 1345 KKNMEEQLDKVKNEMQIKNQAFEKERKLLNEGSSTITQEYSEKINMLEDKLMILQNENES 1404

Query: 1117 ----FSAVTVQDED---QKDAHLEDRYHKVK----EFMEQKLQTSKNNDPSCS-EAEALD 1260
                  AV    E     KD  LE++ +++K    E +  K + S+ N    S E E   
Sbjct: 1405 KTKQIDAVRNDLERATLSKDELLEEKRNEIKILNDEILSYKEKLSETNKGLLSKERENKQ 1464

Query: 1261 NVLGLIENTMKTLEGNSK 1314
            N+  L E      E  +K
Sbjct: 1465 NIESLREQLRTLKESKTK 1482

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 53/260 (20%), Positives = 108/260 (41%), Gaps = 15/260 (5%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN-KI 693
            H  L+K   N ++    I   L    Q +  ++ +DK E    L+ +   I + ED  K 
Sbjct: 786  HISLKKNFSNLETELKNIKGSLDEMTQLKNVLETKDK-ENLAALQEYKGTIHKQEDTIKT 844

Query: 694  SINSLEQQLLEEKTANN----------ILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
                LE    ++K A +           L R+   ++E+ K L  E      +Y K++K 
Sbjct: 845  LEKELETTFSQKKKAEDGINKMGKDLFALSREMQSVEEKYKNLQREKDKSDSNYQKEVKL 904

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI-YIEKYMSH---VKQEYNK 1011
             + +  K   E+K L       K +    S++++  S++   Y  ++ SH   V +  +K
Sbjct: 905  LKEDTVKKMTEIKILNENLIKTKTEHNNLSKEKENISRELTEYRSRFQSHDSLVTKLTDK 964

Query: 1012 KEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
             +   N  K +  +N   I  +E     +T ++ +     +QDE    +  ++ +   +E
Sbjct: 965  LKSLANDYKNMQSENESLIKAVE-----ETKSEKTMQLSALQDEIDSLSRQKENFLTERE 1019

Query: 1192 FMEQKLQTSKNNDPSCSEAE 1251
             +EQ ++  +    +  +A+
Sbjct: 1020 SLEQSIKQLRETISAIEKAK 1039

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 50.8 bits (120), Expect = 7e-06
 Identities = 76/321 (23%), Positives = 136/321 (42%), Gaps = 9/321 (2%)
 Frame = +1

Query: 448  ITHETNRKAECERSKNAIDSLYYHE---QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG 618
            IT E + K      K       + E   +LE K     SL++ ++  L+      +++  
Sbjct: 1435 ITKEYSEKVTALEEKLTSSKNDFEEKVRELESKQTEMDSLKLDLEATLEQKNTEIKKLSS 1494

Query: 619  RDKLEETEV-LKSFIKEIEEV-EDNKISINSLEQQL--LEEKTANNILRRDYYKLQERGK 786
              +L E E+ L+    EI E+ + N+I+I  LE+QL  L ++ A    + +  K     K
Sbjct: 1495 --ELSEKEIQLEKGSSEISEISKKNEITIKELEKQLSELHKQLAEKDEKLETCKGDNEKK 1552

Query: 787  --RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQK 960
              +L H F + +D    K+K+   +  KL+ E K L          + +  +  K+ SQ+
Sbjct: 1553 ITKLKHSFDETED----KLKESNMQTSKLEKENKDL----------RQKLEESLKRNSQE 1598

Query: 961  YIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD 1140
            Y  +E+    + +E  + E   N  K  +++  K I   E + +     +N+ S      
Sbjct: 1599 YKSLEQLQETLVKEKQELEKSLNDSKIQLNEKEKVIKDFEVTKEKLQETENALS------ 1652

Query: 1141 EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYY 1320
              +K+  ++D      E  ++KLQ ++N   + SE E         E T K L    K  
Sbjct: 1653 --EKEKAMQD-----FEATKEKLQETEN---ALSEKE---KAAQDFEITKKKLVETEKAL 1699

Query: 1321 STTTKKCLKYVTGSSRLKENE 1383
            S   K        +++LKE+E
Sbjct: 1700 SEKGKAVEDLEITTNKLKESE 1720

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 71/328 (21%), Positives = 139/328 (42%), Gaps = 35/328 (10%)
 Frame = +1

Query: 469  KAECERS----KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE 636
            K E ER+    K  ++      + E+K LNE S  +  ++  KVT   ++    ++  EE
Sbjct: 1400 KLELERNVTDLKKQLNEKTQAFERERKLLNEGSSSITKEYSEKVTALEEKLTSSKNDFEE 1459

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQL---LEEKTANNILRRDYYKLQERGKRLCHEFQ 807
                     ++ E+E  +  ++SL+  L   LE+K                      E +
Sbjct: 1460 ---------KVRELESKQTEMDSLKLDLEATLEQKNT--------------------EIK 1490

Query: 808  DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN-TNLKADKTQFSQKEKQYSQKYIYI---- 972
             L    S ++ +KE +++K  +E+  ++  N   +K  + Q S+  KQ ++K   +    
Sbjct: 1491 KL----SSELSEKEIQLEKGSSEISEISKKNEITIKELEKQLSELHKQLAEKDEKLETCK 1546

Query: 973  ---EKYMSHVKQEYNKKED---ECNRLKFVVDKNMKKI-DHLERSLQAQTNAQNSFSAV- 1128
               EK ++ +K  +++ ED   E N     ++K  K +   LE SL+  +    S   + 
Sbjct: 1547 GDNEKKITKLKHSFDETEDKLKESNMQTSKLEKENKDLRQKLEESLKRNSQEYKSLEQLQ 1606

Query: 1129 -TVQDEDQK--------DAHLEDRYHKVKEF--MEQKLQTSKN----NDPSCSEAEALDN 1263
             T+  E Q+           L ++   +K+F   ++KLQ ++N     + +  + EA   
Sbjct: 1607 ETLVKEKQELEKSLNDSKIQLNEKEKVIKDFEVTKEKLQETENALSEKEKAMQDFEATKE 1666

Query: 1264 VLGLIENTMKTLEGNSKYYSTTTKKCLK 1347
             L   EN +   E  ++ +  T KK ++
Sbjct: 1667 KLQETENALSEKEKAAQDFEITKKKLVE 1694

 Score = 34.3 bits (77), Expect = 0.93
 Identities = 62/343 (18%), Positives = 147/343 (42%), Gaps = 11/343 (3%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLY-----YHEQLEKKD 540
            +P  + S   I  + + F  +   ++H  + +   + S    + L        ++L + +
Sbjct: 673  LPNLYFSPHFIELIDENFYRIRSALSHSPDEEPYSKISFEEFEELQGRCANLKKELVQLE 732

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGR-DKLE-ETEVLKSFIKEIEEVEDNKISINSLEQ 714
            L+ K+L   ++  L       + V G  ++L+ + E L+   K++E+      S+ ++  
Sbjct: 733  LDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLEGKHKKVEK------SLENVST 786

Query: 715  QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTN 894
            +L+E       + +D   L    K++   F   +    KK++  E ++  L+++++ +T+
Sbjct: 787  RLIE-------ITKDKENLTAANKKITETFASNK----KKIEAYESKINTLESKLRDITS 835

Query: 895  MNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDH 1074
                    K Q  +   + S++   +EK    ++    K E E N+    +    KK+D+
Sbjct: 836  K-------KEQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKELENMKNENKKLDN 888

Query: 1075 LERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFME-QKLQTSKNNDPSCSEAE 1251
                    T A+      ++ +E QK         K++  +E  K Q+++      S+ +
Sbjct: 889  --------TLAKKEKELQSLDEELQK-------LRKMQSLLETDKDQSARELTEWKSKFQ 933

Query: 1252 ALDNVLGLIENTMKTLEGNSKYYST---TTKKCLKYVTGSSRL 1371
              D ++  + + +K+L  + K   +   T +K L  +T +++L
Sbjct: 934  GHDELVTRLTDKLKSLANSFKNIQSERDTLQKHLMEITDNNKL 976

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] {ON}
            Anc_3.479
          Length = 763

 Score = 50.4 bits (119), Expect = 8e-06
 Identities = 51/222 (22%), Positives = 100/222 (45%), Gaps = 3/222 (1%)
 Frame = +1

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            +D+ + +N L+++L ++KT  + LR +    ++       E+ +LQ ++ K  K+K  + 
Sbjct: 111  KDSIVELNQLQEELFQKKTIFDNLRDELNVNKD-------EYANLQSEWEKLYKEKNSKE 163

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK 1038
            Q LK++   + N+N  L   K   ++  +      +++++  +    E+NK E+E  RLK
Sbjct: 164  QLLKSKENEIRNLNEKLTNKKKYLNEGHQ------LHLKQLEAKNNAEFNKMENE-YRLK 216

Query: 1039 FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD---AHLEDRYHKVKEFMEQKL 1209
             +      KI   E +  A  N     S   + ++D      A +E++   +KE   QK 
Sbjct: 217  -IEKLKQSKIKKFEDNRNALLNKVEDISNKILTNDDTLKVMLADVEEKNRTIKEEWLQKY 275

Query: 1210 QTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTK 1335
                  +   +E +  + V  L E   K LE  +K   +  K
Sbjct: 276  HAEWKTNLEINE-KITNEVGSLNERIEKELEPKAKAQKSEIK 316

>TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4.46
            YLR309C
          Length = 906

 Score = 50.4 bits (119), Expect = 8e-06
 Identities = 58/271 (21%), Positives = 115/271 (42%), Gaps = 12/271 (4%)
 Frame = +1

Query: 397  ISSISDLAQTFETLAVGIT-HETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID 573
            ++ ISDL     TL    T HE+ +KA                        EK L    +
Sbjct: 446  MTEISDLKAQISTLNANTTFHESEKKAA-----------------------EKKLNKLNE 482

Query: 574  HLLKVTKQNQRQVDGRDKLEETEV-LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
             L K+  +N  QV   + L+ T V LKS + + E+      +I+ LEQQ+ +    + + 
Sbjct: 483  TLSKLKDENSEQVKEVNNLKRTIVSLKSSVNQKEK------TISYLEQQVKDYSEKSGLS 536

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
            R+    +++  ++L    + L+            E ++L+++VK  ++   N   +  + 
Sbjct: 537  RKARDDMKKENEQLLERLESLRK-----------ENEELRSDVKKNSSSFENYLRENGKL 585

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS-------L 1089
            S++     +KY  ++   S+  ++ +  + +C  L   + ++ KKI  LE         L
Sbjct: 586  SERIAILQEKYETLQNLKSNSSEQVDSIKRQCEELNVKLKESNKKIISLEEEINDYSNLL 645

Query: 1090 QAQTNAQNSFSAVTVQ---DEDQKDAHLEDR 1173
            Q +T   N+   +  +   DE  K++ L+ +
Sbjct: 646  QEKTREANTMRRLLTENSNDETTKESALQQK 676

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 66/308 (21%), Positives = 137/308 (44%), Gaps = 28/308 (9%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNE----KSLQMAIDHLLKVTKQNQRQVDGRDKL 630
            N  A    + NA+      ++  KK ++E    + +Q +  +  +  K  Q Q+D + K 
Sbjct: 297  NYGAASNNTTNAVSEATEKDEEHKKLVDEVEKLRGVQESAQNQEEKCKVLQSQID-QFKE 355

Query: 631  EETEVLKSFIKEIEEVED------NKISINSLEQQLLEEKTANNILRRDYYKLQERGKRL 792
             E+E LK  +K+  +  D      NK+S + L+ + LE +    +LR    +L E   +L
Sbjct: 356  AESE-LKDLLKDSNDKRDELQEELNKVS-SRLKDKGLELEEVREMLRDVGNELVEAKDQL 413

Query: 793  CHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD------KTQFSQKEKQYS 954
              +    ++D+     +KE   +  + + + L    ++LKA        T F + EK+ +
Sbjct: 414  KDKAGLKKEDFELLSAEKEKSAKLFEKKERELMTEISDLKAQISTLNANTTFHESEKKAA 473

Query: 955  QKYI-YIEKYMSHVKQEYNKKEDECNRLKFV-------VDKNMKKIDHLERSLQAQTNAQ 1110
            +K +  + + +S +K E +++  E N LK         V++  K I +LE+ ++   + +
Sbjct: 474  EKKLNKLNETLSKLKDENSEQVKEVNNLKRTIVSLKSSVNQKEKTISYLEQQVK-DYSEK 532

Query: 1111 NSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS----CSEAEALDNVLGLI 1278
            +  S     D  +++  L +R   +++  E+     K N  S      E   L   + ++
Sbjct: 533  SGLSRKARDDMKKENEQLLERLESLRKENEELRSDVKKNSSSFENYLRENGKLSERIAIL 592

Query: 1279 ENTMKTLE 1302
            +   +TL+
Sbjct: 593  QEKYETLQ 600

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 50.4 bits (119), Expect = 9e-06
 Identities = 68/332 (20%), Positives = 140/332 (42%), Gaps = 25/332 (7%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS 654
            E +  K  + S+   ++   KD   KS++  I+  +K+ +    ++D   K  +  VL S
Sbjct: 1249 ESQLEKLKLSSVSKEKEAHLKDEEIKSVKAEIEDNVKLVQAKSTELDELKK--QNSVLNS 1306

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK 834
             + +  E E  KI  + L + L    TA + L+      +E  K L     +L   YS+K
Sbjct: 1307 KLNK--EKEKAKIEQHKLRESLA---TARDELKSKIKDFEEERKLLSEGSSELNQQYSEK 1361

Query: 835  MKQ-----------KEYEVQKLKNEVKFLTNMNTNLKAD-KTQFSQKEKQYSQKYIYIEK 978
            + +            E  VQKL+N ++ L       K+   T+ S   K+  Q+ + +EK
Sbjct: 1362 ILKLEETLNNVKADHEKAVQKLENTIEALEQQAEESKSSLDTERSLSSKEQQQR-LQLEK 1420

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF------SAVTVQD 1140
             +++ ++E    E++      + D +    +H E +L++QT     +      ++  +++
Sbjct: 1421 ILANEQKENKDLENK------LADLDQLFKEH-ENTLESQTKISQDYKQQLEKNSQVIEE 1473

Query: 1141 EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE------ 1302
                ++ L+D+    +E +++    +   D + +   AL      ++ ++  LE      
Sbjct: 1474 LKSAESALKDKLIAAEEKIKESEILTSQLDEAVTSTSALLEEQTKLKKSISDLEAKNIKD 1533

Query: 1303 -GNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
             G  +       KC + +  S RL E +   N
Sbjct: 1534 CGEMEILRKELSKCQESLKVSQRLNEEKDEAN 1565

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 73/336 (21%), Positives = 127/336 (37%), Gaps = 27/336 (8%)
 Frame = +1

Query: 421  QTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEK---SLQMAIDHLLKVT 591
            + F+     +T E N K+E   S          +  E K  NE+   SL       +++ 
Sbjct: 993  ENFDAHTQKLTSENNSKSESIISLQTKLDECERQIKEYKTTNEELKNSLHALNVKCIELE 1052

Query: 592  KQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTA----NNILRRD 759
               +      D  +ET         IEE+ D+ I+IN   Q +L EK      NN +  +
Sbjct: 1053 SSLESAKQSTDNSDET---------IEELNDSVIAINDELQSVLAEKDELLKQNNKINEE 1103

Query: 760  YYKLQERGKRLCHEFQDLQDDYSK--------------KMKQKEYEVQKLKNEVKFLTNM 897
                Q+  +      Q LQD  S               K+K  E   ++   E+K L + 
Sbjct: 1104 LCNYQQELQEKADSCQGLQDKISSLNNEIMQISEESNDKIKLLEASNEEKVAEIKDLKSE 1163

Query: 898  NTNLKADKTQFSQKEKQ----YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKK 1065
             +N+K +    ++K K        +   +E  +    + Y   +     L+   +K    
Sbjct: 1164 ISNIKQNADTKAEKLKSEIDALKSRISDLESLLETKNKLYENSQTTITELEQAKEK---- 1219

Query: 1066 IDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVK--EFMEQKLQTSKNNDPSC 1239
               L+R++Q Q   +  +S  ++   + K  HLE +  K+K     ++K    K+ +   
Sbjct: 1220 ---LQRTIQEQYK-EAQYSEDSLLAGENKIKHLESQLEKLKLSSVSKEKEAHLKDEEIKS 1275

Query: 1240 SEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLK 1347
             +AE  DNV  L++     L+   K  S    K  K
Sbjct: 1276 VKAEIEDNV-KLVQAKSTELDELKKQNSVLNSKLNK 1310

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 50.4 bits (119), Expect = 9e-06
 Identities = 66/343 (19%), Positives = 141/343 (41%), Gaps = 41/343 (11%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            +R +N   S   H+  E K  NE  ++   + L ++T  N      +   EE  +L   I
Sbjct: 628  DRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLT--NDSNAHSKALTEELNLLHKEI 685

Query: 661  KEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRL----CHEFQDLQDDY 825
             ++  ++E  + + +  E++L   + +  +L ++  +L+ R  RL      + ++ Q  +
Sbjct: 686  SQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTF 745

Query: 826  SK------KMKQKEYEVQKLKNEVKFLTNMNTNLKAD-------KTQFSQKEKQYSQKYI 966
            S       K    E  V+ L+ EV  L +   +LK++       KT+      Q      
Sbjct: 746  SSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQS 805

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED 1146
              E  +  V+ ++ K+  E N +   +DK + +  H    ++ + NAQ  +    + +  
Sbjct: 806  ERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEAS 865

Query: 1147 QKDAHLE----------DRYHKVKEFMEQKLQ-------TSKNNDPSCSEAEALDNVLGL 1275
            Q+   ++          +R H   + +E++L+       T +  + + SE +  ++V+  
Sbjct: 866  QQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKE 925

Query: 1276 IENTMKTLEG------NSKYYSTTTKKCLKYVTGSSRLKENEH 1386
            +E T   L          K  S  ++  LK +  S   K+ ++
Sbjct: 926  LEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDY 968

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 57/290 (19%), Positives = 121/290 (41%), Gaps = 6/290 (2%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEET- 639
            N     + +  + ++L   + L+    N++S +        + K  +  VD   KLEET 
Sbjct: 1268 NELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETL 1327

Query: 640  ----EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ 807
                ++L + ++E  E+ D     N L++Q  E+   +  L+     LQE+   L  E  
Sbjct: 1328 NETKQLLDNKVQETNELNDR---FNRLKKQAHEKLNTSKELQSS---LQEQISNLISE-- 1379

Query: 808  DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS 987
              +DD  K++  K  E  +L +E+        +L+  + + +++  +  +  + ++  + 
Sbjct: 1380 --KDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEIE 1437

Query: 988  HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
                       E   L+ V+D    ++         QTN   +  A+  + E+QK   + 
Sbjct: 1438 SSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTN--RNVEAIKREFENQKTKFIA 1495

Query: 1168 DRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGL-IENTMKTLEGNSK 1314
            +   K +EF ++ ++ ++       E E  D  L + +E   K  E +S+
Sbjct: 1496 E---KTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSE 1542

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 62/266 (23%), Positives = 110/266 (41%), Gaps = 27/266 (10%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITH-ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK 585
            +DLA   + L + I+    N     E     I +L  ++ +   + ++K +    +HL+K
Sbjct: 487  TDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVIS---EHLIK 543

Query: 586  VTKQNQRQVDGRDKLEETEVLKSFIKEIEEV----------EDNKISINSLEQQLLEEKT 735
                 Q Q    + ++    L   ++E EE           EDN+I   + E  L  EK 
Sbjct: 544  FKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKV 603

Query: 736  ANNILR--------RDYYKL---QERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
              N+ +        RD +KL   ++R +    +  +    Y +     E  V+ L+N + 
Sbjct: 604  NENLEKNLQIVTKERDAFKLLVSEDRERNF--KSSNSVHKYHELKSYNETVVKDLENRLT 661

Query: 883  FLTN-MNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNM 1059
             LTN  N + KA   + +   K+ SQ  + IEKY S       + +   N ++ +  +N 
Sbjct: 662  QLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENE 721

Query: 1060 K---KIDHLERS-LQAQTNAQNSFSA 1125
            +   +   LE S LQ     Q +FS+
Sbjct: 722  QLRIRSSRLEDSLLQQDKETQKTFSS 747

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 70/337 (20%), Positives = 148/337 (43%), Gaps = 31/337 (9%)
 Frame = +1

Query: 385  KHISIS-SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQ 561
            +H  +S +IS+L +  + L      + + K+     ++  D +  +E+  K + +E  +Q
Sbjct: 1066 RHADVSKTISELREQNQRL------KNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQ 1119

Query: 562  --MAIDHLLKVTKQNQ---RQVD------------GRDKLEETEVLKSFIKEIEEVEDNK 690
              +A   +  +TKQNQ    Q+D              D+   +  L   ++   ++ D K
Sbjct: 1120 IDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTK 1179

Query: 691  ISI-----NSLEQQLLEEKTANNILRRDYYKLQERGKR---LCHEFQDLQDDYSKKMKQK 846
            I++     NSL+Q+L + +      +R    L+        L + +Q ++ D  +    +
Sbjct: 1180 INVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLR 1239

Query: 847  EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK---KE 1017
            E  V  L+NE+K   +    +  D  Q  + E    Q  +  E   + +K++  K     
Sbjct: 1240 ESNVT-LRNELKQALDEKDKIAKD-LQICRNELLPLQSNL--ESANNLIKEKDLKIASAN 1295

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVT--VQDEDQKDAHLEDRYHKVKE 1191
            DE  R K  +++ ++K  H + ++   T  + + +     + ++ Q+   L DR++++K+
Sbjct: 1296 DESQRWKTRLEEMIEK--HQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKK 1353

Query: 1192 FMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
               +KL TSK    S    E + N++   ++  K L+
Sbjct: 1354 QAHEKLNTSKELQSSLQ--EQISNLISEKDDIRKQLD 1388

>Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR023W
            (MYO1) - Class II Myosin [contig 11] FULL
          Length = 1907

 Score = 50.4 bits (119), Expect = 9e-06
 Identities = 67/317 (21%), Positives = 134/317 (42%), Gaps = 17/317 (5%)
 Frame = +1

Query: 466  RKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQN--QRQVDGRDKLEET 639
            ++AE ++  N  + L   E ++KKD     L++ +D   K+ +Q   +++ + + K +E+
Sbjct: 863  KEAELKQKLNESNELQ-QEIMQKKDTE---LKLKLDESNKLREQTFAEKEAELQQKFDES 918

Query: 640  EVLKS-FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ 816
            E L+  F+ E E ++       +   Q  EE   +  L   Y KL     +L ++  +L 
Sbjct: 919  EKLRQHFLAEKEALQKEYSEARAKADQNREETEKSQSL---YKKLLSENDQLKNQVTNLT 975

Query: 817  ---DDYSKKMKQKEYEVQKLKNEVKFLTN----MNTNLKADKTQFSQKEKQYSQKYIYIE 975
               DD  +  +  E +   L +++K L +      T +   KT+ S+ +K+  +    +E
Sbjct: 976  TKIDDGERSFRSIESDKASLHDQIKSLNSEVLSKTTEINELKTKLSESDKELERSLQGLE 1035

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD 1155
            K  +   +      +E   L+  +D++ ++   L  +LQA               +D++ 
Sbjct: 1036 KKFTSASKRLTSLVEENKSLRVSMDRSKREHAELHHNLQA---------------KDKEL 1080

Query: 1156 AHLEDRYHKVKEFM----EQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
              L DR  + +  +    +++   S       +EA+ L   L   +   + LE N     
Sbjct: 1081 KRLADRSEQTQSLVASLNKERADLSSEQGRLLNEAKQLREELASFKQKHQELEKNCTDLR 1140

Query: 1324 T---TTKKCLKYVTGSS 1365
            T   TT K L+    SS
Sbjct: 1141 TQLETTSKELEKARESS 1157

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 55/265 (20%), Positives = 114/265 (43%), Gaps = 16/265 (6%)
 Frame = +1

Query: 628  LEETEVLKSFIKEIEEVEDNKISINSLE---QQLLEEKTANNI-LRRDYYKLQERGKRLC 795
            LE T+ +    K  E+V++ +  + +LE   Q L EEK+A ++ L     +L    + L 
Sbjct: 792  LESTQEISKTRKIAEQVKNLEEKLKTLELQNQALGEEKSAISVNLASVKERLATESQELA 851

Query: 796  HEFQDLQDDYSKK--MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ------FSQKEKQY 951
             + +DL    +K+  +KQK  E  +L+ E+    +    LK D++       F++KE + 
Sbjct: 852  QKQKDLDSVLAKEAELKQKLNESNELQQEIMQKKDTELKLKLDESNKLREQTFAEKEAEL 911

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDH----LERSLQAQTNAQNSF 1119
             QK+   EK   H   E    + E +  +   D+N ++ +      ++ L      +N  
Sbjct: 912  QQKFDESEKLRQHFLAEKEALQKEYSEARAKADQNREETEKSQSLYKKLLSENDQLKNQV 971

Query: 1120 SAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTL 1299
            + +T + +D + +       K     + K   S+    +    E    +    +   ++L
Sbjct: 972  TNLTTKIDDGERSFRSIESDKASLHDQIKSLNSEVLSKTTEINELKTKLSESDKELERSL 1031

Query: 1300 EGNSKYYSTTTKKCLKYVTGSSRLK 1374
            +G  K +++ +K+    V  +  L+
Sbjct: 1032 QGLEKKFTSASKRLTSLVEENKSLR 1056

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 46/221 (20%), Positives = 92/221 (41%), Gaps = 7/221 (3%)
 Frame = +1

Query: 448  ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK 627
            +T+ T +  + ERS  +I+S       +K  L+++   +  + L K T+ N+ +     K
Sbjct: 971  VTNLTTKIDDGERSFRSIES-------DKASLHDQIKSLNSEVLSKTTEINELKT----K 1019

Query: 628  LEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ 807
            L E++  K   + ++ +E    S +     L+EE   N  LR    + +     L H  Q
Sbjct: 1020 LSESD--KELERSLQGLEKKFTSASKRLTSLVEE---NKSLRVSMDRSKREHAELHHNLQ 1074

Query: 808  DLQDDYSK---KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
                +  +   + +Q +  V  L  E   L++    L  +  Q  ++   + QK+  +EK
Sbjct: 1075 AKDKELKRLADRSEQTQSLVASLNKERADLSSEQGRLLNEAKQLREELASFKQKHQELEK 1134

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKN----MKKIDHLERSL 1089
              + ++ +      E  + +     N    +KK+  LE  L
Sbjct: 1135 NCTDLRTQLETTSKELEKARESSGNNQEGDVKKVQSLEEQL 1175

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
            similar to uniprot|P33420 Saccharomyces cerevisiae
            YPL174C NIP100 Large subunit of the dynactin complex
            which is involved in partitioning the mitotic spindle
            between mother and daughter cells putative ortholog of
            mammalian p150(glued)
          Length = 869

 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 85/407 (20%), Positives = 171/407 (42%), Gaps = 42/407 (10%)
 Frame = +1

Query: 283  CGFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHET 462
            CG + ++     D + + +         L  I +K+  +  ISD  +  E   +G+   +
Sbjct: 31   CGVELDKPSGKNDGSVEGIRYFNTNKTGLYGIFSKYEGVKKISDEEEPEE---LGLNLSS 87

Query: 463  NRKAECE--RSKNAIDSLYYHEQLEKKDLNEKSLQMAI-------------DHLLKV--- 588
            ++ + C+  R K  ID L   E+L K     KSLQ+ +             +H +++   
Sbjct: 88   SKSSSCDDVRLKRIIDKL--QEKLYKLHNECKSLQLQLASKKSLEDRITELEHSVELATI 145

Query: 589  ---TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRD 759
               T +   ++ G D L   +  ++ ++E+E V++  I    +E + L+++  + +    
Sbjct: 146  ENETLEEHNELLGHDLLSLKKRHEAVVEELEGVKEELILRRVIEDEELKKEDVDPVTLWK 205

Query: 760  YYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ----KLKNEVKFLTNMNTNLK---AD 918
              KL E          +     +K ++ +++EV+    KLK+E+  LTN   + K    D
Sbjct: 206  RSKLVEHALVKLQSSLEASRKVNKSLEGEKHEVEVENKKLKSEIFELTNQLDDAKKIITD 265

Query: 919  KTQFSQKEKQY-------SQKYIYIEKYMSHVKQEYNKKEDEC-------NRLKFVVDKN 1056
             T     E  Y       ++K I + + +  +KQ   K +D+           K V ++ 
Sbjct: 266  LTSQLAAEGSYNNIVDMLTEKNIQLTEEIEELKQALEKTKDKQMFDEKLERMYKEVEEEL 325

Query: 1057 MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS 1236
              +++ L+R++++   A N     T+Q+E+           K+K  +       K+N+  
Sbjct: 326  SNEVEDLQRAMESHKYALN-----TLQNENA----------KLKNLLSHAETIEKDNN-- 368

Query: 1237 CSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKE 1377
             SE++A    L +  + +K     + +     +K L Y  GS  LKE
Sbjct: 369  -SESQA--QSLSIEISRLKFQNYQNTFEKEMMEKSLMY-RGSVTLKE 411

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 90/416 (21%), Positives = 157/416 (37%), Gaps = 87/416 (20%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHE---------TNRKAECERSKNAIDSLYYHEQ--------L 528
            S  SDL +T   LA  +  E         T        +K AI +L  H Q        L
Sbjct: 545  SKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVL 604

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
             K+    K++Q + ++  K+T+       G+      ++ +S + E EE E N   +NS 
Sbjct: 605  TKERDAYKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSE 664

Query: 709  EQQLLEEKT----------ANNILRRDYYKL--------QERGKRLCHEFQDLQDDYSKK 834
             Q+LL +KT           +  L  +  K+        ++  + L   +  +QD+  K+
Sbjct: 665  IQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQ 724

Query: 835  --------------------------------------MKQKEYEVQKLKNEVKFLTNMN 900
                                                   K+    +++L  E   LT + 
Sbjct: 725  DTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILV 784

Query: 901  TNLKA-----DKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN--- 1056
            T L+      DK   ++ EK Y +K   +E   S ++ + ++K++E N      D     
Sbjct: 785  TQLQTLQGERDKL-LAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQW 843

Query: 1057 -MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDP 1233
              +KID L  +L+  T+   S  A T +D + +   LE R  +V E   Q        D 
Sbjct: 844  YQEKIDSLNETLKVVTSQLES-QAQTTRDLESQKKLLEGRLKEV-ETKAQSYDVLNQTDD 901

Query: 1234 SCSEAEAL-----DNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEH 1386
              ++ EAL      + + L +   +  E  S+Y S   ++ L  +T +    +NEH
Sbjct: 902  VLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKS--AEEALSAITNAFERFKNEH 955

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 53/271 (19%), Positives = 111/271 (40%), Gaps = 36/271 (13%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-----RDKLEETEVLKSFIKEIEEV 678
            +++ ++  D   +  Q  ID L +  K    Q++      RD   + ++L+  +KE+E  
Sbjct: 830  FNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETK 889

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQ-----------------ERGKRLCHEFQ 807
              +   +N  +  L + +     L +   KLQ                 E    + + F+
Sbjct: 890  AQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFE 949

Query: 808  DLQDDYSK---KMKQKEYE----VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI 966
              ++++SK    MK+KE E    V+ LK+++   +N+N  L   K QF  ++ +   + +
Sbjct: 950  RFKNEHSKDFGNMKKKEDELVGQVEALKHQI---SNLNNELGHQKKQFDSEKNELENQLV 1006

Query: 967  YIE-------KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSA 1125
             ++           H +Q+  K   + N+     +K     ++ E+ LQ   +   + S 
Sbjct: 1007 SLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQ---ENYEQELQRHADVSKTIS- 1062

Query: 1126 VTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS 1218
              +++E QK  +         E +E+ L  S
Sbjct: 1063 -QLREESQKYKNQASVLQSSIEQLEKTLDES 1092

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 72/387 (18%), Positives = 155/387 (40%), Gaps = 25/387 (6%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            +Y+ RF++ D+   ++ + +    +L N         +  D+    E+L   +    N  
Sbjct: 945  EYKSRFQSHDNLVAKLTEKLK---SLAN---------NYKDMQAENESLIKAVEESKNES 992

Query: 472  A-ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVT---KQNQRQV-----DGRD 624
            + +    +N IDS+   ++ E   +   S++  I+ L K     +Q + ++       +D
Sbjct: 993  SIQLSNLQNKIDSM--SQEKENFQIERGSIEKNIEQLKKTISDLEQTKEEIISKSDSSKD 1050

Query: 625  KLE-ETEVLKSFIKEIEEVED---NKIS-INSLEQQLLEEKTANNILRRDYYKLQERGKR 789
            + E +  +LK  ++      D   NKIS +    ++L  E  A   L+ +     E  ++
Sbjct: 1051 EYESQISLLKEKLETATTANDENVNKISELTKTREELEAELAAYKNLKNELETKLETSEK 1110

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT-----------NMNTNLKADKTQFSQ 936
               E ++ ++   ++  Q E E  + K ++  L            ++   LK  + Q + 
Sbjct: 1111 ALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHEDLAAQLKKYEEQIAN 1170

Query: 937  KEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNS 1116
            KE+QY+++       +S +  E    + E   +K       KK D LE  ++A  +    
Sbjct: 1171 KERQYNEE-------ISQLNDEITSTQQENESIK-------KKNDELEGEVKAMKSTSEE 1216

Query: 1117 FSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKT 1296
             S +   + D  +  +++   K +      L++ K+ +    + + L +     E  +  
Sbjct: 1217 QSNLKKSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSE 1276

Query: 1297 LEGNSKYYSTTTKKCLKYVTGSSRLKE 1377
            LE   K       K L+    S ++KE
Sbjct: 1277 LEDKLKASEDKNSKYLELQKESEKIKE 1303

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 71/321 (22%), Positives = 136/321 (42%), Gaps = 23/321 (7%)
 Frame = +1

Query: 490  KNAIDSLYYH--EQLEKKDLNEKSLQMAIDHLLKVT-KQNQRQVDGRDKLEETEVLKSFI 660
            K+ ID+L     E  +K + NE SL  +I  +   T K  + Q +   K +E   L+  +
Sbjct: 1222 KSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKL 1281

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANN----ILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            K  E+     + +    +++ EE  A      I       L +  ++   E   L+   S
Sbjct: 1282 KASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKTSS 1341

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
            ++ K  E +++KLKNE++            K Q  +KE++       + +  S + QEY+
Sbjct: 1342 EERKNAEEQLEKLKNEIQI-----------KNQAFEKERK------LLNEGSSTITQEYS 1384

Query: 1009 KK----EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRY 1176
            +K    EDE  RL+   +   K+ID          N ++    V++ +    D  LE++ 
Sbjct: 1385 EKINTLEDELIRLQNENELKAKEID----------NTRSELEKVSLSN----DELLEEKQ 1430

Query: 1177 HKVK----EFMEQKLQTSKNNDPSCS-------EAEAL-DNVLGLIENTMKTLEGNSKYY 1320
            + +K    E +  K + ++N++   S       + E+L + +    E+  K  EG  K  
Sbjct: 1431 NTIKSLQDEILSYKDKITRNDEKLLSIERDNKRDLESLKEQLRAAQESKAKVEEGLKKLE 1490

Query: 1321 STTTKKCLKYVTGSSRLKENE 1383
              ++K+  +       +K+ E
Sbjct: 1491 EESSKEKAELEKSKEMMKKLE 1511

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_5.414
            YDR356W
          Length = 1009

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 82/410 (20%), Positives = 165/410 (40%), Gaps = 102/410 (24%)
 Frame = +1

Query: 397  ISSISDLAQTFETLAVGI-------THETNRKAECERSKNAIDSLYYHEQLEKKDLNEKS 555
            +  I  L +T  TL +         +  T      E +K  ++      Q    +L + S
Sbjct: 460  LEKIKQLEETNHTLQINFDDLQKDNSKLTRNLKNSEENKKTLEIQVQSMQQTIDNLEKAS 519

Query: 556  LQMAIDHLLKVTKQ----NQRQVDGRDKL----EETEVLKSFIKEI------------EE 675
            +Q+  D L K+T++    N++ VD ++++    ++ E LKS  KE             +E
Sbjct: 520  IQLTSD-LKKLTREVHDLNEKDVDSQEQISRLQDKIEKLKSVHKEELKIVNEELDGKRKE 578

Query: 676  VEDNKISINSLEQQLLEE---KTANNILRRDYYKLQERGKRLCHEFQDLQD----DYSKK 834
            + +    I  L+ QL E     T ++I  +   + Q++ + L  +  DL+D    D +K 
Sbjct: 579  LIETNFQIKQLQNQLFENVKNSTTSDINEKVIKEKQDQIEDLQRKLADLRDAIRTDQNKN 638

Query: 835  MKQ-----KEYEVQ------KLKNEVKFLTNMNTNLKAD-----------KTQFSQKEKQ 948
            +K+     KE E++      KLK +V+ L N    LK             +TQ  ++  +
Sbjct: 639  LKKFDLRIKETEMKYTEELGKLKEDVRLLKNERAKLKNQLETIKESKVNMETQHDRELNE 698

Query: 949  YSQKYIYIEKYMSH-VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT-------- 1101
            +  K+  + K  ++ + ++ NK++   N +   +++N + +  LE +LQ Q         
Sbjct: 699  WISKFNSMSKEHNNLINRQDNKRDSYRNEIMETLNENKRLLAQLE-ALQNQRSDMEIEIT 757

Query: 1102 --------------NAQNSFSAVTVQ---------DEDQKDAHLEDRYHKVKE------- 1191
                          N  ++  ++T +         + D+K+  + DRY  ++E       
Sbjct: 758  KLSKSRDAYKDTLKNTLSNLDSITKEFSEYKRRNKNNDEKNESMSDRYQNMQEKLMRRIN 817

Query: 1192 -------FMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYY 1320
                    +E++LQ    +    ++AE   N       ++   + N  YY
Sbjct: 818  QLEDDNLLLERRLQNQPLSSRGTNDAERFSNA------SVSKYQDNIDYY 861

 Score = 36.2 bits (82), Expect = 0.22
 Identities = 40/151 (26%), Positives = 68/151 (45%), Gaps = 12/151 (7%)
 Frame = +1

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHE 801
            +K  E EV     KE + V+++K+  +S  Q  L    A + L+  + KLQE   +  HE
Sbjct: 224  EKHSEAEVKIDKKKEAKLVKEHKVLQDSFNQTRL----ALDTLQNQFKKLQEEKAKADHE 279

Query: 802  FQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNT-----------NLKADKTQFSQKEKQ 948
             ++L   + +++  K  ++ ++  E   L N +T           +L  D T  SQ    
Sbjct: 280  IRNLTTQHHEELDTKLSQLDRIIAEKDDLINKDTAKIHKLEEQLNSLNNDTT--SQSTID 337

Query: 949  YSQKYIYIEKYM-SHVKQEYNKKEDECNRLK 1038
              +K +  EK M   VK E    E++ + LK
Sbjct: 338  SLKKQLIEEKSMLERVKTENETLENKIHDLK 368

>TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] {ON}
            Anc_8.636 YOR216C
          Length = 476

 Score = 49.3 bits (116), Expect = 1e-05
 Identities = 44/235 (18%), Positives = 102/235 (43%), Gaps = 10/235 (4%)
 Frame = +1

Query: 580  LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRD 759
            LKV  +   Q++     EE   LKS ++  ++ ++ +  +   E   + E  A   L+ +
Sbjct: 64   LKVNNEANEQIEKLQ--EEIRTLKSQLEIQKKEQEVQKEVPQQETPDVTETQAYKDLKSE 121

Query: 760  YYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
              + + +   L +    ++  +SK MK+ + E++ +K ++    + N  LK+     S++
Sbjct: 122  RDEYENQYNNLLNRISSMKTVFSK-MKESQEELETVKEQLSEYESQNIRLKSKADLLSKE 180

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID----------HLERSL 1089
              ++ +  + + +  S++ +E    + EC + K  +DK   +++          ++ R  
Sbjct: 181  RTEFEKTILTLNEEFSNLDEERENLQIECKKYKEELDKLTNQLEEASDNHLRELNIHREA 240

Query: 1090 QAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEA 1254
             AQ  AQ     VT+ +  Q  + L +    +   +E       +   + +E EA
Sbjct: 241  NAQLEAQLQELVVTLGNNKQDLSILNEEKKDLISTLESNAIEKDSLQKTINELEA 295

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 39/201 (19%), Positives = 90/201 (44%), Gaps = 18/201 (8%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL 723
            +++ L+   + L +   QN R     D L          KE  E E   +++N  E   L
Sbjct: 149  SQEELETVKEQLSEYESQNIRLKSKADLLS---------KERTEFEKTILTLNE-EFSNL 198

Query: 724  EEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK-------QKEYEVQKL----- 867
            +E+  N  L+ +  K +E   +L ++ ++  D++ +++        Q E ++Q+L     
Sbjct: 199  DEEREN--LQIECKKYKEELDKLTNQLEEASDNHLRELNIHREANAQLEAQLQELVVTLG 256

Query: 868  --KNEVKFLT----NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECN 1029
              K ++  L     ++ + L+++  +    +K  ++    +EK  +  ++E  +K  E N
Sbjct: 257  NNKQDLSILNEEKKDLISTLESNAIEKDSLQKTINELEAELEKATAQFEEEKQQKHMEIN 316

Query: 1030 RLKFVVDKNMKKIDHLERSLQ 1092
             L+  +DK+      L ++++
Sbjct: 317  ALRAQLDKSEDSNSELTKTIE 337

>ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa]
            {ON} some similarities with uniprot|P47035 Saccharomyces
            cerevisiae YJL076W NET1 Core subunit of the RENT complex
            which is a complex involved in nucleolar silencing and
            telophase exit stimulates transcription by RNA polymerase
            I and regulates nucleolar structure
          Length = 1454

 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 7/198 (3%)
 Frame = +1

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            ED+K    +L+Q  LE K       +  +   +R K      +  QD+   ++KQ+E EV
Sbjct: 836  EDSKRLKETLKQADLEAK-------QKAFNESKRFKEEAEAKKKQQDEEKLRVKQQEAEV 888

Query: 859  QKLKNEVKF-------LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
            QK K + +          N    L+  K +F +K+KQ        E+     ++E N+K 
Sbjct: 889  QKKKQQEELERLKQQQFKNQQEELERKKREFHEKKKQ--------EELERQRREEENRKR 940

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
            +E NR K   +   K+I+ LE+  Q +   +        + E+++    E+   K ++ +
Sbjct: 941  EEENRRK-EAEAEKKRIEALEKQRQEKLKLKQQEELDKKKQEEEEKRRKEESEKKRQQEL 999

Query: 1198 EQKLQTSKNNDPSCSEAE 1251
            E+K +   +      E E
Sbjct: 1000 EKKRKEELDRKKQQEEME 1017

>Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)
            [1788 nt, 596 aa]
          Length = 595

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 68/312 (21%), Positives = 128/312 (41%), Gaps = 18/312 (5%)
 Frame = +1

Query: 403  SISDLAQTFETLAVGITH--ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDH 576
            S  D     E + + I H  E N   E E       ++  ++ +E+KD  ++ +    D 
Sbjct: 41   SKDDTGNKIEIIDLDIDHPIEKNNLKEVETELKNDSTVKLNDSVEQKDNKQEVVDSDKDE 100

Query: 577  LLKVTKQNQRQVDGRDKLEETEVLKSFI-------KEIEEVEDNKISINSLEQQLL--EE 729
              K++K++   +  R+KL+E + LK          KE + +E+     + LE++    EE
Sbjct: 101  DTKLSKKDLAAIR-REKLKEEKELKRLEREKEKQKKEAQRLEEKSKRESKLEEEKRKREE 159

Query: 730  KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNL 909
            K A    RR+  KLQ             +++  +K +++  E ++ + E K        L
Sbjct: 160  KAAEVKRRREALKLQ-------------KEEEKRKKEEERLETKRKREEEKLKIEEEKRL 206

Query: 910  KADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNM---KKIDHLE 1080
            K +      KE+  S+   + +K      +E  + + E   LKF   + +   K     E
Sbjct: 207  KEE-----AKERAQSRIGNFFKKVRDSSNEESTRSDYEKIFLKFHAKEGINISKGFKLSE 261

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRY----HKVKEFMEQKLQTSKNNDPSCSEA 1248
             +L+ + N  +S    T +D +     ++ R     +K+K      LQ   + D +  E 
Sbjct: 262  STLKEKINEIDSLLRETNEDNEDVSQWIKSRTNKRGYKIKSTAVSVLQQMTSKDKTDEEL 321

Query: 1249 EALDNVLGLIEN 1284
            + L   L L+ N
Sbjct: 322  QVL---LSLVPN 330

 Score = 39.3 bits (90), Expect = 0.022
 Identities = 45/191 (23%), Positives = 80/191 (41%), Gaps = 15/191 (7%)
 Frame = +1

Query: 799  EFQDLQDDYS-KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE 975
            E  DL  D+  +K   KE E + LKN+     N +   K +K +    +K    K    +
Sbjct: 50   EIIDLDIDHPIEKNNLKEVETE-LKNDSTVKLNDSVEQKDNKQEVVDSDKDEDTKLS--K 106

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF------------ 1119
            K ++ +++E  K+E E  RL+   +K  K+   LE   + ++  +               
Sbjct: 107  KDLAAIRREKLKEEKELKRLEREKEKQKKEAQRLEEKSKRESKLEEEKRKREEKAAEVKR 166

Query: 1120 --SAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMK 1293
               A+ +Q E++K    E+R    ++  E+KL   K  +    + EA +     I N  K
Sbjct: 167  RREALKLQKEEEKRKKEEERLETKRKREEEKL---KIEEEKRLKEEAKERAQSRIGNFFK 223

Query: 1294 TLEGNSKYYST 1326
             +  +S   ST
Sbjct: 224  KVRDSSNEEST 234

>Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {ON}
            YJR134C (REAL)
          Length = 708

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 58/313 (18%), Positives = 139/313 (44%), Gaps = 8/313 (2%)
 Frame = +1

Query: 394  SISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID 573
            ++ + ++L   +  L   +   T++  + ++ ++ +++  +  ++E+KD   KSLQ ++D
Sbjct: 215  NVDNFNELQSLYHNLQGQLAEATDKLKDTDKQRDLLET--FERKIEEKDGLIKSLQQSLD 272

Query: 574  HLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILR 753
             + K+ ++ + +     ++E+  + ++ I ++  +E        LEQ  +E   +N I  
Sbjct: 273  DVEKLLEKERTEF----QMEKKALQEATIDQVTALE------TKLEQLRIELDNSNQI-- 320

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS 933
                     GK    +  D  D+   ++KQ       L  E          L++ K  ++
Sbjct: 321  -------SNGKSSRDDGVD-NDENGSEVKQHTSSQYNLLKE---------QLESSKANWN 363

Query: 934  QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQN 1113
              E   + K + +E +++  ++E  + E+     +  +D +    + LER  +   NA +
Sbjct: 364  SIEYALNIKIVDLENHLTSTRKEKTRFEE---AYQTALDSSETLSEQLEREKENHLNAAS 420

Query: 1114 SFSAVTVQDEDQKDA--HLEDRYHKVKEFME-QKLQTSKNNDPS-----CSEAEALDNVL 1269
                +  Q E  K +   + D Y+ +K+  + Q+ Q  KN+D S      S  + ++   
Sbjct: 421  QVKELERQIETLKLSLQSVNDDYNLLKKKYDIQRAQLEKNDDNSKPHQENSVGKVIEKTP 480

Query: 1270 GLIENTMKTLEGN 1308
              + N++ ++ GN
Sbjct: 481  SELTNSLNSMNGN 493

>KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} similar to
            uniprot|Q06704 Saccharomyces cerevisiae YLR309C IMH1
            Protein involved in vesicular transport mediates
            transport between an endosomal compartment and the Golgi
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 927

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 46/229 (20%), Positives = 99/229 (43%), Gaps = 5/229 (2%)
 Frame = +1

Query: 415  LAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTK 594
            L + +ETL      +TN   + E  +   D L     ++ K+LN+K+L +  D L     
Sbjct: 617  LNEKYETLQ---DMKTNSHEQVELIRRQCDEL----NVKIKELNKKNLSLE-DEL----- 663

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ 774
             N+     +++ +E   ++  + E +   D    +  LEQ         N L  +     
Sbjct: 664  -NESVSALQERTQEASSMRRLLAERQS--DKDFQVQKLEQSFAAASEEKNRLESELALHD 720

Query: 775  ERGKRLCHEFQDLQDDYSKKM-----KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
             + KR  +E +++ DD   ++     K+K+YE      EV  LT++N  ++  + + SQ 
Sbjct: 721  AKTKRTINELKEVNDDLRVQVQTLIAKEKDYE-----QEVARLTSLNKEMQTTRNESSQS 775

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS 1086
              +  +    ++  +   +++  + E     +K + D   KK++ + ++
Sbjct: 776  SNELKEALANVKAALMTSEKKLREMESSSENIKELNDDLTKKLERISKN 824

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 65/311 (20%), Positives = 140/311 (45%), Gaps = 3/311 (0%)
 Frame = +1

Query: 454  HETNRKA-ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR-QVDGRDK 627
            HET +   E +     I S Y  + L     N +SLQ+ ++   K   + ++ +VD    
Sbjct: 328  HETLKDLQETQEKLKVIQSKY--DDLVAASGNSESLQLELE---KTRGEIEKLEVDNERL 382

Query: 628  LEETEVLKSFIK-EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEF 804
            L E +  K  +K + EEVE+ K  + ++  +L+E K   + ++      +   K L  + 
Sbjct: 383  LRELQESKKELKFKSEEVENVKDLLKTVGNELVEAK---DTIKNSNGASETEMKHLKSQL 439

Query: 805  QDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYM 984
            + L+   S+ +K  E    +LK +V        +L+ +K   S+ EK+       + K+M
Sbjct: 440  ESLRSQNSENIKSYETTQSELKQKV-------ASLQKEK---SETEKELDDLRTTLNKHM 489

Query: 985  SHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHL 1164
                +     +    ++  + ++N+   D + ++L A   +++S  + ++  +++   +L
Sbjct: 490  QEKSKLLTDLKQSHEKMSILNNENITLSDQV-KNLNALKRSESSLKS-SLSQKEKTIVYL 547

Query: 1165 EDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCL 1344
            E +   VKE+  ++  +S+    +  E   L N + L+    ++L+   +   T+ +K +
Sbjct: 548  EQQ---VKEYSSKEEASSRALREAKMENGRLSNKISLVSKECESLKNELEKSKTSLEKFI 604

Query: 1345 KYVTGSSRLKE 1377
            K   G S   E
Sbjct: 605  KENGGLSERLE 615

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 59/285 (20%), Positives = 114/285 (40%), Gaps = 18/285 (6%)
 Frame = +1

Query: 427  FETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR 606
            ++ L     +  + + E E+++  I+ L    +   ++L E   ++          ++  
Sbjct: 348  YDDLVAASGNSESLQLELEKTRGEIEKLEVDNERLLRELQESKKELKFKSEEVENVKDLL 407

Query: 607  QVDGRDKLEETEVLKSFIKEIE-EVEDNKISINSLEQQLLEE----KTANNILRRDYYKL 771
            +  G + +E  + +K+     E E++  K  + SL  Q  E     +T  + L++    L
Sbjct: 408  KTVGNELVEAKDTIKNSNGASETEMKHLKSQLESLRSQNSENIKSYETTQSELKQKVASL 467

Query: 772  QERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLK----------NEVKFLTNMNTNLKADK 921
            Q+       E  DL+   +K M++K   +  LK          NE   L++   NL A K
Sbjct: 468  QKEKSETEKELDDLRTTLNKHMQEKSKLLTDLKQSHEKMSILNNENITLSDQVKNLNALK 527

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN---MKKIDHLERSLQ 1092
               S  +   SQK   I      VK+  +K+E     L+    +N     KI  + +  +
Sbjct: 528  RSESSLKSSLSQKEKTIVYLEQQVKEYSSKEEASSRALREAKMENGRLSNKISLVSKECE 587

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
            +  N     S  +++   +++  L +R   + E  E  LQ  K N
Sbjct: 588  SLKNELEK-SKTSLEKFIKENGGLSERLEILNEKYE-TLQDMKTN 630

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/290 (20%), Positives = 118/290 (40%), Gaps = 21/290 (7%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDH--------LLKVTKQNQRQVDGRDKLEETEVLKSFI---- 660
            HE+L +K  +  S  M++          L  +T+        RD LE  +   SF     
Sbjct: 769  HEELVEKYQSLTSSHMSLKENVSSLEIELKSITESLNEMTKLRDALETKDKDNSFALQEY 828

Query: 661  -----KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
                 K+ E +   +  + ++  Q  + +   N + +D + L    + +  + + LQ + 
Sbjct: 829  KSTIHKQEEAIRTLEKELETISSQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEK 888

Query: 826  SKKMKQKEYEVQKLKNEVKF----LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
             K     + E + LK+E+      +  +N NL   KTQ S   ++  Q        +S  
Sbjct: 889  DKSNSDHQKETKSLKDEITKKIIEIKTLNENLVKTKTQHSALSEEKEQ--------ISKE 940

Query: 994  KQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
              EY  +    + L   + + +K + +  R LQA+  +      VT  + D + ++L+D+
Sbjct: 941  LVEYKSRFQSHDNLVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQDK 1000

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
            +  +    ++  QT K +     + + L   +  +E+  K  E  S+Y S
Sbjct: 1001 FDSLSR-EKESFQTEKEH--LTDDIKELKETISRLEH--KNEETTSRYTS 1045

 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 70/321 (21%), Positives = 136/321 (42%), Gaps = 29/321 (9%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLL-KVTKQNQRQVDG-RDKLEETEVLKSFIKEIEEVEDNKI 693
            EQ+ K+ +  KS   + D+L+ K+T++ +   +  RD   + E L   I+  +   D ++
Sbjct: 935  EQISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQL 994

Query: 694  S-----INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            S      +SL ++    +T    L  D  +L+E   RL H+ ++    Y+      E ++
Sbjct: 995  SNLQDKFDSLSREKESFQTEKEHLTDDIKELKETISRLEHKNEETTSRYTSAKDDYESQI 1054

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK 1038
             +LK +++  T   T    +  + S+  K      + +E   S  K +   K +   +  
Sbjct: 1055 NQLKEQLETAT---TTQDDNMDKISELSKNIRNLEMLLETCKSS-KHDLQTKLEASEKTL 1110

Query: 1039 FVVDKNMKKIDHLERSLQAQT-NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT 1215
              + +N +++   +  L+ +  N +   S +    E  +  H +D   +V E+ +Q    
Sbjct: 1111 AEMHENEERLKEEKAQLEKEVVNTKKELSTLRENFESLEKEH-KDSVTQVGEYEKQITDK 1169

Query: 1216 SKNNDPSCS-----------EAEAL----DNVLGLIENTMKTLEGNSKYYSTTTK----- 1335
            +K  + + S           E EAL    DN+ G +E   +TLE  S    +T +     
Sbjct: 1170 AKEYNENISKLNDDIRSIQQENEALCKNNDNLKGEVEQVKQTLEEQSNLRESTVEALNTQ 1229

Query: 1336 -KCLKYVTGSSRLKENEHITN 1395
             K L+    SS  K +E + N
Sbjct: 1230 IKDLEVKNQSSEAKLSESVKN 1250

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 59/284 (20%), Positives = 117/284 (41%), Gaps = 13/284 (4%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKS----------LQMAIDHLLKVTKQNQR 606
            ++N + +  + +N I       + E+K LNE S          + M  D L K+  +N+ 
Sbjct: 1342 KSNLEEQLGKLRNEIKIKSQAFEKERKLLNEGSSTITQEYSEKINMLEDQLNKLENENES 1401

Query: 607  QVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGK 786
            +    D   + E+ K+ +   E +E+ +  I S++ ++L  K           K+ E   
Sbjct: 1402 KTRLIDT-SKNELEKATLSHDEILEEKRNEIKSMKDEILSYKE----------KINEANT 1450

Query: 787  RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI 966
            +L    +D  +  S  +K++   VQ+ K EV+                        +K  
Sbjct: 1451 KLLSTERD-HESRSNSLKEQLEAVQESKAEVE------------------------RKMN 1485

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF---SAVTVQ 1137
             +E+  +H K E NK ++    LK  ++ N KK++ L  S +        +   S + ++
Sbjct: 1486 EMEEESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQYTKNSQIDIK 1545

Query: 1138 DEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVL 1269
            +   +   LE +  + K+ +E+     K+   S S+ EA+   L
Sbjct: 1546 ELQNEKTDLESQIIEFKKKIEELHGKLKDEAESNSKTEAIQQEL 1589

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 65/331 (19%), Positives = 125/331 (37%), Gaps = 47/331 (14%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVT----KQNQRQVDGRDKL 630
            N K E E  K  +       + E+K LNE S  +   +  ++T    K +Q +++ + K 
Sbjct: 1458 NDKEEVESVKKDLQEKVQAFEKERKLLNEGSDAVTKQYSERITVLEDKVHQTELEVQRKN 1517

Query: 631  EETEVLKSFIKEIE-----EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLC 795
            +E E  KS   E       ++E+  + ++SL+  + E++ A   L  D    +E G +  
Sbjct: 1518 KELESAKSAADEASGELRNQLEEKVVEVSSLKSTIGEQEKAIKKLESDLTDSRESGNKKI 1577

Query: 796  HEFQDLQDDYSKKMKQKEYEVQ-------------------------KLKNEVKFLTNMN 900
             +     +   K +  K+ E++                         K++N  K L  + 
Sbjct: 1578 EDLNGELEALKKALSDKQAEIEANKSDLNKRAGERKELEDTIATLQKKVENSSKALQQLE 1637

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
             +  + K     +E    +K   IEK     K    K ED+  +L  +  +     ++LE
Sbjct: 1638 NSTDSSK---KNQENLIKEKDTNIEKLEVAAKDLRKKDEDKSKQLAALESEKSSMKENLE 1694

Query: 1081 RSLQAQTNAQNSFSAVTVQDE------DQKDAHLE-------DRYHKVKEFMEQKLQTSK 1221
            ++++ +  +   F +     E      D+    LE        R  K+ E  E+K +  K
Sbjct: 1695 KNVKEKDESIAQFKSQVADMESLKKELDENTNKLERMKFEEKSRIEKLTEITEEKKKIQK 1754

Query: 1222 NNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
              +    +A+     L    + +K  E   K
Sbjct: 1755 ELEKRSEDAQNSRTELEQKTDELKRYEAEKK 1785

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 66/317 (20%), Positives = 125/317 (39%), Gaps = 19/317 (5%)
 Frame = +1

Query: 421  QTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQN 600
            Q  E L V I     R A     KNA+  +    + + K  +  +L   +   LK   ++
Sbjct: 872  QNLEALQVNIKKAEERIASLNSEKNAL--IKESGEWKSKFQSHDNLISKMTEKLKSFSES 929

Query: 601  QRQVDG-RDKLEET---------EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
             +++   RD L  +           L +   E+  +   K+ +NS +Q+LLE+ ++   L
Sbjct: 930  YKELQNERDSLSRSLHEASSNSSNELTALKNELATLSAEKVKLNSEKQELLEQVSS---L 986

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
               Y  L +R +    +     +   + +   + +V +LK     +T    NL+     F
Sbjct: 987  NSSYESLSKRHQDETSDLNVEVEKLKETVSHLKVQVDELKTSRDQITENANNLQEQCKIF 1046

Query: 931  -SQKEKQYSQKYIYIEKYMSHVKQEY-------NKKEDECNRLKFVVDKNMKKIDHLERS 1086
              Q E Q ++K    ++YM  +KQ +        K   E   L      N K+++ L++ 
Sbjct: 1047 EGQIENQEAEKKEAEKRYM-ELKQNFQVSTTDLEKLAKEKQELNDAKGSNEKELNKLKKD 1105

Query: 1087 LQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNV 1266
            L+ +     S +    + E   D          ++  E           + S ++ L+N 
Sbjct: 1106 LEGKEQKLKSITERAQELEKTLDEQRNSNADSERKLKENIKALEHQKKEAISNSKELENE 1165

Query: 1267 LGLIENTMKTL-EGNSK 1314
            L  ++N  K+L E N+K
Sbjct: 1166 LDQLKNKHKSLDEQNTK 1182

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 58/266 (21%), Positives = 109/266 (40%), Gaps = 37/266 (13%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR--DKLEETEV 645
            A+ E  K  +D      +LE+    EKS    +  + +  K+ Q++++ R  D       
Sbjct: 1712 ADMESLKKELDE--NTNKLERMKFEEKSRIEKLTEITEEKKKIQKELEKRSEDAQNSRTE 1769

Query: 646  LKSFIKEIEEVE-DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
            L+    E++  E + K++I  LE+ L E++        +   L +  K L  E +     
Sbjct: 1770 LEQKTDELKRYEAEKKLTIGKLEKLLSEKERIIAKFEAEIADLSKSNKDLKTELEQ---- 1825

Query: 823  YSKKMKQK---EYEVQKLKNEVKFLTNMNTNLKAD------------------------- 918
            +SKK+      E + Q+LK+E+K L   +  LKAD                         
Sbjct: 1826 HSKKLSNSSSIEEKNQELKSELKTLKKDSDALKADLEEVRGSINKHEEARRLSMEGKHSL 1885

Query: 919  KTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQ 1098
            +++  Q  K+       IE+     +++  + + E  +LK  +DK   +    ++    +
Sbjct: 1886 ESELEQAYKRLQSSNTLIEEKQKEFEEKEKRMKKESEQLKSELDKLRLEASEPKKENGKE 1945

Query: 1099 TNAQNSFSA------VTVQDEDQKDA 1158
            TN  N  S+      + V D D+K+A
Sbjct: 1946 TNNTNEGSSEIDDLMLLVSDLDEKNA 1971

>TDEL0G01570 Chr7 complement(309710..311722) [2013 bp, 670 aa] {ON}
            Anc_6.188 YGL086W
          Length = 670

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 63/301 (20%), Positives = 125/301 (41%), Gaps = 21/301 (6%)
 Frame = +1

Query: 382  TKHISISSISDLAQTF-ETLAVGITHETNRKAECERSKNAIDSL-----------YYHEQ 525
            T+ + + +   L + + E +AV      N + E       ID+L           Y  E+
Sbjct: 143  TQRMELRNCKSLLERYKEAIAVKSEEINNLQREKSEMSGEIDALRVSRLVMAHHNYSTEE 202

Query: 526  LEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS 705
            L++  +  KSLQ  I +  ++ + N +Q +   KL     + S  ++    E+ K+  N 
Sbjct: 203  LQELTVINKSLQDQIQYTKELEEVNLQQANELKKLR----ISSESQQFWRTENGKLQ-NK 257

Query: 706  LEQQ-LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
            LEQ  LLE+K     L     K Q     + +E +D  +D  +++K  +  +  L +E +
Sbjct: 258  LEQTWLLEKKLEEIQLENINLKSQLASWDIYNEDKDRPEDIVRELKLAKDTLVVLTDENE 317

Query: 883  FLTNMNTNLK-------ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
             +   N NLK        ++ Q     K Y    I  ++    ++Q+     +EC  L+ 
Sbjct: 318  KIHLDNNNLKILNDELALERNQLLDLNKNYETSIINFKRLNHEIEQQKQLSFEECKLLRK 377

Query: 1042 VVDK-NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS 1218
             +D+     ++  +    A T    +F ++    ++Q +   E+      + + Q+ Q+ 
Sbjct: 378  QLDELTAFNVEAGQAEKGANTEEVKNFESIVDGYKNQTEDLTEELRKLNDQLLSQEPQSK 437

Query: 1219 K 1221
            K
Sbjct: 438  K 438

>TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {ON}
            Anc_3.393 YBR130C
          Length = 481

 Score = 48.1 bits (113), Expect = 3e-05
 Identities = 56/238 (23%), Positives = 104/238 (43%), Gaps = 9/238 (3%)
 Frame = +1

Query: 562  MAIDHLLKVTKQNQRQVDGRDKL----EETEVLKSFIKEIEEVEDNKISINSLEQQLLEE 729
            ++ID   KV K N  +      +      ++V++S   +I+ + +  + +      LLE+
Sbjct: 47   VSIDGSPKVNKNNSSKAAASPSIGISSSSSKVIESLHDQIDTLTNTNLQLTIQSHSLLEK 106

Query: 730  KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK---MKQKEYEVQKLKNEVKFLTNMN 900
              A       ++   E    L HE ++L    S+K   +K  E E+ +LK +   +   N
Sbjct: 107  LDAAQQKESQFH---ENITSLRHENENLNSMLSRKTRKLKDTEDELNELKQKFDQMLKEN 163

Query: 901  TNLKADKTQFSQKEKQ-YSQKYIYIEKYMSHVK-QEYNKKEDECNRLKFVVDKNMKKIDH 1074
            T+LK++  Q + KE Q   Q  +Y  +Y + V+ Q+Y +     N     V +  ++I+ 
Sbjct: 164  TSLKSNVEQSTLKETQLQEQSELYKAQYDAIVESQQYYR-----NHYNSEVTELKQQIEE 218

Query: 1075 LERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA 1248
            L++S   Q N         +  +D+ D H   +Y  +KE  + +       D  C EA
Sbjct: 219  LKKS---QINQLQKIKEHHLSIDDKMD-HFHKKYKDMKELEDSRYAFL---DVKCQEA 269

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 55/264 (20%), Positives = 111/264 (42%), Gaps = 21/264 (7%)
 Frame = +1

Query: 586  VTKQNQRQVD------GRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
            +T +N+++++      GRD  +E + +K+   E  ++ D  + I      + EE    N 
Sbjct: 659  LTPENKKKIEDEIAGLGRDIQKEKDEIKNIENENTKLNDEIVVIKRKLALIQEELKKLNS 718

Query: 748  LRRDYYKLQERGKRLCHEFQDL----QDDYSKKMKQKEYE-VQKLKNEVKFLTNMNTNLK 912
             R  Y++++     + ++ +DL    Q D S K+++ E + +Q +K E   +  MN  +K
Sbjct: 719  QREKYFRVENEINSMENKLKDLEKQTQVDVSDKIREIESKLLQSVKEESNLIFRMNEKMK 778

Query: 913  ADKTQFSQKEKQYSQ----KYIYIEKYMSHVKQEYNKKEDECN------RLKFVVDKNMK 1062
              K    QK+  +S     + + IEK +  +   ++ KE E        + +     N +
Sbjct: 779  --KVYRCQKDVLHSDVEYLEALNIEKSIGDIINLFSNKEKELEDVVASLKNELRTKNNTE 836

Query: 1063 KIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCS 1242
              +  +   ++ T  +       ++    KD    D   +    +E  L+ +     S  
Sbjct: 837  DYERWKEETRSYTEERKKIIEKYIEKCKDKDNLTVDFIDREISRLESTLKNTNEEKTSAL 896

Query: 1243 EAEALDNVLGLIENTMKTLEGNSK 1314
              E  +  L +IE+ M  LEG  K
Sbjct: 897  LLENNNKELKVIEDGMPDLEGKLK 920

>NDAI0F02570 Chr6 complement(630462..634955) [4494 bp, 1497 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1497

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 61/234 (26%), Positives = 103/234 (44%), Gaps = 3/234 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISI 699
            +++E +D +E   +   +H      +N+ + +  D+ EE E   S I E + +E+ +  I
Sbjct: 667  DEVEDEDEDEDEGEDEHEH----EHENEEEDEDEDEDEEEEEYDSGIDEEDRLEEGRKLI 722

Query: 700  NSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV 879
                 +LL+ +     +   Y++ Q    RL    ++L+D+   K+KQKE E +K K   
Sbjct: 723  QIAITKLLQGR-----IMASYHEKQAENNRL-KLLKELEDE---KLKQKEKEEKKQKKRE 773

Query: 880  KFLTNMNTNLKADKTQFS-QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL--KFVVD 1050
            K         K  K Q    KE++  +K + +E      K+E  +KE E   L  K V +
Sbjct: 774  K--------EKEKKRQLQLAKEEERRKKILELEGQ----KRENERKEQERRELQRKKVEE 821

Query: 1051 KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ 1212
               KK +  +R LQ Q   +        Q E Q+    E R  K  E  E++ Q
Sbjct: 822  AKRKKDEEKKRKLQEQRRREE-------QQEQQRRLKEEQRQKKEVEKKEKEEQ 868

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 65/308 (21%), Positives = 129/308 (41%), Gaps = 8/308 (2%)
 Frame = +1

Query: 448  ITHETN-RKAECERSKNAIDSLYYHEQLEKKDLNEKSL-------QMAIDHLLKVTKQNQ 603
            I+HE   ++ E E S   ++S    + L K+    K L           ++   + K+ +
Sbjct: 611  ISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKE 670

Query: 604  RQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERG 783
              ++ R    +T++ K  +     V+DNK+  ++   +LL+ +T   I            
Sbjct: 671  SILETRVNNLKTDLEKQKLSVPSFVQDNKVRDST---ELLQSRTKTEI------------ 715

Query: 784  KRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
              L HE   L+ + +  M  KE   + L+   K    +   LK  +   ++++  +  K 
Sbjct: 716  --LMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKG 773

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            I   KY + +KQ     E+   RL+  +    ++I    +SLQ+  ++Q  ++  T+ D 
Sbjct: 774  I---KYDARIKQ----LEESLERLRIELKSKAQEI----KSLQSSKDSQLKWAQNTIDDT 822

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
            ++          K+K  + +  +  K      S+ E LDN L   EN +K    N+   +
Sbjct: 823  EE----------KLKSVLTELSRKEKTVVTLSSKIENLDNELR--ENKLKYEFLNNTSDA 870

Query: 1324 TTTKKCLK 1347
            +T +  L+
Sbjct: 871  STLQPALR 878

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 55/261 (21%), Positives = 114/261 (43%), Gaps = 20/261 (7%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS-FIKEIEEVEDNKISINSLEQQL 720
            N   LQ ++ ++ +  ++   ++  R   EE   LKS  IK  E+V  N   I   E ++
Sbjct: 1180 NNAILQKSLKNVTEKNREIYEELTIRQ--EEVSQLKSDLIKTKEQVSVNANKILIYESEM 1237

Query: 721  LEEKTANNILRRDYYKLQERG-KRLCHEFQD--------------LQDDYSKKMKQKEYE 855
             + K   + L     ++Q++  ++L  E  D              L++ +++  KQ   +
Sbjct: 1238 DQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEK 1297

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE-KYMSHVKQEYNKKEDECNR 1032
            +   K +   LTN    LKA + +  Q     + K + ++ +   H  Q  +   D+   
Sbjct: 1298 LDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQ--- 1354

Query: 1033 LKFVVDKNMKKIDHLERSLQAQTNAQNS---FSAVTVQDEDQKDAHLEDRYHKVKEFMEQ 1203
             K      +++I+ L+R LQ   NA NS   F  +    E++K+  + +R  + ++ +E+
Sbjct: 1355 EKVASLPLIEEIESLKRELQVFKNANNSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEE 1414

Query: 1204 KLQTSKNNDPSCSEAEALDNV 1266
             +  SK+       +E ++ +
Sbjct: 1415 IVSKSKSTGKVADNSENIETL 1435

 Score = 31.6 bits (70), Expect = 6.3
 Identities = 49/269 (18%), Positives = 101/269 (37%), Gaps = 28/269 (10%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS-INSLEQQL 720
            N  SLQ+  D +++     ++++  ++K    E L S+  +    E  K S I +LE++L
Sbjct: 166  NSVSLQLKYDTIVQ-----EKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKL 220

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
             + +            L ++ K+L H  ++   +          E  +   E+    +MN
Sbjct: 221  YQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMN 280

Query: 901  TNLKADKTQFSQKEKQYSQKYI--------------YIEKYMSHVKQEYNKKEDECNRLK 1038
              L +    F   E+ +S   I               +   + + K ++ K +DEC RL+
Sbjct: 281  DLLSSQLASF---ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQ 337

Query: 1039 FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV-------------QDEDQKDAHLEDRYH 1179
             ++   +++      +  A       FS + V             Q ++Q +  + +  H
Sbjct: 338  NIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEH 397

Query: 1180 KVKEFMEQKLQTSKNNDPSCSEAEALDNV 1266
            K  E +  K +T           E L+ +
Sbjct: 398  KTPELVSFKERTKSLEHELKRSTELLETI 426

>KLTH0A05544g Chr1 (460303..462198) [1896 bp, 631 aa] {ON} weakly
            similar to uniprot|Q01649 Saccharomyces cerevisiae
            YMR198W CIK1 is important for proper organiziation of
            microtubule arrays and establishment of a spindle is
            essential for karyogamy and expression is regulated by
            KAR4 and mating spindle pole body associated protein and
            to uniprot|Q12045 YPL253C VIK1 Protein that forms a
            complex with Kar3p at the spindle pole body, possible
            regulator of Kar3p function in microtubule- mediated
            processes; required for sister chromatid cohesion
          Length = 631

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 63/308 (20%), Positives = 129/308 (41%), Gaps = 4/308 (1%)
 Frame = +1

Query: 343  DAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK-AECERSKNAIDSLYYH 519
            DA  +     N+P     +S  + L        V +T   + K  ECE  ++  +    H
Sbjct: 99   DAETKLIQETNLPNLDYDMSKKNTLCNELRKELVQLTTSLDEKNGECELMESNWELTVKH 158

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISI 699
             QLE  ++N +  +  ID  L   ++   +     KL E E  +     IEE+E+ K   
Sbjct: 159  LQLEH-EVNLQKARNEIDQALCEARERWEE-----KLREMENFRPDSGIIEEIEELK--- 209

Query: 700  NSLEQQLLEEKTANNILRRDYYKLQERGKRLC-HEFQDLQDDYSKKMKQKEYEVQKLKNE 876
               E++L EEK  N         L+   KR C    Q+L  ++ K + +K+   ++L+ +
Sbjct: 210  ---EERLQEEKKLN--------ALEASNKRACTMRDQELDIEFQKFLLEKQKPSEELREK 258

Query: 877  VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN 1056
             +                 +K KQ +++ +  E  +    ++  +  +   R++ ++   
Sbjct: 259  CQVQ--------------REKNKQLTEEILCFENQLEESTRDCARLYEAITRIEKLIKAC 304

Query: 1057 MKKIDHLERSLQAQTNAQNSF--SAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNND 1230
            +++ + L   L+ +T  + SF  + +T Q    + + +E +Y+   + ME++    +  +
Sbjct: 305  LEEREEL---LERRTKVEASFRETELTTQKVQTEASAVESKYNAQFDKMEKEQLRRRKME 361

Query: 1231 PSCSEAEA 1254
             S  E  A
Sbjct: 362  NSIDEMRA 369

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
            weakly similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport,
            coiled-coil protein necessary for protein transport from
            ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 61/261 (23%), Positives = 111/261 (42%), Gaps = 16/261 (6%)
 Frame = +1

Query: 598  NQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQE 777
            N R V   D+LE  +     IK +++VE ++  I   EQ           L +D  + + 
Sbjct: 590  NSRSVSLDDELESAKTCS--IKSVQKVEQSEHRIERDEQ-----------LVQDSERWKM 636

Query: 778  RGKRLCHEFQDLQDDYS---KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
             G+    EF  L++++S   +K  + E+E  KL+ E       N  L   K  +S     
Sbjct: 637  EGQSCFQEFSILRNEHSTLLQKCSKLEFEKSKLQTE-------NVELSGYKEGYSL---- 685

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS----------LQAQ 1098
            + +KY ++E     +KQE    +D+   L+  +    K ID +E++          LQ Q
Sbjct: 686  FDEKYEWLESIALSLKQEKKCSDDKIKDLQRELKYARKTIDSMEKAKSQYERRPQELQIQ 745

Query: 1099 TNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE---FMEQKLQTSKNNDPSCSEAEALDNVL 1269
             +     +    Q   +K+  L++ + K++E    +   +  +K   PS  E   ++   
Sbjct: 746  LDRLRLQNFELSQRFGKKNKELQESFDKMREMAVMLRSTMSLAKTLSPS-DEVTLVEQPN 804

Query: 1270 GLIENTMKTLEGNSKYYSTTT 1332
                NT+KT     K++ T+T
Sbjct: 805  NNAGNTLKTFL-PLKWWKTST 824

 Score = 37.4 bits (85), Expect = 0.095
 Identities = 83/394 (21%), Positives = 159/394 (40%), Gaps = 66/394 (16%)
 Frame = +1

Query: 331  KEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECER---SKNAI 501
            ++V   + R + L  IP   I      DL  T + LA G+     ++ +C +    K +I
Sbjct: 151  QDVITLLQRIFTLHGIPPCEIK----EDLLGTLQRLARGVVASFKQREQCYKYVGRKQSI 206

Query: 502  DSL----YYHEQL--EKKDLNEKSLQMAI--------------------------DHLLK 585
            + L    Y +++L  E   LN+K  Q  +                           HLLK
Sbjct: 207  EELDELEYVNDKLKCEVAGLNKKLSQEKVRWEVVDEVFIENDSLKAKVEELITAKQHLLK 266

Query: 586  VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN--------KISINSLEQQLLEEKTAN 741
              +   +  D    LEE + LKS +K++  + D+        +I+ +    +L+  K  +
Sbjct: 267  ELQLAPKWEDVDGLLEEDKELKSRVKQLTFLNDDLKKKYAQIEITTSKRADELVSSKEKS 326

Query: 742  NI-LRRDYYKLQERGKRL-------------CHEFQDLQDDYSKKMKQKEYEVQKLKNEV 879
            +I LR+   KL E  +++              + ++   +  S K+++ E  VQ+L   V
Sbjct: 327  DIELRKTDIKLNETTEQVIELRREKEVLNAKLYTYKKNAETTSIKLEETEERVQELSKIV 386

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD-KN 1056
            +     N  L +   Q  +K +Q + K    E     +         + + +K  VD   
Sbjct: 387  EDYRTKNGELGSSCGQLVEKAEQTAIKLRNTELVNVELVSTRADLTSKLHGVKRTVDYLT 446

Query: 1057 MKKIDHLERSLQAQTNAQNSF--SAVTVQDEDQKDAH-LEDRYHKVKEF----MEQKLQT 1215
             + I+  ++    +  A N F    V++  ++++ A  L    +K++EF     + +   
Sbjct: 447  SENIEMTKKMKLMKKKAYNRFFDQNVSLGSKNEELAEKLGQALNKLEEFGNLQKDYEKLD 506

Query: 1216 SKNNDPSCSEAE-ALDNVLGLIENTMKTLEGNSK 1314
            SKNN+ + ++ E  L N     +N  + LE  +K
Sbjct: 507  SKNNELAANQDELTLTN-----KNLSQRLEAETK 535

>SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly
            similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component ortholog of human kendrin involved in
            connecting nuclear microtubules to SPB interacts with
            Tub4p-complex and calmodulin phosphorylated by Mps1p in
            cell cycle-dependent manner
          Length = 849

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 69/329 (20%), Positives = 146/329 (44%), Gaps = 22/329 (6%)
 Frame = +1

Query: 379  PTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSL 558
            PT H+  + IS+L  T             R       K   D+LY      K ++   +L
Sbjct: 92   PTTHVKKNLISELINT---------ENGKRDIASNPLKEQQDALY------KLNMENYNL 136

Query: 559  QMAIDHLLK----VTKQNQ--RQVDGRDKLEETEVLKSFI-KEIEEVEDNKISINSLEQQ 717
            ++  + LLK    VT + +  + ++  D+L++ +     + K   E++     + S E +
Sbjct: 137  RVKCNSLLKFLNNVTDEGELKKNLEILDELQDWKTKYQMLNKTFRELQSKFDELESKESE 196

Query: 718  LLEEKTANN--------ILRRDYYKLQERGKRLCHEFQDLQDDYSK-KMKQKEYEVQK-L 867
             +++  A+N        +L  + ++ +E+  +L    + L++   + + + KE E Q  L
Sbjct: 197  KMQDIEADNGKSDSERQLLEEELFQTKEKLSKLKDVVKALENKVMEIRQESKEREHQSFL 256

Query: 868  KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVV 1047
            KNE+     +   ++  +   S KE +  +    +++ ++ + QE++ +      L+  +
Sbjct: 257  KNEL-----LQAKIRELEGSISDKESELVKSKKKVQRLVNEL-QEFDHQSGSLLELEKQI 310

Query: 1048 DKNMKKIDHLERSLQAQTNAQNSF----SAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT 1215
            D   + I +LE  L    +++ S     SA T Q  D ++ H + R +  K+ +E+ +QT
Sbjct: 311  DMKNEGIRNLETKLTQLAHSKQSLERELSAKTQQINDLREEHDQSRSNNNKK-LEELVQT 369

Query: 1216 SKNNDPSC-SEAEALDNVLGLIENTMKTL 1299
            +   D    ++ EAL      +EN  + L
Sbjct: 370  NSTGDTVLKAKLEALRQEKAQLENANEEL 398

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 55/267 (20%), Positives = 116/267 (43%), Gaps = 20/267 (7%)
 Frame = +1

Query: 592  KQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISI----NSLEQQLLEEKTANNILRRD 759
            K  ++ +  R      E L S   E+E++ D+K S+      L+QQ++ + + + +L+ +
Sbjct: 434  KHARKGILHRASTSNKEALGSLQDELEKLNDSKRSLERENERLKQQIVNQASRSPLLKEN 493

Query: 760  -YYKLQERGKRL------CHEFQDLQDDYSKKMKQ--KEYEVQKLKNEVKFLTNMNTNLK 912
               KL E+ K +       H+ ++    Y +++++  +E+  +  + E+K L ++ T   
Sbjct: 494  ANKKLLEKEKEIRLLQSTIHDIEEEVSHYKRQIQEAKREHSREVAEFEIK-LQSLETEPL 552

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
             ++ +    EK+ S   + ++       +E    E++C  LK       ++   L +  +
Sbjct: 553  IERRKL---EKEISMLQLELQSAQETKNRELALWENKCEALK-------RENQQLSKQEE 602

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK-------NNDPSCSEAE 1251
              +N  N   A     E QKD  L D   +  +   +KLQ ++       +ND    E +
Sbjct: 603  GHSNNLNRIIA-----ERQKD--LNDLVQRCSDLSMEKLQLNRELNELKSSNDDYKQELK 655

Query: 1252 ALDNVLGLIENTMKTLEGNSKYYSTTT 1332
             + + L  I      L+ + K  +T T
Sbjct: 656  KVTSRLDFITKEFVKLKESIKDRATET 682

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
            plaque spindle pole body (SPB) component, ortholog of
            human kendrin; involved in connecting nuclear
            microtubules to SPB; interacts with Tub4p-complex and
            calmodulin; phosphorylated by Mps1p in cell
            cycle-dependent manner
          Length = 944

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 63/307 (20%), Positives = 137/307 (44%), Gaps = 18/307 (5%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN-KISINS 705
            E K + +  L+   D L+K+ + + +    ++K  + E      KE++E E N KIS + 
Sbjct: 459  ESKTITDNELESK-DKLIKILENDLKVA--QEKYSKME------KELKEREFNYKISESK 509

Query: 706  LEQQ--LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV 879
            LE +   L EK +N  L  +  +L+ + +        ++++Y K+++    ++++ K   
Sbjct: 510  LEDEKTTLNEKISN--LAAENSQLKNKIEDNSTATHHMKENYEKQLESLRKDIEEYKESA 567

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYI-YIEKYMSHVKQEYNKKEDECNRLKFVVDKN 1056
            K   +    LK    + S K  +   K I   ++ +S + Q    +EDE + LK ++D+ 
Sbjct: 568  KDSEDKIEELKIRIAENSAKVSEKRSKDIKQKDEQISDLTQNLKLQEDEISSLKSIIDRY 627

Query: 1057 MKKIDHL---ERSLQAQTNAQ-NSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKN 1224
             K  + L   + ++Q   N Q  +     ++ ED+  +  + +  +++ +  +    S  
Sbjct: 628  KKDFNQLKSEQSNIQHDLNLQILNLENKLIESEDELKSLRDSQKIEIENWKRKYNNLSLE 687

Query: 1225 NDPSCSEAEA----------LDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLK 1374
            ND   +E E+          L+  L  ++     L+ + + Y    ++  K +T + RL+
Sbjct: 688  NDRLLTEKESASDKEREISILNRKLDEMDKEKWNLQESKEKYK---RELQKVITANDRLR 744

Query: 1375 ENEHITN 1395
              +   N
Sbjct: 745  REKEELN 751

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 69/381 (18%), Positives = 147/381 (38%), Gaps = 50/381 (13%)
 Frame = +1

Query: 337  VNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYY 516
            +N  ++R  +  N+  + I  +  SD+    E +A            C+R   ++     
Sbjct: 539  LNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIA------------CKRENLSLTQQIS 586

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTK-----------QNQRQVDGRDKLEETEVLKSFIK 663
             +Q E  +LN KS Q   D+ LK+ +           +N   +   +K +  +  +S   
Sbjct: 587  TKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFD 646

Query: 664  EIEEVEDNKISINSLEQQL--------LEEKTANNILRRDYYKLQERGKRLCHEFQDLQD 819
            +I++     + + +  ++L        L  K +   L      L E  K L ++    ++
Sbjct: 647  KIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEE 706

Query: 820  DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 999
            +  + +++ E +++  +  +  L+  N N      + + K +  S+K +  + Y   V  
Sbjct: 707  EVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPY--PVGT 764

Query: 1000 EYNKKEDECNRLKFVVDKNMKKI----DHLERSLQAQTNAQNSF---------------- 1119
            E  + ++E N +K  ++ +  +     D LER+     N+  SF                
Sbjct: 765  ELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSK 824

Query: 1120 ------SAVTVQDEDQKDAHLE-----DRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNV 1266
                  + +T  +   K   LE     DR    K  +E+KL +  +++   +E +     
Sbjct: 825  QHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMK----- 879

Query: 1267 LGLIENTMKTLEGNSKYYSTT 1329
             G  +  ++ +E N K  S T
Sbjct: 880  -GEYDAQIQKIESNLKIQSDT 899

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 43/210 (20%), Positives = 92/210 (43%), Gaps = 6/210 (2%)
 Frame = +1

Query: 610  VDGRDKLEETEVLKSFIKEIEEVEDNKISI----NSLEQQLLEEKTANNILRRDYYKLQE 777
            VD     E T++++    E + +E    +     N L +QL + ++   +L  +Y + ++
Sbjct: 1006 VDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKK 1065

Query: 778  RGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQ 957
                  +      +++  +++  +     L NEVK     N  + A+  +   K K    
Sbjct: 1066 EVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVES 1125

Query: 958  KYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQ 1137
            +       +S    +  + + EC+RLK     +M +  + + S +     Q+S + +T Q
Sbjct: 1126 QLDEARNVLSSKDMKLMELQTECSRLK-ATSHDMPQNGNKDSSSELVGALQSSVATLTEQ 1184

Query: 1138 DEDQKDAH--LEDRYHKVKEFMEQKLQTSK 1221
             ++ K A+  LEDR+ ++K    ++L  SK
Sbjct: 1185 VDNLKHANTELEDRFGRLKRQARERLDASK 1214

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 68/311 (21%), Positives = 137/311 (44%), Gaps = 24/311 (7%)
 Frame = +1

Query: 454  HETNRKAECERSKNAI--DSLYYHEQLEKK-DLNEKSLQMAID-HLLKVTKQNQR----- 606
            HE+  K      KN I  D L   E L K+ + +++SL+  I+ HL K+ +Q Q      
Sbjct: 1243 HESEEKLV---HKNDIMKDKLSTQESLLKQLESDKESLKSNIESHLEKIEEQKQEILKLQ 1299

Query: 607  ------QVDGRDKLEETEVLKSFIKEIEEVEDN-KISINSLEQQLLEEKTANNILRRDYY 765
                  + D  +  +E E +   + E     +N K  +      L++ K+  +    +  
Sbjct: 1300 DEYSSLESDSLNSSKEKENVTLLLDEANNKNENLKSELEKARADLIDLKSNLDETNLNSQ 1359

Query: 766  KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV----KFLTNMNTNLKADKTQFS 933
            ++ E  + L  + +  +D+     K++E   QK + ++    K + + N   + ++   +
Sbjct: 1360 RISEEKENLSKKIKKFEDEILSIKKERETSKQKTQEQIMELQKSIKSRNEEFERERKLLN 1419

Query: 934  QKE----KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
            +      K+YS K   +E  +  +K EY+ ++D   +L    D   +  + LE  L+ ++
Sbjct: 1420 EGSNTATKEYSAKVSELEDKLDALKAEYSLEKD---KLVTNSDSLRESNERLEDQLEEKS 1476

Query: 1102 NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIE 1281
            N  +           ++DA +++   K+K  +E KL+T  N++ S      L + +G I+
Sbjct: 1477 NELHL---------AKEDAKIQN--EKIKN-IELKLKTQANSNES-----KLKDYMGNID 1519

Query: 1282 NTMKTLEGNSK 1314
            +  K L G  K
Sbjct: 1520 SLKKELLGKEK 1530

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 42/205 (20%), Positives = 84/205 (40%), Gaps = 1/205 (0%)
 Frame = +1

Query: 775  ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYS 954
            E  +++  E + L+ + +    + +  ++KLKN++  L   + N+  D   F   +++Y 
Sbjct: 758  ENFEQIQEECKALKQEINTLGAESQLTIEKLKNDLDALKESHENVTTD---FETAKEEYL 814

Query: 955  QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
                        V   YNK + E   L      N+K +   + +L+ + N+Q S     +
Sbjct: 815  S-----------VSDNYNKTQKELKDLTI----NLKVVSEAKENLE-KINSQQSNKMERL 858

Query: 1135 QDEDQKDAHLEDRYHKVKEFM-EQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
             DE  ++       HK  + + ++K +  +  +    E  +L      + N  K LE   
Sbjct: 859  NDELTQNKEKLSILHKTLDTLKKEKAKAEEGINKMGRELMSLTKEKDFLSNKEKELEKKM 918

Query: 1312 KYYSTTTKKCLKYVTGSSRLKENEH 1386
            K  S T      ++   S L++N H
Sbjct: 919  KKNSDT------FMKEKSSLQQNLH 937

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 42/254 (16%), Positives = 105/254 (41%), Gaps = 18/254 (7%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
            +K   +E  L+  I    ++ KQ       +D+L +  V      E+++  D    ++  
Sbjct: 1138 DKLASSESRLEELIKQKGELAKQKDELAKQKDELHKLNVESK--DELQKTNDKIAKLSGE 1195

Query: 709  EQQLLEEKTA--------NNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK 864
             ++L  E T+          + + +   LQE+ K L  E +   +++ +  ++  ++   
Sbjct: 1196 HKELKLENTSLIKKSDDCKILHKTEVASLQEKIKSLDGELKRKDENFHESEEKLVHKNDI 1255

Query: 865  LKNEVKFLTNMNTNLKADKTQFS-------QKEKQYSQKYIYIEKYMSHVKQEYNKKEDE 1023
            +K+++    ++   L++DK           +K ++  Q+ + ++   S ++ +      E
Sbjct: 1256 MKDKLSTQESLLKQLESDKESLKSNIESHLEKIEEQKQEILKLQDEYSSLESDSLNSSKE 1315

Query: 1024 CNRLKFVVDKNMKKIDHLERSLQ---AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
               +  ++D+   K ++L+  L+   A      S    T  +  +     E+   K+K+F
Sbjct: 1316 KENVTLLLDEANNKNENLKSELEKARADLIDLKSNLDETNLNSQRISEEKENLSKKIKKF 1375

Query: 1195 MEQKLQTSKNNDPS 1236
             ++ L   K  + S
Sbjct: 1376 EDEILSIKKERETS 1389

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 59/304 (19%), Positives = 134/304 (44%), Gaps = 25/304 (8%)
 Frame = +1

Query: 385  KHISIS-SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYH------EQLEKKDL 543
            KH  +S +IS+L +   T  V +   T  + + E +    +  +        EQLE  + 
Sbjct: 1045 KHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNS 1104

Query: 544  NEKSL----QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLE 711
              + L    ++  D +   T  ++   D  DK     +L S  +E  ++ D K+++   +
Sbjct: 1105 RIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRE-RDILDTKVTVAERD 1163

Query: 712  QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
             ++L +K +   +     +LQE   +L  +   L+++    + Q+  ++ +  N++  L 
Sbjct: 1164 AKMLRQKISLMDI-----ELQEARTKL--DNSRLEEEKRPTIIQQHEDIMEKLNQLNLLR 1216

Query: 892  NMNTNLKADKTQFSQKEK-------QYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
              N  L+ +    +++++       +  Q    IE  ++ +K    +KE E    K  V 
Sbjct: 1217 ESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVH 1276

Query: 1051 KNMKKI-DHLERSLQAQTNAQNSFS------AVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
            +  K+  D LE+  Q  ++             V + ++ ++ A  E+R+++++   +++L
Sbjct: 1277 RWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERL 1336

Query: 1210 QTSK 1221
            +TSK
Sbjct: 1337 KTSK 1340

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 43/238 (18%), Positives = 103/238 (43%), Gaps = 21/238 (8%)
 Frame = +1

Query: 571  DHLLKVTK-QNQRQVDGRDK---------LEETEVLKSFIKEIEEVEDNKISINSLEQQL 720
            DH + +   QN    D R K          E+ E + S +  I+ + D  +  N L+ + 
Sbjct: 3    DHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDL--IKHLNDKLLQFNELKSEN 60

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDL----------QDDYSKKMKQKEYEVQKLK 870
            L+   + + L+ +  K  +  K+   E ++L          +DD   K++ ++ E  K+ 
Sbjct: 61   LQITVSFDELKTNSSKKIDNLKK---EMENLIKQNDGIRKERDDTCDKLESEKNEKTKIS 117

Query: 871  NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK-FVV 1047
            NE++ +     +L  +K +    +++  +      K +   + + N+ ++EC RL+  ++
Sbjct: 118  NELESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTII 177

Query: 1048 DKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK 1221
            D   K+ D +   L ++   +     + +  +   D   ++   K ++++  + +T K
Sbjct: 178  DLETKQQDLITSDLNSRAELERKAQELNIL-QSTNDWLEKELCSKNEQYLSYRKKTDK 234

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 67/341 (19%), Positives = 138/341 (40%), Gaps = 28/341 (8%)
 Frame = +1

Query: 397  ISSISDLAQTFET----LAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQM 564
            I+S  +   T E      A+ + H +N K    R  +A        + EK    E  +Q 
Sbjct: 417  INSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSA--------KSEKLKQCENDIQT 468

Query: 565  AIDHLLKVTKQ-------NQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL 723
             I   L + +Q       N    D +  L + E++  FI+ I +  D+  +  +  Q+++
Sbjct: 469  LIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIM--FIQNILQ-NDSDTATETDSQKIV 525

Query: 724  EEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE-VKFLTNMN 900
             E+       R   +LQE+   L    ++L D       + +  +QK+++E +       
Sbjct: 526  TERLVEF---RSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAI 582

Query: 901  TNLKADKTQFSQKEKQY-----SQKYIYIEKYMSHVK---QEYN--KKEDEC------NR 1032
              LKA+K Q   K ++      + K +   +  SH+    Q+ N  K+  EC      + 
Sbjct: 583  LTLKAEKEQLESKVEELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSN 642

Query: 1033 LKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ 1212
            +  +  ++ + +  L + +Q   ++++  S + +  E       E+R+  +   ++    
Sbjct: 643  ISQITRESTENMSLLNKEIQDLYDSKSDIS-IKLGKEKSSRILAEERFKLLSNTLD---L 698

Query: 1213 TSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTK 1335
            T   ND      + L +   +++   KT E  ++Y S  +K
Sbjct: 699  TKAENDQLRKRFDCLQST--ILKQDSKTQETLNEYISCKSK 737

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
            hypothetical protein
          Length = 645

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 88/391 (22%), Positives = 152/391 (38%), Gaps = 46/391 (11%)
 Frame = +1

Query: 343  DAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAEC------ERSKNAID 504
            +A+ RC+ LCN+P + +      DL  + + L+ GI      +  C      +  +  + 
Sbjct: 217  EAITRCFNLCNVPLEDL---DEDDLVMSLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILG 273

Query: 505  SLYY--------HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            SL +         E  E+  L  K L +    L     QN +  + +D+L   E LK  I
Sbjct: 274  SLNHLGEKVICLEEDNEQLTLKVKQLSLENQQLF----QNSKPDNLKDEL--AEKLKGKI 327

Query: 661  KEIE------EVEDNKI--SINSLE--------------QQLLEEKTANNILRRDYYKLQ 774
             ++E      + E +K+   +NSL+              +QL E+     ILRR   +L 
Sbjct: 328  MQLEGKISTKDKEYHKVLTQLNSLKNNSHDDSSQQSIVLKQLAEKTREAEILRR---RLT 384

Query: 775  ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS-----QK 939
            E+  R+ +   +L++       + EY   K + ++       T+ K  + Q S     ++
Sbjct: 385  EQNDRIVNNSNELEN------LKLEYREVKSQYDLLAKEKERTDFKCKEFQESWYEATER 438

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKKEDEC-----NRLKFVVDKNMKKIDHLERSLQAQTN 1104
             K    + + +EK    +  E  K E E      N  K  +  + +  D+L + +Q Q  
Sbjct: 439  TKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFL-SSKETYDNLSKKVQEQIV 497

Query: 1105 AQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIEN 1284
            A+N+     +    QK   L +  +KVKE                 E  AL+      E+
Sbjct: 498  ARNT-QQRKMNVLSQKIVKLSEELNKVKE-----------------ERTALN------ES 533

Query: 1285 TMKTLEGNSKYYSTTTKKCLKYVTGSSRLKE 1377
                 E N+K  + T K  +K      R KE
Sbjct: 534  LSSVTEENNKSKALTEKLEVKLTNQKKRFKE 564

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
            Anc_5.88 YGR238C
          Length = 1167

 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 51/224 (22%), Positives = 101/224 (45%), Gaps = 22/224 (9%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV----LKSFIKEIEEVED 684
            H   +  D +EK  ++ ID ++    +N+         E  ++    +K   KE+EEV+ 
Sbjct: 802  HIHDDNDDGDEKG-EITIDRVVLEKMRNELYELKTSSKENAKIASDHIKELEKELEEVKQ 860

Query: 685  N-KISINSLEQQLLEEKTAN--NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYE 855
            N     +SLE+ LLE+K     N+L   +  ++   + +  + + ++    + + +K+YE
Sbjct: 861  NHSFEHDSLEKSLLEDKLHEFENLLSSKFLDVEHLNEIIKQQNKTIETYELEPIYKKKYE 920

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY-IEKYMSHVKQEYNKK------ 1014
              +L+ + +F+T  N  LK + T++    +     Y   +++ +SH KQ    K      
Sbjct: 921  --ELQRDYEFVTEENDTLKKEATRYELDLRNNIISYSSSLDELLSHWKQMTIMKNQKLDD 978

Query: 1015 --------EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS 1122
                    ED+    K VVDK   ++D L    Q  + +++  S
Sbjct: 979  GMKSEVAIEDDNGHHKSVVDKLSNRLDDLIAKSQEMSESKDKLS 1022

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 69/277 (24%), Positives = 122/277 (44%), Gaps = 11/277 (3%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            +Y      +D+   E+ + +++   L +I ++ +  + IS L      L   +T  T   
Sbjct: 687  EYSSLMTLKDNLILEI-ETISKENKLASINSRELE-TEISLLNSEITNLKTQLTQLTRNL 744

Query: 472  AECERSKNAIDSLYYHEQLEK-------KDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL 630
                  K+    L YH+ L K       KDLN K +   ID  +K+ +      D R+ L
Sbjct: 745  ------KDNNTELLYHQNLIKLDYDPKLKDLNHKIID--IDSKMKIIE------DERESL 790

Query: 631  EETEVLKSFIKEIE-EVED-NKISINSLEQQLLE-EKTANNILRRDYYKLQERGKRLCHE 801
            E  E  K F  +I   ++D  K S+N + +Q  + +K A +IL  +  KLQ   +RL   
Sbjct: 791  EN-ETFKDFELKIGFSIKDYKKYSVNIITEQSKDLQKLAKDILNIEN-KLQFEKERL--- 845

Query: 802  FQDLQDDYSKKMKQKEY-EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
                  + ++  K+K    ++K   E+  LT     L   K   S+  ++   +   IEK
Sbjct: 846  ------ESTQLRKEKTLANIEKYNQELNDLTEQENQLNIQKENDSKLIEKEKTELKEIEK 899

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 1089
             + + K E N+KE+   + +  ++   KKID L  ++
Sbjct: 900  NIQNKKIEINEKEEVIKQNQNELNSIQKKIDALNENI 936

>KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1872

 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 59/235 (25%), Positives = 106/235 (45%), Gaps = 11/235 (4%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL 723
            N  SLQ   D   +V  Q ++Q+     +E+ +   S + ++E   D +IS+N    Q L
Sbjct: 1102 NYTSLQNRYDSQKEVQIQTEKQLS----MEKDD---SRVHDLERRLDQEISLNEYLHQQL 1154

Query: 724  EEKTANNI---LRRDYYKLQERGKRL---CHEFQDLQDDYSKKMKQKEYEVQKLKNEVKF 885
              K   NI        +K +   + L   C+E     DD SKK+   + E+++ KN +  
Sbjct: 1155 STKDKINIGIPSASFLFKPEMSKEELVMGCNEIIVKLDDTSKKL---QAEIEEKKNLISK 1211

Query: 886  LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKK 1065
            L    T L +    F     Q ++    IEK  S++  + +K+  E       V+K + +
Sbjct: 1212 LRFAETRLASSSFDFQNANAQVNKLKEIIEK--SNLNVDLDKELGESTLTDINVEKLVLE 1269

Query: 1066 IDHLERSLQAQ----TNAQNSFSAVTVQ-DEDQKDAHLEDRYHKVKEFMEQKLQT 1215
            + +L R L+ +    TNA+N   A+  + D+ QK     + Y    E  E+++++
Sbjct: 1270 VQYLRRQLEVEKNVRTNAENVTKALHQKFDKIQKVDSTSNIYKLKFEASEERIKS 1324

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 52/224 (23%), Positives = 105/224 (46%), Gaps = 16/224 (7%)
 Frame = +1

Query: 529  EKKDLN------EKSLQMAIDHLLKVTKQNQR-QVDGRDKLEETEVLKSFIKEIEEVEDN 687
            EK D+N      E++L +  +  ++  +  Q+ Q +  D  E+ E  K    E+ E    
Sbjct: 1656 EKHDINGQIKYLEETLALQKEQNIRNEELVQKLQAEMEDYREKFEAEKHANIELHEDHQT 1715

Query: 688  --KISINSLEQQLLEEKTANNILRRDYY--KLQERGKRLCHEFQDLQDDYSKKMKQKEYE 855
              K+S    E+    ++  N+  ++D +  K+QE  + L  E  +++ +  KK K  E  
Sbjct: 1716 LVKVSTQLKEKIATLQEQLNDTTQKDGWIAKIQEMDRMLAEE-TEVKYEEMKKNKNLELI 1774

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
            V+ LK + +  +++      D+ QF     QY+ +   +EK +S  KQE + K       
Sbjct: 1775 VEDLKTKNQQQSDVIQMANEDRQQFENNMLQYNGQVSELEKLIS--KQELDLK------- 1825

Query: 1036 KFVVDKN--MKKIDHLERSL---QAQTNAQNSFSAVTVQDEDQK 1152
            KFV D +    ++  LE+ L   +A+   +++   ++++  ++K
Sbjct: 1826 KFVRDNSYYQDRVSDLEKELNFWKAKAGGESNGMRMSMEASNEK 1869

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 55/281 (19%), Positives = 120/281 (42%), Gaps = 12/281 (4%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKK-------DLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            N  A+  + K  I+    +  L+K+       D+N + L + + +L     + Q +V+  
Sbjct: 1228 NANAQVNKLKEIIEKSNLNVDLDKELGESTLTDINVEKLVLEVQYL-----RRQLEVEKN 1282

Query: 622  DKLEETEVLKSFIKEIEEVE--DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLC 795
             +     V K+  ++ ++++  D+  +I  L+ +  EE+  +   +     L+++   L 
Sbjct: 1283 VRTNAENVTKALHQKFDKIQKVDSTSNIYKLKFEASEERIKSLESKLHSGVLRDKTNTLN 1342

Query: 796  HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE 975
                    D + K ++ E   QK++N  K   ++N   K   T  S + KQY  K   +E
Sbjct: 1343 AGNIFRNRDNAAKYEE-EIRFQKIEN-YKLQEHLNETNK-QITSLSFEIKQYGSKEKMLE 1399

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQA-QTNAQNSFSAVTVQDEDQK 1152
             ++  +KQ+    E +   L   + +   + +     LQ  +   ++   A+   ++D K
Sbjct: 1400 NHIDVLKQDLEDAEKQKELLNLSLKQQRIQYEKCVADLQENEVQLRDYIHALKQAEDDVK 1459

Query: 1153 DAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEAL--DNVL 1269
               + D   K+K   ++K +     + + +E E    DN+L
Sbjct: 1460 S--MADVIDKLKTQNKEKDKIIWEKETARNEIEMKLEDNIL 1498

>Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {ON}
            YLR309C (REAL)
          Length = 913

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 59/294 (20%), Positives = 126/294 (42%), Gaps = 5/294 (1%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMA-IDHLLKVTKQNQRQVDGRDKLEETEVL 648
            ++ E+S   +++L       KK L EK+ ++  +  +L+V       VD +D+++E    
Sbjct: 364  SQLEKSAKELENLNVKLTETKKSLKEKNSELEEVRDMLRVV--GNELVDAKDQIKE---- 417

Query: 649  KSFIKEIEEVEDNKISINSLEQQ---LLEEKTANNI-LRRDYYKLQERGKRLCHEFQDLQ 816
             S  K+ EEV+  K+ +++L  +   ++E      I L+     L +  + L     + +
Sbjct: 418  -STNKQFEEVKAVKLELDNLRHKNASMIEAYETKIIELKNKIDSLNKEAEHLKTSSAEKE 476

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK 996
            ++++   K+    V KL  E+  LT   +NL  + T      KQ  +   Y+E+ +    
Sbjct: 477  EEHAVLQKK----VAKLNEEISQLTCERSNLTKELTSLRISYKQKDKTVGYLEEQVKQFS 532

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRY 1176
            ++ +  E    +L+    K   K+D L++  +            T+ ++  K+ +  + Y
Sbjct: 533  EQKDAAEKSTEQLQKENVKMSNKLDLLKKENE------------TLHNDIAKNGNSYEMY 580

Query: 1177 HKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
             K    + ++L                 N+L    NT++ ++ NS  +  T K+
Sbjct: 581  LKENGKLSERL-----------------NILQEKYNTLQNVKSNSNEHIDTIKR 617

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 68/291 (23%), Positives = 120/291 (41%), Gaps = 33/291 (11%)
 Frame = +1

Query: 448  ITHETNRK-AECERSKNAIDSLYYHE--QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG 618
            I   TN++  E +  K  +D+L +     +E  +     L+  ID L K  +    +   
Sbjct: 415  IKESTNKQFEEVKAVKLELDNLRHKNASMIEAYETKIIELKNKIDSLNK--EAEHLKTSS 472

Query: 619  RDKLEETEVLKSFIKEI-EEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLC 795
             +K EE  VL+  + ++ EE+       ++L ++L   + +     +    L+E+ K   
Sbjct: 473  AEKEEEHAVLQKKVAKLNEEISQLTCERSNLTKELTSLRISYKQKDKTVGYLEEQVK--- 529

Query: 796  HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY---- 963
             +F + +D   K  +Q + E  K+ N++  L   N  L  D  +     + Y ++     
Sbjct: 530  -QFSEQKDAAEKSTEQLQKENVKMSNKLDLLKKENETLHNDIAKNGNSYEMYLKENGKLS 588

Query: 964  ----IYIEKY--MSHVKQEYNKKED----ECNRLKFVVDKNMKKIDHLERSLQAQTN--A 1107
                I  EKY  + +VK   N+  D    +C  L   + ++ KKI  LE  L   TN   
Sbjct: 589  ERLNILQEKYNTLQNVKSNSNEHIDTIKRQCEELNVKLKESTKKILSLEDELSEYTNIVQ 648

Query: 1108 QNSFSAVTVQ--------DEDQKDAHLEDRY-----HKVKEFMEQKLQTSK 1221
              +  A T++        D+  K   LE++       K K   E  LQTS+
Sbjct: 649  DKTREANTLRRLVSDSQVDDSGKQKELENKIAYLTDEKSKLEAELNLQTSR 699

 Score = 35.4 bits (80), Expect = 0.38
 Identities = 43/172 (25%), Positives = 80/172 (46%), Gaps = 12/172 (6%)
 Frame = +1

Query: 619  RDKLEETEVLKSFIKEIEEVED--------NKISINSLEQQLLEEKTANNILRRDYYKLQ 774
            +DK  E   L+  + +  +V+D        NKI+  + E+  LE +  N    R   +LQ
Sbjct: 648  QDKTREANTLRRLVSD-SQVDDSGKQKELENKIAYLTDEKSKLEAEL-NLQTSRKASELQ 705

Query: 775  ERGKRLCHEFQDLQDD-YSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY 951
            E      H   +L+ + ++ K+++KE     LK+EVK L   N+N+K      S    Q 
Sbjct: 706  EWK----HNAAELKSEIHALKLREKE-----LKSEVKALNLANSNIKRKTQATSDDSTQL 756

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL---ERSLQAQ 1098
             Q  + ++  ++   ++ ++ +     L  + ++  KK+D L    RSL +Q
Sbjct: 757  EQITLNLKLALARADEKNSELQSTNENLMNLNNELNKKLDRLLKNYRSLSSQ 808

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 60/291 (20%), Positives = 117/291 (40%), Gaps = 20/291 (6%)
 Frame = +1

Query: 409  SDLAQTFET----LAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDH 576
            SD+ + +E     L   +     +K + E     + +       EK +L +K+L  + + 
Sbjct: 478  SDVIKNYEKNLNELNKKVADVNEKKVKLENETKTLQTALAKSHQEKDEL-KKNLSESKEF 536

Query: 577  LLKVTKQNQRQVDGRDKLEETEVLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILR 753
            + K+ K++    D   +L E   LK     ++  +   + +I+ LEQQ+           
Sbjct: 537  ISKIRKESNTLAD---QLREYNFLKKNESVMKLSITQKEKTISYLEQQI----------- 582

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS 933
            RDY   +E  K    + +   +  SKK+     E + LK +VK           +  + S
Sbjct: 583  RDYNVKEETTKNSLRDAKLENEHLSKKLDTLTKENESLKKDVKKNDGSLEQYIKENGKLS 642

Query: 934  QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKI----DHLERS---LQ 1092
            ++     +KY  ++   S+   + +    +C  L   + ++ K+I    D L  S   LQ
Sbjct: 643  ERLDILQEKYDTLQNMKSNSNDQVDSIRRQCEELNVKLKESNKRILSLEDELNESTSILQ 702

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQK--------LQTSK 1221
             +T   N+   +    E+ +   L++   K    +E+K        LQTS+
Sbjct: 703  ERTRETNTMRRLLADSENDRGIKLKELQEKFAITLEEKSKLQSELTLQTSR 753

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 70/356 (19%), Positives = 151/356 (42%), Gaps = 25/356 (7%)
 Frame = +1

Query: 298  ERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNR--- 468
            ++R  T  D + +   +     A  ++      ++S++  A       V    E NR   
Sbjct: 516  QQRSVTSTDLYADAEASGQLSEATTDLANLSTQVTSLTSQATRLNNKKVVAQQELNRITE 575

Query: 469  -KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID-----HLLKVTKQNQRQVDGRDKL 630
             KA  E    ++ + Y  E  + +++ +  LQ   D       L V+++N   V  +   
Sbjct: 576  LKASIESKLASLRASYEQETKQTEEVEQLLLQSRKDTDSLTQQLSVSEENYHSVQSQ--- 632

Query: 631  EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
                 L S  ++++E E N    + L++Q+    +    L+++  + Q++ K+     + 
Sbjct: 633  -----LTSLQQQLQEYEQNN---SQLKEQIGNYNSLTASLQKELAEKQQQVKQQ----KS 680

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTN-----MNTNLKADKTQFSQKEKQYSQKYIYIE 975
            + D  +K+ +  E     LK E++ L       +N   + D+ Q +  EKQ+S      +
Sbjct: 681  MVDVNTKQAELSEITANNLKAEIEGLDEQLVVFLNKRKELDEYQ-TNIEKQHSSLESKHQ 739

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE--DQ 1149
            KY++  ++   K  + C+R K V ++  + ++      Q  +  Q  F  +  Q E  + 
Sbjct: 740  KYVARSQELEAKYLESCHREKEVQERTKQIVEQERIYHQQVSRLQELFKDLNKQRESFEL 799

Query: 1150 KDAHLEDR----YHKVKEFMEQKLQTSKNNDP--SC---SEAEALDNVLGLIENTM 1290
             +  L+ R      +V+E  +++++ +    P  SC   + +E +D V   +E T+
Sbjct: 800  AEQDLQQRRMEYTQQVQELSDKQMKFAMGELPQDSCKISNNSENVDPVSKFVEETV 855

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 64/307 (20%), Positives = 133/307 (43%), Gaps = 14/307 (4%)
 Frame = +1

Query: 505  SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE------ETEVLKSFIKE 666
            +L   + +E + LNE  ++      +  T++N  + D    LE      +  +L+S + +
Sbjct: 325  TLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQ 384

Query: 667  IEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQK 846
             +  + N     +L++ +   K A    R  Y K+Q    +   E ++  +  +  + Q+
Sbjct: 385  YKLYQTNTKLATTLDK-ISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQE 443

Query: 847  EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK--QEYNKKED 1020
               VQK +       +M   +K    + ++ EK    K I I+K  S +K  Q+Y    D
Sbjct: 444  RELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYD 503

Query: 1021 -ECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
             E + L+  +DK   K+D ++ SL+ +T   +S  ++  +D +   + ++++  ++ +  
Sbjct: 504  SEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQI-QLA 562

Query: 1198 EQKLQTSKNNDPSCSEA-----EALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGS 1362
            E ++   K +     E        +D+V   I+N    +E   K   +  K+     +  
Sbjct: 563  ESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESEC 622

Query: 1363 SRLKENE 1383
            SR KE E
Sbjct: 623  SRAKEKE 629

>Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON}
            (91526..93262) [1737 nt, 579 aa]
          Length = 578

 Score = 47.0 bits (110), Expect = 9e-05
 Identities = 70/318 (22%), Positives = 135/318 (42%), Gaps = 12/318 (3%)
 Frame = +1

Query: 397  ISSISDLAQTFET-LAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD----LNEKSLQ 561
            +S + D ++ FE  L + I  E   K E E   N I + +  E+++ KD    + EK L 
Sbjct: 25   MSELIDRSKNFERILDLDIDKELLIK-ELESKLNVISNEFEIERIQLKDQINLVQEKYL- 82

Query: 562  MAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTAN 741
              ++  L+      + +   +K  E  ++K   +  +E+E+    I  LE+ +   +   
Sbjct: 83   -TVNKELESNNSTVKYLYDTNKKLENNIVKLREEHQDEIEEKNTFIAELEKTVEARENEL 141

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTN---MNTNLK 912
            + L  D  +  +  K    EFQ+    Y  K+K+ ++E+   +NE+  L +    N    
Sbjct: 142  DDLESDLQEQIDDLKDENTEFQNKLKIYKNKIKEYKHEINCKENEIHNLKSEREFNAEEV 201

Query: 913  ADKTQFSQKE----KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 1080
              KT+ +Q      ++ ++ Y+   K +   K ++ K  D+ N LK   +    + D L+
Sbjct: 202  EQKTETNQDNISELQRQNELYLKENKELIETKLKHMKTIDDLNYLKESNNFWRLECDRLQ 261

Query: 1081 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
              ++     +N         E Q +++   +     E  EQ+LQ S N     SE  + +
Sbjct: 262  VQVKDIKKLKNEIK------EKQLESNKLRKVLTQWEIFEQQLQKSPNE--IISEWRSFE 313

Query: 1261 NVLGLIENTMKTLEGNSK 1314
                 + N +   E N+K
Sbjct: 314  TERAFLNNQLS--EANAK 329

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 73/299 (24%), Positives = 123/299 (41%), Gaps = 6/299 (2%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQV-DGRDKLEETEV 645
            + + E   N + S +  ++ +  D     LQ+ ID L    K+ + Q+ DG   L+++  
Sbjct: 209  QVDFEAKLNNVSSQFKGKESDSSDEEISKLQVKIDELQAKIKELETQLLDGNQSLDDS-- 266

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLE-EKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
                + ++++  D K       QQL+E E+   + L +   +L E  K+  +E  DLQ  
Sbjct: 267  ----LTKLKDEVDQKT------QQLIEQEEKHKDELDQRTKQLTELEKKHVNEISDLQAQ 316

Query: 823  YSKKMKQKEYEVQKLKNEVKFLTNMNT-NLKAD---KTQFSQKEKQYSQKYIYIEKYMSH 990
             ++K+       + LK     + N NT N K D   K   SQ E+ +  K   + + +  
Sbjct: 317  LTEKLTTINNLEENLKKNNDVIKNFNTENYKHDNQVKDFISQIEELHDDKK-SLTRDLQI 375

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
             K+++NK   E  R          K+  L+ S +  T               + DA   D
Sbjct: 376  SKEKFNKYRGEMER----------KVFELKTSNERTT---------------ENDAEQLD 410

Query: 1171 RYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLK 1347
            +  K+ E    KLQ SKNN     E   L      +++ +  LE     YS  TK+  K
Sbjct: 411  QIKKLYEDRVNKLQ-SKNNS-LLKEIAQLQTKESNVKSKLSELETK---YSKNTKQLTK 464

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/311 (20%), Positives = 135/311 (43%), Gaps = 22/311 (7%)
 Frame = +1

Query: 484  RSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIK 663
            R K A+       Q E K+L+EK +  A     K +++  + ++ +D  EE   L+  I+
Sbjct: 545  RDKIALKKELKKSQSEIKELHEKIISSAS----KKSQEILQIIENKD--EEIRKLERKIR 598

Query: 664  EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            + ++    +  I  L+ +L   +     L   + K  E  +   HE   LQ+D S+ +K 
Sbjct: 599  DYDQKFSKESDIKDLQNKLKATENEKLTLLERHEKEVEEWR---HELDKLQEDASQVVKL 655

Query: 844  KE------YEVQKLKNEVKFLTNMNTNLKAD----KTQFSQKEKQYSQKYIYIEKY---M 984
            KE       ++++L   +      N+ ++ D      Q+ +  K  ++    I++Y    
Sbjct: 656  KEDLNDKSTKIEELHASLIKHQKENSKIRNDMQKLTAQYGELRKSMNESQKLIDEYYELK 715

Query: 985  SHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT--------NAQNSFSAVTVQD 1140
            S  + E  K+E++ N L+   + N++ +    +SL+ +         N + +    +++ 
Sbjct: 716  STRRNEDFKQEEKLNELERNYNSNLQNLKKYVKSLENENTELEQLLKNFKQNDIRNSIET 775

Query: 1141 EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGN-SKY 1317
            +  +       Y+K+K   E K    +NND         D +  +I+ T+ T + + +KY
Sbjct: 776  KMSETMEYRSDYYKLKYNREVK----RNNDLKIQ----TDYLNRVIKATLATAKADLAKY 827

Query: 1318 YSTTTKKCLKY 1350
             + T    ++Y
Sbjct: 828  RNLTRSLGIEY 838

>Kwal_14.2326 s14 (707822..710593) [2772 bp, 923 aa] {ON} YLR309C
            (IMH1) - Product of gene unknown [contig 225] FULL
          Length = 923

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 62/303 (20%), Positives = 120/303 (39%), Gaps = 18/303 (5%)
 Frame = +1

Query: 460  TNRKAECERSKNAIDSLYYHEQLEKKDLNE--KSLQMAIDHLLKVTKQNQRQVDGRDKLE 633
            T+ + E   S+   DSL    +   +D N+    L+ + + +    K N       D+L 
Sbjct: 462  TSLEKEITESRQETDSLKTSLRKSDQDKNKLLAELKKSEETIGNFRKDNNSL---SDQLR 518

Query: 634  ETEVLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            E  VLK     ++  +   + +I  LEQQ+           ++Y   +E G R   E + 
Sbjct: 519  EFNVLKRSDASMKMSLNQKEKTITYLEQQI-----------KEYSSKEEAGARTLREVKA 567

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
                   ++ Q   E ++LKNEVK   N       +    S++     +KY  ++   S+
Sbjct: 568  ENSKILNRVSQLTKENEELKNEVKKADNSLEKYIKENGSLSERLLVLKEKYETLQDMKSN 627

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKK-------IDHLERSLQAQTNAQNSFSAVTVQDEDQ 1149
               +      +C  L   + +  K+       +  +  +LQ +T   +S   +  + +  
Sbjct: 628  SSDQVELIRRQCEELNIKLKEANKRHLSLEDELSEVAATLQERTQEASSMRRLLSERQTD 687

Query: 1150 KDAHLEDRYHKVKEFMEQK--------LQTSKNNDPSCSEAEALDNVLGLIENTMKTLEG 1305
            +D  +++   K+K   + K        L  SK N  S SE + +++ L      ++T E 
Sbjct: 688  RDILIQNLEEKLKATTDDKNRLENDLALHVSKMN-RSMSEVKEVNDELRSQVTILRTKEE 746

Query: 1306 NSK 1314
            N +
Sbjct: 747  NQR 749

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 56/304 (18%), Positives = 130/304 (42%), Gaps = 14/304 (4%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITH------ETNRKAECERSKN----AIDSLYYHEQLEKKDLNE 549
            S++ +   T +    G+ H      +T +K E  ++K     A  +L   E  +  ++ E
Sbjct: 308  SAVGEKTATAQGEDNGVLHAEEDLDKTKKKLEELQTKYDDLIAKQTLVGEEDSKMCEIKE 367

Query: 550  KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI-EEVEDNKISINSLEQQLLE 726
            +   + I++   + +  + + D + K EE + ++  +K +  E+ D K ++ + +     
Sbjct: 368  ELESLKIENTSLLHELQEMKKDLKFKAEEVDNVRDILKSVGNELVDAKETLKNYDSANTT 427

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN 906
            E T    L+    KLQ         ++D+Q +  K++   E E+ + + E   L      
Sbjct: 428  EITE---LKSRLEKLQSETSIEVKRYEDVQAELKKRITSLEKEITESRQETDSLKTSLRK 484

Query: 907  LKADKTQFSQKEKQYSQKYIYIEK---YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
               DK +   + K+  +      K    +S   +E+N  +     +K  +++  K I +L
Sbjct: 485  SDQDKNKLLAELKKSEETIGNFRKDNNSLSDQLREFNVLKRSDASMKMSLNQKEKTITYL 544

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEAL 1257
            E+ ++  ++ + +  A T+++   +++ + +R            Q +K N+   +E +  
Sbjct: 545  EQQIKEYSSKEEA-GARTLREVKAENSKILNRVS----------QLTKENEELKNEVKKA 593

Query: 1258 DNVL 1269
            DN L
Sbjct: 594  DNSL 597

>KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {ON}
            Anc_4.46 YLR309C
          Length = 964

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 75/374 (20%), Positives = 155/374 (41%), Gaps = 11/374 (2%)
 Frame = +1

Query: 295  YERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKA 474
            YE ++    + +K       +  A+  I  ++  IS  +D+ QT   L+V  T  TN+ +
Sbjct: 63   YESKYPLLLNAYKSERVKNEKFEAVQKILMENTPISDFNDVEQT---LSVFFTDLTNKTS 119

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS 654
                    +       + E K L +++     ++L +  K+ +         +++E+   
Sbjct: 120  MLNEEIKRLTIAKQKTEEENKQLKQENKDKLPENLSQTEKEAEGGTPFEGSTDDSELQTI 179

Query: 655  FIKEIEEVEDNKISINSLEQQL-LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK 831
            F  +  ++ D +  I  L+++  +EEK+             E  K++      L+DD   
Sbjct: 180  FETQKRQITDLQTEIKDLKEKYEIEEKSREE---------AELAKKV------LEDD--- 221

Query: 832  KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
              KQ   ++ K+K E++ ++  N + +       ++ K   +     +K ++       +
Sbjct: 222  -EKQYGTDITKIKTELQQVSEKNDSAEKTIKTLEEQLKHVEETATEDKKLLNSKDVLLKE 280

Query: 1012 KEDECNRLKFVVDKNMKKIDHLERSLQA--QTNAQN-------SFSAVTVQDEDQKDAHL 1164
             ED+  +L+  + +  +KI  L++ +++   T +QN       S SA   +   +K    
Sbjct: 281  NEDQMRKLEGEIQEKKQKIATLQKDVESLKVTVSQNGSNVDMPSLSASKKKKNKKKGKKN 340

Query: 1165 EDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCL 1344
                  +     Q +  S + D S + A   D++L    NT++TL GN + +     K  
Sbjct: 341  GPTTDNISVEAAQDV-NSASIDESTAAASRYDDLLNKY-NTLETLHGNCEDWKV---KYT 395

Query: 1345 KYVTGS-SRLKENE 1383
            K  T S S+ KE E
Sbjct: 396  KLETDSESKCKEIE 409

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 57/247 (23%), Positives = 107/247 (43%), Gaps = 15/247 (6%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE 642
            N K+      N+I        L+ K+ N++ + M  D L      N+      DK  E +
Sbjct: 644  NLKSNSNEQTNSIKRQCEELNLKLKEANKRIMSME-DEL------NEYSTIIHDKTREAD 696

Query: 643  VLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQD 819
             ++  + E + E  D + S+ +     LEEK     L  D   +  +  R   E Q+L+ 
Sbjct: 697  TMRRLLSESQNEGTDKQESLQTKLSFALEEKAK---LESD---MALQSSRQIRETQELK- 749

Query: 820  DYSKKMKQKEYEVQKLKN-------EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
               +   + E E+ KLK        E++ LT++N  +K       +K +  S+    +EK
Sbjct: 750  ---RSQNELETEMHKLKMKEKQMLLEIETLTSLNEAIK-------RKNEVNSEDSSGLEK 799

Query: 979  YMSHVKQEYNKKEDECNRL----KFVVDKN---MKKIDHLERSLQAQTNAQNSFSAVTVQ 1137
              S++K+  ++ +     L    + ++D N    KK D L ++ ++ +N  N+F  V  Q
Sbjct: 800  IASNLKESLSRADKRVQELQKSNEELLDLNNDINKKFDRLTKNYKSLSNQFNAFKDVR-Q 858

Query: 1138 DEDQKDA 1158
            D  ++ +
Sbjct: 859  DTSRRSS 865

 Score = 34.7 bits (78), Expect = 0.67
 Identities = 41/233 (17%), Positives = 92/233 (39%), Gaps = 3/233 (1%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHL 579
            + + +   + +   V  T +   +AE    K  I    Y E+  K +   K L+   + L
Sbjct: 452  NELVEARDSIKEAGVNSTDKLKLEAEITALKEKISM--YEEKEPKLNETIKKLRQTEEDL 509

Query: 580  LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRD 759
             +     +  ++   K   T  L+   KE + +       NSL+  LL+++     L + 
Sbjct: 510  KRKHNDEKAALESNVKFL-TSTLEEKKKENDILSTQLKDYNSLKSSLLQKEKTVVYLEKQ 568

Query: 760  YYKLQERGKRLCHEFQDLQDDYSK---KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
              +     + +  + + L+ D  K   +++  + E + L  EVK  +        +  + 
Sbjct: 569  VREFTTNDEAVKRKLETLKKDNEKLNNRIELLKKENESLTAEVKKNSGSYEGYLKENGKL 628

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 1089
             ++     +KY  ++   S+  ++ N  + +C  L   + +  K+I  +E  L
Sbjct: 629  CERLNVLQEKYNTLQNLKSNSNEQTNSIKRQCEELNLKLKEANKRIMSMEDEL 681

>CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} similar to
            uniprot|Q12234 Saccharomyces cerevisiae YOR216c RUD3
          Length = 459

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 49/245 (20%), Positives = 106/245 (43%), Gaps = 8/245 (3%)
 Frame = +1

Query: 592  KQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS-------LEQQLLEEKTANNIL 750
            +QN  +V G DK++          E+EE  ++    ++       + ++L   KT  + +
Sbjct: 57   EQNSEEV-GSDKVDN---------EVEETRNDGAENSNTGNTDENIREELERVKTERDQV 106

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
               Y  L  R   +   F         KMK+ E E++ +K +++   N N NLK   +  
Sbjct: 107  ESQYQTLLSRLSSMKTIFS--------KMKESEAELEVVKEQLQEYENQNLNLKNKVSLL 158

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQ 1110
            ++++K+  +    + K +  ++ E    +D+       + ++  +I  LE  L+A++   
Sbjct: 159  TKEKKELEETATTLNKELESLESEQESNDDK-------LKESQTRIKELEHQLEAKSEIS 211

Query: 1111 NSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSE-AEALDNVLGLIENT 1287
             S S    ++ +Q ++ +++    V +  +Q L  SK       +  E L+N    ++N 
Sbjct: 212  KSESGRLKKENEQLNSQVQELL-VVIDNNKQDLSASKEEIEDLKQNVENLENEKVKLQNA 270

Query: 1288 MKTLE 1302
               +E
Sbjct: 271  FNDME 275

 Score = 39.7 bits (91), Expect = 0.015
 Identities = 49/256 (19%), Positives = 111/256 (43%), Gaps = 14/256 (5%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTK----HISISSISDLAQTFETLAVGITHE 459
            + ER    RD    +    ++R  ++  I +K       +  + +  Q +E   + + ++
Sbjct: 95   ELERVKTERDQVESQYQTLLSRLSSMKTIFSKMKESEAELEVVKEQLQEYENQNLNLKNK 154

Query: 460  ----TNRKAECERSKNAI----DSLYYHEQLEKKDLNEKSLQMA-IDHLLKVTKQNQRQV 612
                T  K E E +   +    +SL   ++     L E   ++  ++H L+   +  +  
Sbjct: 155  VSLLTKEKKELEETATTLNKELESLESEQESNDDKLKESQTRIKELEHQLEAKSEISKSE 214

Query: 613  DGRDKLEETEVLKSFIKEIEEVEDN-KISINSLEQQLLEEKTANNILRRDYYKLQERGKR 789
             GR K +E E L S ++E+  V DN K  +++ ++++ + K     L  +  KLQ     
Sbjct: 215  SGRLK-KENEQLNSQVQELLVVIDNNKQDLSASKEEIEDLKQNVENLENEKVKLQNAFND 273

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY 969
            +  +   ++    +++ +K  E+  L+      T ++  ++A   + S+ E+        
Sbjct: 274  MELQLDAVEKANKEQLDEKNLEINALR------TQLDQAIEAKNAEISKMEE-------- 319

Query: 970  IEKYMSHVKQEYNKKE 1017
            +EK ++ +KQ+   KE
Sbjct: 320  LEKKLAAMKQDVTLKE 335

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 56/255 (21%), Positives = 118/255 (46%), Gaps = 6/255 (2%)
 Frame = +1

Query: 457  ETNRKAECERSKN--AIDSLYYHEQLEKKDLNEKSLQMAIDHLLK--VTKQNQR--QVDG 618
            E+  K E E SK    IDSL     L++K LNE +   +I+  +   +T+ +     ++ 
Sbjct: 874  ESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNE 933

Query: 619  RDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH 798
            + KL E++ +KS    I+E++D  + I  ++ Q+   K  +         LQE+ K L  
Sbjct: 934  KQKLIESQ-MKSKKDRIKELQDKIMKIGGIKLQMQNSKVDS---------LQEQKKILI- 982

Query: 799  EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
                      KK K ++  + K++++V+ L+      ++D T+ ++K+     +   IE+
Sbjct: 983  ----------KKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIALENELKNIEE 1032

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDA 1158
             ++  +   N  +D+   L+   +  M ++  +E  L      +     V  + + +K A
Sbjct: 1033 LLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLE-----VEYKIKSEKLA 1087

Query: 1159 HLEDRYHKVKEFMEQ 1203
             L ++  K+ + +E+
Sbjct: 1088 SLLNQIKKILKALEE 1102

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 46/257 (17%), Positives = 107/257 (41%), Gaps = 7/257 (2%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            E +   I +L   E ++        LQ  ++++ ++  + +++ D    LE  E +    
Sbjct: 266  ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDD-GLLEYLEDIIGTT 324

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
            K  E ++   I I +L    +E +   +I+ R+   L+   +         ++    K K
Sbjct: 325  KYKELIDKKFIEIEALNDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSK 384

Query: 841  QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED 1020
              +Y++ +             N+K   T               +EK ++ ++ EYN++++
Sbjct: 385  LIQYKIWQ------------NNIKLSNT---------------LEK-ITKLEDEYNQEKN 416

Query: 1021 ECNRLKFVVD-------KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYH 1179
            +   LK  +D       KN  ++  L +  +   NA+ S  +  V + +Q   ++E +  
Sbjct: 417  KNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQL-KNIEKKLK 475

Query: 1180 KVKEFMEQKLQTSKNND 1230
            K  + +E+ L+T  +++
Sbjct: 476  KTAKEIEEDLKTISSSN 492

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 39/161 (24%), Positives = 66/161 (40%)
 Frame = +1

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS 1086
            L  +K Q   K K    K       +S+  ++  K EDE N+ K    +   KID L + 
Sbjct: 372  LSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRK- 430

Query: 1087 LQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNV 1266
                         +  +++D+  A L+D     KE +  K     +N    S  E L N+
Sbjct: 431  -------------LYTKNQDELQALLKDE----KELVNAKRSLDSDN---VSNTEQLKNI 470

Query: 1267 LGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHI 1389
               ++ T K +E + K  S++  + LK    + +L E + I
Sbjct: 471  EKKLKKTAKEIEEDLKTISSSNVR-LKNFHDNKKLFETQLI 510

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 66/323 (20%), Positives = 140/323 (43%), Gaps = 3/323 (0%)
 Frame = +1

Query: 379  PTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSL 558
            P    SIS+I+D   T +           R+ E  +S++ I        L++ +L  +  
Sbjct: 90   PNNATSISNINDEILTLQ-----------RELERAKSEHLISQSEAERSLKQSELVREHN 138

Query: 559  QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTA 738
            Q   +HL+K T++   Q     K+EE +         +E+++ +  ++ L       K  
Sbjct: 139  QWLEEHLVKTTEELMTQKQSILKMEEKD---------QEIDNLRHEVSIL-------KKN 182

Query: 739  NNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD 918
            N++L     +L E  +    E +   DDYS K ++  +E+  LK+ +   +++ T LK  
Sbjct: 183  NDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEI-GLKDRIN--SSLETQLKEI 239

Query: 919  KTQFS-QKEKQYSQ-KYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
            + + S Q E   S+ +   I + +   +++     +EC RLK  V++ +  ++       
Sbjct: 240  QQEKSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVN------G 293

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAE-ALDNVL 1269
              +++ +      ++ ++QKD +LE +       +E K+    + +    + E  L +V 
Sbjct: 294  EYSSSSSLLKKELLKVKEQKD-YLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVT 352

Query: 1270 GLIENTMKTLEGNSKYYSTTTKK 1338
             L++      E   K + +  +K
Sbjct: 353  SLVDRISIERESLEKEFQSFKRK 375

 Score = 37.7 bits (86), Expect = 0.079
 Identities = 58/284 (20%), Positives = 113/284 (39%), Gaps = 5/284 (1%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            D+ RR  T +DT+   ND+ +       I  + +  + I++L +    +   + H   + 
Sbjct: 420  DFIRRL-TENDTYARNNDSQSI------ISERLLKFADITELQKQNMDILATVRHLAGQL 472

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK 651
             E E+ + A      H  +E+K L E   + A+  L + T   +R+++   K  E +V K
Sbjct: 473  EEQEKLRQAD-----HHTIERKTLEEA--KKALLDLQEYTNSLERKLETFRK--ERDVYK 523

Query: 652  SFIKEIEEVEDNKISINSLEQQLL-----EEKTANNILRRDYYKLQERGKRLCHEFQDLQ 816
               K      +     N +++        E +     L ++  KL    K + ++ ++L+
Sbjct: 524  LLSKGKSPSSNKPSECNDIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELE 583

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK 996
                K    KEY   K +     L  +  N K+   Q    ++  SQK    E  ++ + 
Sbjct: 584  YSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQK----EAKLAELT 639

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV 1128
            Q+ ++   + N L+        + + L    Q QT  +  F  V
Sbjct: 640  QDLHELTSQYNLLQIRFTDTQSQSNSLR--TQHQTTQKELFEVV 681

>ZYRO0F10538g Chr6 (856604..864181) [7578 bp, 2525 aa] {ON} weakly
            similar to uniprot|Q00402 Saccharomyces cerevisiae
            YDR150W NUM1 Protein required for nuclear migration
            localizes to the mother cell cortex and the bud tip may
            mediate interactions of dynein and cytoplasmic
            microtubules with the cell cortex
          Length = 2525

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 46/238 (19%), Positives = 106/238 (44%), Gaps = 11/238 (4%)
 Frame = +1

Query: 631  EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            E+   +     E + +ED    ++S  Q   +E TA   L+   ++L+ + ++   EF++
Sbjct: 108  EKNGTINQLQDEYQNLEDKHEKLDSSHQVTSKELTA---LKDTNWELEVKLQQFSVEFKE 164

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            L+D  ++  K+ + E +  K  +  L          + + +++EK+YS +   + K +S 
Sbjct: 165  LKDKLNRNKKELKVEQENSKTTMAELEVSRLQRTGLEKELAEREKEYSAELTELRKNVSE 224

Query: 991  VKQE----------YNKKEDECNRLKFVVDKNMKKIDHLERSL-QAQTNAQNSFSAVTVQ 1137
            +  E           +KK  +   L+  + ++ + +D+L+R L + +T  +NS     ++
Sbjct: 225  LNDENDSLYGRIKTLDKKILQNESLRTQLSESAQLVDNLKRQLGELETKLENSSDNGILK 284

Query: 1138 DEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
             +  K    E   +K+K  +      +KN+D    E      ++  ++  + T E  +
Sbjct: 285  AQLSKS---ESTVNKLKLQLTDLKTKNKNHDDLQLELLHSRGLISKLKQQVATFEATT 339

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
            YOR140W
          Length = 810

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 53/246 (21%), Positives = 96/246 (39%), Gaps = 6/246 (2%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI 693
            +H Q++ +    + +  A +   +  +Q Q+Q   +  L       SFI     + + + 
Sbjct: 219  FHPQMQPQWQRPQFIINAENEQQQQQQQQQQQQQQQQPLPPLSRTDSFILHRYSIFNQQF 278

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK--QKEYEVQKL 867
                LE +L E   + + LR DY+ LQ +   L  + + L  D  K +   QK   +QKL
Sbjct: 279  QSQQLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKL 338

Query: 868  KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE----KYMSHVKQEYNKKEDECNRL 1035
             +EV        +LK D ++  Q +K + Q+  Y+E    ++ +++ Q   KK   C   
Sbjct: 339  SSEVYH----EASLKDDPSKLHQFQK-HQQEMSYLEQEILRFKANLMQRLTKKLGSC--- 390

Query: 1036 KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT 1215
                            +    T+A  S+          K  H+    HK K   + K + 
Sbjct: 391  ----------------ATTTATSASTSYKPKPKPKPKHKLKHMHKHKHKHKPMPKHKPKP 434

Query: 1216 SKNNDP 1233
               + P
Sbjct: 435  KPKHKP 440

>Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON}
            (70806..73295) [2490 nt, 830 aa]
          Length = 829

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 57/339 (16%), Positives = 143/339 (42%), Gaps = 3/339 (0%)
 Frame = +1

Query: 295  YERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKA 474
            YE+ F+  + T  +  + +   Y   +   K    SS+++++++ E+L   +    N   
Sbjct: 381  YEQHFKQFEATEMKALENIQSVYKANSENLKVTLTSSVTEVSESIESLKDKMISHENLSI 440

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEK--SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            E   + +   S + ++  + K+ + K  SL   I  L K+ K     + G  + E  E  
Sbjct: 441  EKVDNLSVELSQFKNQVFDCKEYDSKINSLSQEISDL-KLQKTQTLSLLGTKEAEFEEAS 499

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            K  I++  ++E   IS +++   +                     K L +E ++ + +  
Sbjct: 500  KKLIEQTAQLEKYIISNDTMTTSI---------------------KNLGNELKEAEINID 538

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
            +   +++  +   +N++   T ++  L ++     ++  Q  +    I++  +  K  Y 
Sbjct: 539  RLKDEEKVNLSNYENKIAAHTAISNTLNSENEMLKKRIAQLEEASTTIQEENTKKKDRYQ 598

Query: 1009 KKEDECNRLKF-VVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKV 1185
            K  D+ N+L   VV     +++  E + + +T           + E++++ + E+ Y++V
Sbjct: 599  KINDQLNKLNVEVVQLKAHELELEEENRRLKT-----------KFEEERNGY-EETYNEV 646

Query: 1186 KEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            K + ++ +    +     SE   L + +  ++ T+  L+
Sbjct: 647  KRYKQKIILLESDKQEIVSEKLELQDSIEQLKKTIDHLK 685

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 39/201 (19%), Positives = 88/201 (43%), Gaps = 11/201 (5%)
 Frame = +1

Query: 625  KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQER-GKRLCHE 801
            K  + EV     ++++E+E  K  +++   QL EEK  N+ L  ++ +L++   K+L   
Sbjct: 266  KNSKAEVENEIARKVKEIEYLKKELDNCSGQLSEEKIKNSSLLMEFSRLRDHSSKQLDET 325

Query: 802  FQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD----------KTQFSQKEKQY 951
             + + + Y+  +   E E+ K  N+    +N     K D          ++Q SQ E+ +
Sbjct: 326  AKKMNELYNNMVGYLETELSKRINDKLDSSNEKILEKIDVNKLETVILYESQMSQYEQHF 385

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVT 1131
             Q      K + +++  Y    +    LK  +  ++ ++     SL+ +  +  + S   
Sbjct: 386  KQFEATEMKALENIQSVYKANSE---NLKVTLTSSVTEVSESIESLKDKMISHENLSIEK 442

Query: 1132 VQDEDQKDAHLEDRYHKVKEF 1194
            V +   + +  +++    KE+
Sbjct: 443  VDNLSVELSQFKNQVFDCKEY 463

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
            similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 63/355 (17%), Positives = 135/355 (38%), Gaps = 38/355 (10%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKA-----ECERSKNAIDSLYYHEQLEKKD 540
            + T++  +  + D+ +T     V    +   +      E +R K  +++L+        D
Sbjct: 370  LKTRNEELEMVKDMLKTVGNELVDAKDKLKEQGGTSDEELKRLKAEVEALH--------D 421

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS--FIKEIEEVEDNKISINSLEQ 714
               +S     + L K+TK+    +D +++LE   V  +    +  E+V+  +I  N +  
Sbjct: 422  AKSQSASSYEEQLGKLTKEVATLLDDKNRLESVLVQSNDQLTRAQEQVQKFRIQNNEMND 481

Query: 715  QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQD------DYSKKMKQKEYEVQKLKNE 876
            ++ E  T           L +R K + +  Q ++D      +  K ++  E E ++L   
Sbjct: 482  KMREFNTLKKSESNSKLALAQREKTIAYLEQQVKDYSLQGSNAQKALRDLEIERERLNKR 541

Query: 877  VKFLTNMNTNLKADKTQFSQKEKQY--------------SQKYIYIEKYMSHVKQEYNKK 1014
            +++L       K++  + S   + Y               +KY  ++   S+   + +  
Sbjct: 542  IEYLVKDLERTKSESKKSSGSLENYIKENGKLSERLEVLQEKYDTVKSLKSNSNNQVDSI 601

Query: 1015 EDECNRLKFVVDKNMKKIDHLERS-------LQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
            + +C  L   + +  KKI  LE         LQ +T   N+   +   D    +A   + 
Sbjct: 602  KRQCEELNVKLKEANKKIIALEEELNENANILQERTRETNAMRRLLNDDHTDTNAKFREL 661

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCS----EAEALDNVLGLIENTMKTLEGNSKYYST 1326
              K+    +++ +     D   S    E + L      +++ + TL    K Y T
Sbjct: 662  EEKLAIIRDERDKLKSELDIQVSRRHREVQDLRETNLELKSQISTLTLKEKEYET 716

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 76/391 (19%), Positives = 141/391 (36%), Gaps = 56/391 (14%)
 Frame = +1

Query: 295  YERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKA 474
            YE+++      +K   +      AL  I +++  +SS+++  Q       G   + N K 
Sbjct: 68   YEQKYPLLLTAYKAEKEKAEDIEALIKILSENTPVSSLNEADQL-----KGFFEDLNMKN 122

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG------------ 618
                 +  +  L Y      K+L E   Q+A++   KV+    + +D             
Sbjct: 123  SLLNDE--VKRLSYEAISRDKELEELK-QLAVEQYSKVSANEDKDLDALLETQKLKLEQK 179

Query: 619  -----RDKLEETEVLKSFIKEIEE--------VEDNKISINSLEQQLLEEKTANNILRRD 759
                 R+K  E E LKS ++++++        V + + +++ L+ QL ++    N +   
Sbjct: 180  YDEIVREKDGEIEELKSTLQKVDQKIETLELLVAEKENALSGLDGQLKDQDEKLNQME-- 237

Query: 760  YYKLQERGKRLCHEFQDLQDDYSKK----------MKQKEYEVQKLKNEVKFLTNMNTNL 909
              KL    K +  EF + + +   K           K+ + +  K K  VK +     NL
Sbjct: 238  --KLLSLYKDVIKEFDEPKSNVVSKGSPPTSTGRSNKRNKNKKNKNKQSVKDIAGGGVNL 295

Query: 910  KADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE--- 1080
            + D      KE   S          + VK  Y     +  +LK  ++KN K  D      
Sbjct: 296  EHDGVDNKDKEPGTSLSEAIFSSIETKVK--YENLCGDYEKLKEELEKNKKDGDQYREME 353

Query: 1081 -RSLQAQTNAQNSFSAVTVQDE-----------------DQKDAHLEDRYHKVKEFMEQK 1206
             R    Q+   ++  A+  ++E                 D KD   E      +E    K
Sbjct: 354  LRISSLQSELSDTKVALKTRNEELEMVKDMLKTVGNELVDAKDKLKEQGGTSDEELKRLK 413

Query: 1207 LQTSKNNDPSCSEAEALDNVLGLIENTMKTL 1299
             +    +D     A + +  LG +   + TL
Sbjct: 414  AEVEALHDAKSQSASSYEEQLGKLTKEVATL 444

 Score = 38.1 bits (87), Expect = 0.056
 Identities = 57/280 (20%), Positives = 108/280 (38%), Gaps = 1/280 (0%)
 Frame = +1

Query: 517  HEQLEKKDLNE-KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI 693
            H+ ++ KD     SL  AI   ++   + +      +KL+E   L+   K+ ++  + ++
Sbjct: 297  HDGVDNKDKEPGTSLSEAIFSSIETKVKYENLCGDYEKLKEE--LEKNKKDGDQYREMEL 354

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
             I+SL+ +L + K A      +   +++  K + +E  D +D   ++    + E+++LK 
Sbjct: 355  RISSLQSELSDTKVALKTRNEELEMVKDMLKTVGNELVDAKDKLKEQGGTSDEELKRLKA 414

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
            EV+ L +            SQ    Y       E+ +  + +E     D+ NRL+ V   
Sbjct: 415  EVEALHDAK----------SQSASSY-------EEQLGKLTKEVATLLDDKNRLESV--- 454

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDP 1233
                   L +S    T AQ       +Q+ +  D        K++EF             
Sbjct: 455  -------LVQSNDQLTRAQEQVQKFRIQNNEMND--------KMREF------------- 486

Query: 1234 SCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYV 1353
                            NT+K  E NSK      +K + Y+
Sbjct: 487  ----------------NTLKKSESNSKLALAQREKTIAYL 510

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 71/369 (19%), Positives = 157/369 (42%), Gaps = 10/369 (2%)
 Frame = +1

Query: 307  FETRDDTFKEVNDAVNRCYAL-CNIPTKHISISSISDLAQTFETLAVGITHETNRKAECE 483
            F+     F E +D V + Y+   N   + IS+S    + +    L        N K++  
Sbjct: 1276 FDKERQLFAEGSDMVTQEYSKKINTLEEQISVSE-KQIEEVKSQLQASEKTVRNLKSDSI 1334

Query: 484  RSK--NAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSF 657
             S+  N I        L   +   K +    D L   + +N   + G+ +   TE +KS 
Sbjct: 1335 ASQQTNDIKVESLKSALASSEKQAKEVTQKYDKLKTSSDENASSLKGQIE-RLTEAVKS- 1392

Query: 658  IKEIEEVEDNKISINSLEQQL---LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
              E    E N   +N L+++L   +E       L ++   L +R K+L +E ++   +  
Sbjct: 1393 --ETRAKEINAKDLNQLKEKLQCFVETMNKLETLEKENAVLDQRVKKLKNEKEETVKNLE 1450

Query: 829  KKMKQKEYEVQKLKNEVKFLT-NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
             K++    E Q LK +++  + ++N N    +   S K+K  S         +  +    
Sbjct: 1451 VKLETLSSEKQSLKEKLQGQSISLNDNESLREENNSLKKKIES---------LEELTDAC 1501

Query: 1006 NKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKV 1185
            +K  +E   +    ++ +K ++ +  +L+++ + + S  A++ +   ++DA + +   + 
Sbjct: 1502 DKSLEESKSMIVQHEEGIKSLNSINSTLKSELDLKESALALSEKLIQERDAIVTNNKEQT 1561

Query: 1186 KEFMEQKLQTSKNNDPSCSEAEA---LDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVT 1356
             +  E+     + N    ++AEA   +D+++ L+ +  K    N++Y S   K  ++  +
Sbjct: 1562 AKLEERMKDLERQNRVLLAKAEANSEIDDLMLLVNDLDKK---NARYRSLLRKNAIQLSS 1618

Query: 1357 GSSRLKENE 1383
                 +E++
Sbjct: 1619 DEEEEEEDD 1627

>TDEL0A07030 Chr1 (1229629..1231527) [1899 bp, 632 aa] {ON} Anc_6.289
            YMR198W
          Length = 632

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 67/328 (20%), Positives = 135/328 (41%), Gaps = 15/328 (4%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHL 579
            S I ++ +    +   I H  N  AE E+    I      +QL              + +
Sbjct: 71   SVIEEVKKRERKIMKDIAHFRNAIAEIEKETIQIRE----QQLPDMQYEISKRLTMCNEV 126

Query: 580  LKVTKQNQRQVDGRD-------KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTA 738
             K T Q   Q+D +D       K EE ++    +K   EV++ +   N L+Q L +EK  
Sbjct: 127  KKETSQLTTQLDMKDRENDLCRKNEELDMANMQLKHSVEVQEVE---NQLKQVLDDEKLK 183

Query: 739  --NNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
                I+  +  K  E+  +  H+ +D       K   +++E  + +N+ K  T      K
Sbjct: 184  WDKKIMELENLKPDEKVAQEIHQLRD-----ELKQVNEQWEALQRENQDK-CTEYEAKFK 237

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
             D  +F + +++       +EK    +   + K + EC++L   +D + K+   +E  + 
Sbjct: 238  EDLEEFKRFKQEPMDN---LEKEQGKLLDRHKKLQVECDQLVNQIDSDKKEFSSIELKIM 294

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHL--EDRYHKVKEFME--QKLQTSKNN--DPSCSEAEA 1254
               + Q   +   + ++  +D  +  +  Y K K+  E  Q++  ++ +       + E 
Sbjct: 295  ---DIQQKITDTMIVNQPLEDELVVSQSHYEKAKQETEAIQEIAHARESYYKGKFDKMEE 351

Query: 1255 LDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
                   +ENT++ L+G  + ++  TKK
Sbjct: 352  EQLRRRKLENTIEELKGGIRTFAYITKK 379

>TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {ON}
            Anc_8.704 YPL174C
          Length = 861

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 66/265 (24%), Positives = 106/265 (40%), Gaps = 23/265 (8%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            DY  +     ++  ++    N C          +  S   D  +  E L      ETN K
Sbjct: 143  DYLLKISDLIESLDDLKCKYNECIVTLKELETEVDTSRKLDKKRIGELLNDAHIDETNLK 202

Query: 472  AECERSKNAIDSL---YYHEQLEKKDL--NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE 636
                R  N++ S    Y     E +DL     +LQ   + L K      +     DK  E
Sbjct: 203  DLATRLYNSLTSTTDQYESLLAENEDLLGENTTLQALFEDLNKENIALSKTATDLDK--E 260

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ--------ERGKRL 792
             E++K   KE+ E   N+   NS  Q +LE K++  I      + Q        E  + L
Sbjct: 261  LEIVKDS-KELVEFLTNE---NSKLQNILERKSSKIIDMEKEIEYQNNIISVYAEMEQEL 316

Query: 793  CHEFQDLQDDYSKKMKQKE---YEVQKLKNEVKFLTNMNTNLK---ADKTQFSQKEKQYS 954
              E +DL+  YSK +K  E    E  KL +E+K L N N ++     +   +++KE  Y 
Sbjct: 317  HLEIEDLKIKYSKSVKNNEDLVNENVKLSSELKNLFNTNADISDVHKNNNGYTEKEIIYK 376

Query: 955  QKYI----YIEKYMSHVKQEYNKKE 1017
             K I    Y++K + ++    N ++
Sbjct: 377  DKIINKGNYLDKLLEYLLSSKNYRK 401

>Suva_14.260 Chr14 complement(477268..477867) [600 bp, 199 aa] {ON}
            YNL079C (REAL)
          Length = 199

 Score = 44.3 bits (103), Expect = 2e-04
 Identities = 45/200 (22%), Positives = 96/200 (48%), Gaps = 8/200 (4%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS 696
            +E+L++K+ + +   +  ++L+K      +Q++     EE E L++ + E ++ E + + 
Sbjct: 22   YEELKEKNKDSEQETVEKENLIKSLTVKNQQLE-----EEIEKLEAGLTETKQTEQDNVE 76

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQER---GKRLC---HEFQDLQDDYSKKMKQKEYEV 858
                E Q+      N+ L  +  KL+      K+L    H  Q   D+YSKK +Q E ++
Sbjct: 77   ---KENQIKSLAVKNSQLEDEIEKLEAELAESKQLSEDSHHLQSNNDNYSKKNQQLEDDL 133

Query: 859  QKLKNEVKFLTN--MNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR 1032
            ++   ++K  T      +LKAD         Q  ++ + +E+     ++E+ +K +E   
Sbjct: 134  EESDTKLKETTEKLREADLKAD---------QLERRVVALEEQ----REEWERKNEE--- 177

Query: 1033 LKFVVDKNMKKIDHLERSLQ 1092
            L    ++  K++D +  SL+
Sbjct: 178  LTAKYEEAKKELDEIAASLE 197

>KLTH0F12144g Chr6 complement(1023571..1026102) [2532 bp, 843 aa] {ON}
            weakly similar to uniprot|P53253 Saccharomyces cerevisiae
            YGR089W NNF2 Protein that exhibits physical and genetic
            interactions with Rpb8p which is a subunit of RNA
            polymerases I II and III computational analysis of large-
            scale protein-protein interaction data suggests a role in
            chromosome segregation
          Length = 843

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 37/162 (22%), Positives = 74/162 (45%), Gaps = 1/162 (0%)
 Frame = +1

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
            NTNL  ++ +  + +K+ S+K   + + + H+K + ++   +  +  F +D N+K +  L
Sbjct: 635  NTNLAEERAKLKKTKKEASKKLASLRQQIDHLKSKISQNASQDGKSAFKMD-NLKTV--L 691

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQ-KLQTSKNNDPSCSEAEA 1254
            ++S    T  ++    +  Q++  +  HL+ +   ++  ME  KLQT+        E E 
Sbjct: 692  QQSETQLTKLEDELKDLLEQEQQVEREHLQQKDRHLRNQMEYGKLQTTLE-----IELEE 746

Query: 1255 LDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKEN 1380
                L  +E  +  L+      S   +K  K VT  +   EN
Sbjct: 747  YSTKLSKLEQELTQLKSKRDKVSMKQEKLKKEVTQCTEDMEN 788

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 23/162 (14%)
 Frame = +1

Query: 532  KKDLNEK--SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS 705
            KK+ ++K  SL+  IDHL     QN  Q DG+   +  + LK+ +++ E        +  
Sbjct: 649  KKEASKKLASLRQQIDHLKSKISQNASQ-DGKSAFK-MDNLKTVLQQSET------QLTK 700

Query: 706  LEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ-------DDYSKKMKQKEYEV-- 858
            LE +L +       + R++ + ++R  R   E+  LQ       ++YS K+ + E E+  
Sbjct: 701  LEDELKDLLEQEQQVEREHLQQKDRHLRNQMEYGKLQTTLEIELEEYSTKLSKLEQELTQ 760

Query: 859  ------------QKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
                        +KLK EV   T    NLKA   QF Q+ KQ
Sbjct: 761  LKSKRDKVSMKQEKLKKEVTQCTEDMENLKA---QFLQQRKQ 799

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
            Ashbya gossypii AER241W
          Length = 854

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 76/340 (22%), Positives = 127/340 (37%), Gaps = 44/340 (12%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI 669
            KN +  L   +  EK DL    L+   + L K+  +N      R K        S +K +
Sbjct: 94   KNLVPELLGSDTREKADLASNPLKEQQNALQKLNMENYSL---RVKCN------SLLKFL 144

Query: 670  EEVEDNKISINSLE--QQLLEEKTANNILRRDYYKLQERGKRLCHE-------FQDLQDD 822
              V D+     SLE   +L E KT ++ L   +  LQ R   L  +        + +   
Sbjct: 145  NNVTDDGQLRKSLEILDELQEWKTKHHELLERFKDLQVRFDGLEQKDTENAKVAEPVDHS 204

Query: 823  YSKKMKQKEYEVQKLKNEVKFLT------NMNTNLKADKTQFSQKEKQYSQKYIYIEKYM 984
            Y   M+ KE E        + LT      N+   LKA    +  +E+QY      ++  +
Sbjct: 205  YCDSMR-KELEAALADTNQQILTLTETIKNLEAKLKATSKDYEAREEQYKMNIDVLKSEI 263

Query: 985  SHVKQEYNKK-------EDECNRLK-----------------FVVDKNMKKIDHLERSLQ 1092
            + +   +  K       E++ NRL+                   +D+  + I +LE  LQ
Sbjct: 264  NQLNSSFISKQEALAQAEEKVNRLRNQLQEFDHNSGSLLELEKKIDEKNQGIRNLESKLQ 323

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT-----SKNNDPSCSEAEAL 1257
             + N Q       +Q  D     L++ Y K K   E KL +     S + +    + E L
Sbjct: 324  -ELNHQRQNLERQLQTSDGVVNSLKNEYEKYKNDTENKLNSYQKSASADENKLREKMEIL 382

Query: 1258 DNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKE 1377
            +     +     +LE N++ +    KK  K +    R +E
Sbjct: 383  EKDNSKLSKMKDSLEQNNREFDVKLKKAEKQIQTLERERE 422

>TDEL0A07200 Chr1 complement(1255540..1258209) [2670 bp, 889 aa] {ON}
            Anc_6.306 YNR011C
          Length = 889

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 63/287 (21%), Positives = 129/287 (44%), Gaps = 18/287 (6%)
 Frame = +1

Query: 421  QTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQN 600
            +TFET    +  ET  KA  E SKNA + +   ++ +KK+ +   L++            
Sbjct: 15   RTFETTTGDVEEETKSKASVEDSKNASNGI---DETDKKEDDMNDLRL---------YAR 62

Query: 601  QRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQER 780
            QR +  R+K ++ E L+  ++ +EE + NK   ++L Q+  ++ +    L+R+  +L ++
Sbjct: 63   QRYLGQREK-KKVEALRQELRLLEE-DVNKYGWDNLTQKERDDVS----LKRELVELFDK 116

Query: 781  GKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKT--QFSQKEKQY- 951
             +    E   LQ+DY    ++ +++V + +   + L N ++  K  K   Q + +EKQ  
Sbjct: 117  KEADFDEGYQLQEDYVD--EKGKFDVSRKR---RVLNNRDSYFKESKATRQQAWEEKQLQ 171

Query: 952  ---------------SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS 1086
                           S+KY ++  + +    ++ +++DE      + +K+ +   HL   
Sbjct: 172  KAVKEDGTDEIMVPNSEKYDFV--FDNDAAIDFTEEDDE-----ILPEKDAEYDTHLSER 224

Query: 1087 LQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
            L A+ N   S   +              +   V ++ E+ LQ  K+N
Sbjct: 225  LDAEQNRTKSIQEMR-------------KLLPVFQYREELLQAIKDN 258

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 41/192 (21%), Positives = 85/192 (44%), Gaps = 6/192 (3%)
 Frame = +1

Query: 622  DKLEETEVLKSFIKEIEEVEDN-KISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH 798
            DK  E  +L   + E+ + + N + S    +++L +  TAN  LRR+  +L E G  +  
Sbjct: 700  DKEHEVSILNRKVDELNKEKWNLQESKEKYKRELQKVITANERLRREKEELNENGNNI-- 757

Query: 799  EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
              + ++D  ++  K    E+  L+ E         N + ++     + ++     + + +
Sbjct: 758  --RVMEDKMTRIKKSYLSEITSLQEE---------NRRLEERLILNERRKDDNSIMQLNE 806

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD- 1155
             +S+ K +Y+ +    N LK + D   K +    R L+  T        +++ D+D+ D 
Sbjct: 807  IISYYKLKYHTEVRHNNDLKVINDYLNKVLALSTRRLRLDTRKGEHSLNISIPDDDELDR 866

Query: 1156 ----AHLEDRYH 1179
                +H+  RYH
Sbjct: 867  DYYNSHIYTRYH 878

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa] {ON}
            Anc_4.46 YLR309C
          Length = 1065

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 65/293 (22%), Positives = 119/293 (40%), Gaps = 12/293 (4%)
 Frame = +1

Query: 460  TNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAI--DHLLKVTKQNQRQVDGRDKLE 633
            +N+K E +  +  I S     +  K +L+EK   + +    L  ++KQ +  +D    LE
Sbjct: 234  SNQKVELQNHEKLISSKEEEIKNGKSELDEKVEMITVINSKLEDISKQCKSHLDSIQNLE 293

Query: 634  --------ETEVLKSFIKEIEEV-EDNKISINSLEQQLLEEKTANNILRRDYYK-LQERG 783
                    E E  +S I  +E+V E ++  I  LE+ + E+    + L  D  K +Q   
Sbjct: 294  SDNNKLKNENEEKQSKILTLEQVVEKHENKIKDLEESVHEKSKLISSLEEDIKKEIQSSA 353

Query: 784  KRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
             +      + +D  S  +      +   K   K     N   +   TQ   K     +KY
Sbjct: 354  GQ-----SNTEDQVSTTLPSTSQTISSKKKNKKKNKKGNNISQPSTTQAPVKSSDSQEKY 408

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
              + K    +K+E+ K +    +L   ++K  K  D L++S     N  ++   +T   E
Sbjct: 409  NALLKEYEVLKEEHEKSD----QLALQLEKITKDFDELKKS----HNDNSNLKEITENFE 460

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
              K ++ +     ++E+ E K+   K+          LD+ L L+ +T K  E
Sbjct: 461  KLKLSNQK----LIEEYNEFKINHEKSIS-DIKHTSELDDELQLLRSTNKEQE 508

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 67/313 (21%), Positives = 125/313 (39%), Gaps = 26/313 (8%)
 Frame = +1

Query: 436  LAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVD 615
            L +    + NR  +    KN   S  Y ++        K LQ   DH   +   +  QV+
Sbjct: 709  LRMSALQKENRDLKENSKKNITSSENYIKENGILSERIKILQEKFDHAQNLKSNSNEQVE 768

Query: 616  G-RDKLEETEV-LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYY-----KLQ 774
              + + EE  V LK   K +  +ED     +++ Q+   E T    L  D +     KL+
Sbjct: 769  SIQRQCEELNVKLKESNKRVMSLEDELNDYSNIIQEKTREATTMRQLISDSHNGDSQKLR 828

Query: 775  E----------RGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT----NMNT--- 903
            E            KRL  EF+      S+++++ + +  KL+  +  LT     +N    
Sbjct: 829  ELHDKIDYFTDENKRLKSEFELSSGKMSRELQEAQAKNSKLQTSIHALTLSEQRLNAEIE 888

Query: 904  NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLER 1083
            NLK+      +K     +    +EK  S +K+  +K + +   L+  ++  MK  +   +
Sbjct: 889  NLKSVNESIRKKSTVNGEDTDELEKSNSSLKEALSKADTKVRDLQENIENLMKANNDTNK 948

Query: 1084 SLQAQTNAQNSFS--AVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEAL 1257
             L+  T +  + S    T++D+    +    R + V         TS  +D S  +++  
Sbjct: 949  KLERITKSYRTVSNQLSTLRDQRGFASSRSSRSNSV---------TSTLHDSSKGDSDGN 999

Query: 1258 DNVLGLIENTMKT 1296
              ++G    +M T
Sbjct: 1000 GFIMGQSRPSMST 1012

>TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {ON}
            Anc_2.257 YIL112W
          Length = 1078

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 46/215 (21%), Positives = 92/215 (42%), Gaps = 8/215 (3%)
 Frame = +1

Query: 586  VTKQNQRQVDG--RDKLEETEVLKSFIKEIEEVEDN------KISINSLEQQLLEEKTAN 741
            V K +  +VD   R K + ++V  S   E ++ E N      KI +   E+QLLEEK   
Sbjct: 646  VDKGDDTKVDNSTRGKHQRSDVEFS---ESDQDESNRNKKIAKIEVPKTEEQLLEEKAER 702

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADK 921
                    K QE  +    + +  ++  ++K K++E E  + + E+             +
Sbjct: 703  --------KRQEEEELRLEKLRVEEERLARKRKEEEEEEDRKRREI-------------E 741

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
             +  QK K+  +K   I K    ++ +  K+E+E    K   ++   ++  L++  + + 
Sbjct: 742  AEEKQKRKEQEEKEERIRKAEEEIRMKKQKEEEEARAEKLKREEEEYRVKMLQQKKKREQ 801

Query: 1102 NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQK 1206
                  +   ++ E +K+ H  +   ++KE   QK
Sbjct: 802  ELLQKLAEDELKREAEKEKHKLEEDKRIKELELQK 836

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 48/251 (19%), Positives = 112/251 (44%), Gaps = 5/251 (1%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV- 645
            + E ++ + +++SL      +KK   E  L   +   +KV    ++    +++ E  +  
Sbjct: 240  RQESDKLRKSVESL---RDFQKKK-GEIELHSQLLPYVKVKDHKEKLNTYKEEYERAKSN 295

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
            L++ +K+ +   + K ++ +   +L E+ +  N    ++ K +E+   +      ++DD 
Sbjct: 296  LRALLKDKKPFANTKKTLENRVHELTEKCSLKN---DEFVKAKEKVNEIFERLNIIRDDV 352

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
             KK  Q EY   + K      T ++T     + Q   ++ Q  +K ++ +  + + ++E 
Sbjct: 353  IKKKTQNEYYRGRTKK--LQATIISTKEDLVRNQEILEQTQLPEKSVFED--IDNKRKEI 408

Query: 1006 NKKEDECNRLKFVVDKNMKKIDHLERSLQAQ----TNAQNSFSAVTVQDEDQKDAHLEDR 1173
              KE +   L   +D     ++H  RS+  Q    TN+ N+   + + ++DQ    + D 
Sbjct: 409  INKEGDLRGLISEIDAKANAVNHEMRSIHRQAENKTNSLNTTDKIGILNQDQDLKEVRDA 468

Query: 1174 YHKVKEFMEQK 1206
               +++  E K
Sbjct: 469  VLFIRDHPEMK 479

>Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL091W
            (REAL)
          Length = 1232

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 47/202 (23%), Positives = 89/202 (44%), Gaps = 2/202 (0%)
 Frame = +1

Query: 631  EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            +E +   S + E + +E+ +  I     +LL+ +     +   Y++ Q    RL    Q+
Sbjct: 570  DEEDTYDSGLDETDRLEEGRKLIQIAITKLLQSR-----IMASYHEKQADNNRL-KLLQE 623

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            L+++  KK ++KE + QK K + K    +    K ++ +  ++EK+  +K +        
Sbjct: 624  LEEEKRKK-REKEEKKQKKKEKEKEKKRLQQLAKEEEKRKKEEEKERLRKEL-------- 674

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
              +E   K  E  R K V +   KK +  +R L+ Q   +        Q E+QK    E+
Sbjct: 675  --EEREMKRREAQRKK-VEEAKRKKDEERKRRLEEQQRREEIQEKQRKQKEEQKRKREEE 731

Query: 1171 --RYHKVKEFMEQKLQTSKNND 1230
              R  + K   ++KLQ  K  +
Sbjct: 732  KKRIREQKRLEQEKLQKEKEEE 753

>KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa] {ON}
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1396

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 32/122 (26%), Positives = 65/122 (53%), Gaps = 6/122 (4%)
 Frame = +1

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
            S ++ Q   E+  L N+V  LTN  T +   KT+  Q+ K+ +     IE  M+ ++  Y
Sbjct: 599  SLQLSQATTELANLSNQVGSLTNQATLVNERKTRAQQELKRINNLKSSIETKMTTLRGSY 658

Query: 1006 NKKEDECNRLKFVVDKNMKKIDHLERSLQ-AQTN---AQNSFSAV--TVQDEDQKDAHLE 1167
             K+  E  +L+ ++ K+ ++ + L+R L  A+ N    Q S + +   +Q+ +Q ++ L+
Sbjct: 659  EKELSETEQLESILTKSRQESEELKRELAVAEANHHAVQGSLAELQQQLQESEQSNSQLK 718

Query: 1168 DR 1173
            ++
Sbjct: 719  EK 720

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 65/340 (19%), Positives = 131/340 (38%), Gaps = 12/340 (3%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHL 579
            + +++L+    +L    T    RK   ++    I++L       K  +  K   +   + 
Sbjct: 607  TELANLSNQVGSLTNQATLVNERKTRAQQELKRINNL-------KSSIETKMTTLRGSYE 659

Query: 580  LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN----KISINSLEQQLLEEKTANNI 747
             ++++  Q +       +E+E LK   +E+   E N    + S+  L+QQL E + +N+ 
Sbjct: 660  KELSETEQLESILTKSRQESEELK---RELAVAEANHHAVQGSLAELQQQLQESEQSNSQ 716

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ 927
            L+     L      L  E  + Q    +K+KQ+   V     +++      TNL+ +   
Sbjct: 717  LKEKIGNLNAIAASLQAELNERQ----QKVKQERSMVDVNSRQLEVSEITTTNLQNEIQG 772

Query: 928  FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA 1107
              Q    + QK+  +E Y    K     K  E N    V+++    I   E+ +Q ++  
Sbjct: 773  LEQHLDIFKQKHKELEDY----KSTLESKHGELNSRHQVLEEQHAGISRREQEVQERSRQ 828

Query: 1108 QNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDN-----VLG 1272
                  +  Q+  +  +  ED   + + F + + +  K       + + L        +G
Sbjct: 829  VEEQEKIYHQEIAKLQSMFEDLSAQRESFAKAEDELQKQQFEYAQKVQELSERRMKLAMG 888

Query: 1273 LIENTMKTLEGNSKYYSTTTKKCLKYVTGS---SRLKENE 1383
             +      +  N + +S+      K+V  S   SRL   E
Sbjct: 889  ELPEDSDEISKNHRSFSSNQDHIAKFVDESVTNSRLGAQE 928

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 66/321 (20%), Positives = 136/321 (42%), Gaps = 21/321 (6%)
 Frame = +1

Query: 424  TFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQ 603
            TF++  + +  E   K+  ERS ++  +   + + E KDL  +   +         + N 
Sbjct: 1204 TFKSKILALEEE---KSSIERSCDSYRTQRQNNEAELKDLRSEMTTLRDSLSSAKNEMNS 1260

Query: 604  RQVDGRDKLEETEVLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQER 780
             +        +T+ L   I E+E E+E+   +I++ E+  L               +++ 
Sbjct: 1261 AKDLSLHLQNDTKDLNDRILELEAEIENKNENISAYEKSKLA--------------IEKE 1306

Query: 781  GKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE----KQ 948
               L  E Q L++ + K+    + E+QKLK+E+K   N   + + ++   ++      + 
Sbjct: 1307 KSNLKIELQSLENKFEKEASVLKSEIQKLKDEMK---NKVQDFEKERKMLNEGSTSITQG 1363

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK----KIDHLERSL-QAQTNAQN 1113
            YS+K   +E  +S+ + E +       R    +D+ ++    K++  E  L   +    N
Sbjct: 1364 YSEKVTALELKLSNTEAELSANIKSLERTNADLDEKLRICEEKLEEKEVELCSLKEKESN 1423

Query: 1114 SFSAVTVQD------EDQKDAHLEDRYHKVKEF-----MEQKLQTSKNNDPSCSEAEALD 1260
              S++ +++      +D +   +    +K+KE      ++++   SKNND S     A  
Sbjct: 1424 VLSSLDLKESEINALKDSQTKEITALNNKIKELSGQINIKEEELKSKNNDISTLNMSAKA 1483

Query: 1261 NVLGLIENTMKTLEGNSKYYS 1323
            N    I++  K LE     YS
Sbjct: 1484 NKES-IDDLKKQLEELQARYS 1503

>Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {ON}
            YDR356W (SPC110) - component of the spindle pole body
            that interacts with Spc42p, calmodulin, and a 35 kDa
            protein [contig 129] PARTIAL
          Length = 567

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 64/297 (21%), Positives = 125/297 (42%), Gaps = 4/297 (1%)
 Frame = +1

Query: 331  KEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSL 510
            K+++D   R   L N+  K      I D  Q  + L   I     +K E  R        
Sbjct: 143  KQLDDLKQRSNQLRNLDGKIDDDRKIKD--QKIKELRAQIQQVVKQKDELNRK------- 193

Query: 511  YYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-RDKLEETEV-LKSFIKEIEEVED 684
              +E+L ++ + + +   A+    + T +N  +    R K +E EV L S IK ++ +  
Sbjct: 194  --NEELRERIVTQATRSPALKINTRKTLENDIETQKLRAKNQELEVELNSSIKALDSLRQ 251

Query: 685  N-KISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
            N +  I  L+ QL   +T   + RR    L++   +L  E + L +    ++   E    
Sbjct: 252  NYRGEIEELKSQLERSETDQLLTRR---ALEKEISKLKFELEALHESKRDEIAILENRCS 308

Query: 862  KLKNEVKFLTNMN-TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK 1038
             L+ E   L++   TNL   +   ++K+KQ  +    +++   H  ++    + E  + +
Sbjct: 309  LLRQENDHLSSQGGTNLAHLQKAMAEKQKQIDE---LVQRCSDHTMEKLRLNK-ELAQTQ 364

Query: 1039 FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
                ++ K++  L   L+  T     F      DE+   + L +++ +  + M+QKL
Sbjct: 365  EAEAESKKELSKLSARLEYITKEFVKFRETGNSDENTSASKLNEKWSEKYQRMKQKL 421

>KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {ON}
            Anc_4.364 YJR134C
          Length = 616

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 56/271 (20%), Positives = 120/271 (44%), Gaps = 19/271 (7%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK 651
            AE + S   +     H+Q E+ +L+    Q   D+ +++           D +   E+++
Sbjct: 49   AEADHSSQILAETEPHKQ-EEYELDPFFKQCLPDNFMEL-----------DPIRLIELIR 96

Query: 652  SFIKEIEEVEDNKIS--INSLEQQLLEEKTANNILRRDYYK-------LQERGKRLCHEF 804
              ++++ + +D+ +   +   ++ + + +  N +L ++  K       L+E+  +L +E+
Sbjct: 97   PNVEKLNKTQDSSLFRLVKEKDESIQKLEKTNELLSKNEKKSLYTISQLEEKSTKLENEY 156

Query: 805  QDLQDDYSK------KMKQKEYEVQKLKNE----VKFLTNMNTNLKADKTQFSQKEKQYS 954
              L+    K      ++K++   + K+  E     K LT    + K  +T+   KE+   
Sbjct: 157  DILKSADKKNTVKIDQLKKELAALNKINKEGESNFKELTKREEDWKNIETKLESKERTIE 216

Query: 955  QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
            +    I+   +  KQE N  E++  RL   ++ N + I  LE SL+ Q   Q S S  T 
Sbjct: 217  ELNATIQALEASSKQEKNDHEEKVKRL---IESNNEHIISLESSLE-QLRIQLSGSESTA 272

Query: 1135 QDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
             D++    + E         ++++L +SK N
Sbjct: 273  DDKEGGAINTES-----YSLLQEQLTSSKKN 298

 Score = 38.9 bits (89), Expect = 0.030
 Identities = 52/249 (20%), Positives = 100/249 (40%), Gaps = 24/249 (9%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            E +K   D      +LE K+   + L   I  L   +KQ +   + + K       +  I
Sbjct: 193  ELTKREEDWKNIETKLESKERTIEELNATIQALEASSKQEKNDHEEKVKRLIESNNEHII 252

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
                 +E  +I ++  E    ++K    I    Y  LQE+       ++ ++   + KM 
Sbjct: 253  SLESSLEQLRIQLSGSESTA-DDKEGGAINTESYSLLQEQLTSSKKNWESIEFQLNLKMT 311

Query: 841  QKEYEVQKLKNEVKFLTNMNT---NLKADKTQF-----SQKE---------KQYSQKYIY 969
              E     L  + K +T +NT   NLK + ++      ++KE         K+ S K   
Sbjct: 312  NLE---TSLGEKEKLITGLNTEIQNLKVENSRLVTEIEAKKEESKTLRLQFKETSNKTSI 368

Query: 970  IEKYMSHVKQEYNKKEDECNRLKFVVDKNMKK-------IDHLERSLQAQTNAQNSFSAV 1128
            +E  ++++K +YN  E +    K  ++ N+K+       I H E         Q   S +
Sbjct: 369  LEMSLNNLKDDYNLLESKYMIQKSQLENNIKEDHSANEIIKHFENGSHEDWFLQAESSLL 428

Query: 1129 TVQDEDQKD 1155
            +++++ Q +
Sbjct: 429  SIEEKPQDE 437

>TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa] {ON}
            Anc_6.184 YPL186C
          Length = 812

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 58/297 (19%), Positives = 125/297 (42%), Gaps = 31/297 (10%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLE-KKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE 633
            +   +AE +R +   +     E+ E KK   E+  +   +      KQ + + + + K E
Sbjct: 506  QEEEEAELKRKQEEAELKRKQEEAELKKKQEEEERKRKQEEAELKRKQEEEEAELKRKQE 565

Query: 634  ETEVLK----SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHE 801
            E E+ +    + +K+ +E E+ K     L++Q  EE+       +   + +ER K+    
Sbjct: 566  EAELKRKQEEAELKKKQEEEERKRKEAELKKQQQEEE-------KKRLEAEERKKKEL-- 616

Query: 802  FQDLQDDYSKKMKQKEYEVQKLKN---------EVKFLTNMNTNLKADKTQFSQKEKQYS 954
              +L+    ++ K+KE E++K K          E K   +     K +  +  +++ +  
Sbjct: 617  --ELKKKQEEERKRKEAELKKKKETEQKRLLDIEQKKRESAELKKKQEAEEKRRQDAELK 674

Query: 955  QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKI-----------DHLERSLQAQ- 1098
            +K    ++ +  ++++   K+D     K  V + MKK+              ER++  + 
Sbjct: 675  KKQDLEQERLLEIEKKNKDKQDTKQISKVKVQQKMKKMQGKTNSQSKIQQGTERNIDPRN 734

Query: 1099 -----TNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEA 1254
                 TN  N  S+      D  +A ++ R HK  E  + +  T+ N + + +E ++
Sbjct: 735  SQNTTTNTTNLHSSSARMTSDSGEATIKQRKHKSTETFKNQPITTSNEENTDTEVDS 791

 Score = 31.2 bits (69), Expect = 7.7
 Identities = 41/215 (19%), Positives = 91/215 (42%), Gaps = 12/215 (5%)
 Frame = +1

Query: 643  VLKSFIKEIEEVEDNKISINSLEQQ----LLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            V+ S  ++   VE N   ++S + Q    +L+    NNI  +     +   K+      D
Sbjct: 137  VVASSQRDDSNVEWNSSLLSSKDGQSDDKILDVANTNNINNKATTTKEIEPKK-----GD 191

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY-IEKYMS 987
            +++  ++  K+     ++  N+ K L       K D  +  QK K+  QK I  +E+ + 
Sbjct: 192  IEESTNENEKKDALGSEQKGNQKKELNKKELKKKKDTEE--QKRKEAEQKRILELEQKLE 249

Query: 988  HVKQ-------EYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED 1146
               +       E  KK++E  + +   +   K++  +E+ ++ ++  +        + ++
Sbjct: 250  EEAELRRQQEVELKKKQEEEEKKR--QEAEQKRLMEIEQKVKEESELKKKKELELKKKQE 307

Query: 1147 QKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAE 1251
            +++ H ++   K    +EQKL+          EAE
Sbjct: 308  EEEKHRQEAEQKRLLELEQKLKEEAELKRKQEEAE 342

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
            to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 54/279 (19%), Positives = 119/279 (42%), Gaps = 4/279 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAID-HLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS 696
            E+ +K   N  +L   +D  ++KVT+   +Q       +ET+      KEIE++E  K  
Sbjct: 569  EEFDKWTTNMTTLGQQLDAKIMKVTQITMKQ-------DETQ------KEIEKLETQK-- 613

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE 876
                + Q+   K           K  E G+++   +++   +Y  K+   + ++ +L NE
Sbjct: 614  -KEYQAQIDAAK-----------KEHEEGQKVVESYEN--KEYLPKIHTIDNQISELLNE 659

Query: 877  VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED---ECNRLKFVV 1047
            +  +   N N   ++T+ S+  K+  ++    E+ +    +E  ++E    E  RL+   
Sbjct: 660  LAIIKQENAN---EQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEE 716

Query: 1048 DKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
                +K +H E+  + +   +N  + V  Q E  +   L + +++ +   ++ L   +  
Sbjct: 717  KAEQQKREHEEQVRKMKEQYENELNNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQ 776

Query: 1228 DPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCL 1344
                +EA+       +  N    ++ NS Y   T ++ +
Sbjct: 777  ----AEAQHAAQTKSIATNAANDMQDNSLYEFKTEEEIM 811

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
            YLR309C (REAL)
          Length = 916

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 52/255 (20%), Positives = 112/255 (43%), Gaps = 6/255 (2%)
 Frame = +1

Query: 601  QRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS-----INSLEQQLLEEKTANNILRRDYY 765
            ++  D  D   + + +K+ I+    +ED+++      +  L  +L   K +      +  
Sbjct: 339  EKHKDCEDWKHQYDEIKTKIENANGLEDSQLGKLEKELEKLNVELSATKKSLKEKNSELE 398

Query: 766  KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN-TNLKADKTQFSQKE 942
            ++++  + + +E  D ++   +   Q+  EV+ +K E+  L + N T ++A +T    K 
Sbjct: 399  EVRDMLRTVGNELVDAKNKIKESTSQQNEEVKAVKLELDDLRHKNATMIEAYET----KN 454

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS 1122
             +   K   + K +  +K    +KE E   L+  + K  + I  L       T    S  
Sbjct: 455  SELRNKLDSLNKEVECLKTSSTEKEKEQALLQNKLVKLNEDISQLALEKSIITKELTSLK 514

Query: 1123 AVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
             ++ + +++   +LE++   VK+F EQK    K+ +    E   + N L L++   +TL 
Sbjct: 515  -ISYKQKEKTVGYLEEQ---VKQFNEQKDAAEKSTEQLKKENSKISNRLDLLKKENETLH 570

Query: 1303 GNSKYYSTTTKKCLK 1347
             + K    + +  LK
Sbjct: 571  NDIKKNGNSYETYLK 585

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 52/196 (26%), Positives = 91/196 (46%), Gaps = 22/196 (11%)
 Frame = +1

Query: 865  LKNEVKFLTNMNT---------NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN--K 1011
            L +E+K LT  N+         N+  DK +F QKE++Y    + +EK +  +  E    +
Sbjct: 112  LNDEIKRLTKENSGMVPETVSENISNDKEEFLQKEQEYKSDILGLEKKIDALNNELATLQ 171

Query: 1012 KEDECNRLKFVVDKNMKKIDHLERSLQAQ--TNAQNSFSAVTVQDEDQ--KDAHLEDRYH 1179
            K+ +   L+F      KK+  LE  L+ +  T  Q   + ++   E+   KD   E+   
Sbjct: 172  KDKDSTVLEF-----EKKLAALENVLKVEKDTKEQEDNACLSKLKEELAIKDHSFEESQL 226

Query: 1180 KVKEFMEQKL----QTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS---TTTKK 1338
            K++E +EQ+L     T K N  + +E   L+  L   E  ++ LE  +   S   T+   
Sbjct: 227  KIRE-LEQELASYKDTMKENTLTLTE---LNTSLKEKEEKLRDLEKQANEVSKTITSNGS 282

Query: 1339 CLKYVTGSSRLKENEH 1386
              + V G++R K+N +
Sbjct: 283  LNQNVGGNNRRKKNRN 298

 Score = 36.2 bits (82), Expect = 0.22
 Identities = 53/261 (20%), Positives = 105/261 (40%), Gaps = 17/261 (6%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI 669
            +N +DSL    +  K    EK  + A+    K+ K N+        + +  + KS I + 
Sbjct: 458  RNKLDSLNKEVECLKTSSTEKEKEQALLQN-KLVKLNE-------DISQLALEKSIITK- 508

Query: 670  EEVEDNKISINSLEQQL--LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
             E+   KIS    E+ +  LEE+       + + + ++  ++   + +      S ++  
Sbjct: 509  -ELTSLKISYKQKEKTVGYLEEQV------KQFNEQKDAAEKSTEQLKKENSKISNRLDL 561

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDE 1023
             + E + L N++K   N       +  + S++     +KY  ++   S+  +  +  + +
Sbjct: 562  LKKENETLHNDIKKNGNSYETYLKENGKLSERLNILQEKYNTLQNVKSNSNEHMDSIKRQ 621

Query: 1024 CNRLKFVVDKNMKKIDHLERSL-------QAQTNAQNSFSAVTVQDED---QKDAHLEDR 1173
            C  L   + ++ KKI  LE  L       Q +T   N+   +    +     K   LED+
Sbjct: 622  CEELNVKLKESNKKILSLEDELNEYANIVQDKTREANTLRRLVSDSQSGDLSKQKELEDK 681

Query: 1174 Y-----HKVKEFMEQKLQTSK 1221
                   K +   E  LQTS+
Sbjct: 682  LAYLTDEKSRLESELNLQTSR 702

>KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} similar
            to uniprot|P40957 Saccharomyces cerevisiae YGL086W MAD1
            Coiled-coil protein involved in the spindle- assembly
            checkpoint phosphorylated by Mps1p upon checkpoint
            activation which leads to inhibition of the activity of
            the anaphase promoting complex forms a complex with Mad2p
          Length = 648

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 50/260 (19%), Positives = 122/260 (46%), Gaps = 10/260 (3%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKIS- 696
            E+L+   +  K+L+  +++  ++   N +Q     KL +   ++S +K+  E+  +K+  
Sbjct: 197  EELQDLAVLNKTLKEQLNYAKELEDMNLKQATELKKLRQNNDVQSLLKKENELLQSKLDQ 256

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERG-KRLCHEFQDLQDDYSK-KMKQKEYEV---- 858
            +NSL+++    +  N  L+    K+ + G  RL  +F++  D  ++  M Q+E       
Sbjct: 257  LNSLQKKFESLEMENISLQE---KITQWGIVRLDGKFKNPNDVITELNMLQRENTFLLDT 313

Query: 859  -QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
              KL+ +   ++ +N  +  ++ Q     K Y    + +++    ++Q+     +EC  L
Sbjct: 314  NSKLQIDFNQMSMLNDEMAIERNQLLDLNKDYETSILNLKRLNHELEQQKLLSFEECKLL 373

Query: 1036 KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD--AHLEDRYHKVKEFMEQKL 1209
            +  +++  ++ D  +++   Q NA N       Q ED  +    L +   K  + ++++ 
Sbjct: 374  RQQLEE-FEEQDDKKKTPGDQVNASNIIEGYKNQTEDLTNELKRLNEELSKTDDKIQKRR 432

Query: 1210 QTSKNNDPSCSEAEALDNVL 1269
            + +  ND   S ++ L+ ++
Sbjct: 433  KIT--NDLGISYSQRLNELI 450

>SAKL0E14212g Chr5 (1169895..1172657) [2763 bp, 920 aa] {ON} similar
            to uniprot|Q75E63 Ashbya gossypii ABL193C ABL193Cp and
            some similarites with YNL225C uniprot|P53865
            Saccharomyces cerevisiae YNL225C CNM67 chaotic nuclear
            migration predicted mass is 67kDa Spindle pole body
            protein involved in nuclear migration
          Length = 920

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 53/239 (22%), Positives = 108/239 (45%), Gaps = 12/239 (5%)
 Frame = +1

Query: 325  TFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAID 504
            T KE N+ +++     +   +H+ ++   ++    + L   +    N + E  ++K    
Sbjct: 302  TIKEKNEEIDQLKHQLHESVEHLKVAEEKNIE--VDQLRNQLKELVN-EVETHKAKYNQV 358

Query: 505  SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVED 684
            ++ Y + LE +  N +  +  ++ L K+ K+   +   +DK E  + LK      E++ D
Sbjct: 359  TVEYEKSLEDQKANLERSETLVEQL-KMQKEKALEEKEQDK-ETIDSLK------EKILD 410

Query: 685  NKISINSLEQQLLEE----KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQK-- 846
                ++SLE Q  E     K   ++L      L+     +  E +DL++D  KKM+ +  
Sbjct: 411  QNKRLDSLELQYTERSNDGKNQISLLEEKNKGLETENANIRGELKDLRNDL-KKMQDRNI 469

Query: 847  --EYEVQKLKNEVKFLTN----MNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
              + E  K K     LT+    +  N +  K + S+ EK+  +K+    + +SH+K E+
Sbjct: 470  ALDQECAKFKTSSAKLTHIVEMLKENSELQKGEISKLEKEIEEKWKKQGENLSHLKTEH 528

 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 48/207 (23%), Positives = 92/207 (44%), Gaps = 4/207 (1%)
 Frame = +1

Query: 439  AVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG 618
            A+G T++ N+ A+   ++   D    H+ +     N+K L ++++  LK T         
Sbjct: 576  AIGETYKKNKDAKSIETQILKDQ---HQVIGFYTQNQKDLSISLNRRLKET--------- 623

Query: 619  RDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH 798
               +EE + +K   K+IE+  + K+ ++ LE  + E       L     K   + +RL +
Sbjct: 624  ---VEECDHMK---KQIEQ--EWKVKVSKLEDVVKESDLKFQALEEQLKKRDLKIERLSN 675

Query: 799  EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ----YSQKYI 966
            E  DLQ +    +++KE   Q LKN +K    +   +   K +F  KEK+     S K  
Sbjct: 676  EVDDLQSEKLVLIREKE---QSLKNAIK----LGDQINKLKEEFLIKEKEIFMDLSDKIE 728

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVV 1047
             +      ++ +    E++    +F+V
Sbjct: 729  QLSSQCISLRTDLESAENQVRSSEFLV 755

>YFR016C Chr6 complement(177042..180743) [3702 bp, 1233 aa] {ON}
            Putative protein of unknown function; green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            and bud; interacts with Spa2p; YFL016C is not an
            essential gene
          Length = 1233

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 75/346 (21%), Positives = 143/346 (41%), Gaps = 36/346 (10%)
 Frame = +1

Query: 385  KHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLE-KKDLNEKSLQ 561
            K+I  SS S    T E   V    E + K E  + K  +++L   ++ E   +LN+++  
Sbjct: 801  KYIEPSSESVKKDTEEDAEV----ENSEKTEFIKVKAELENLDAPKEAEVTAELNKENED 856

Query: 562  MAIDHLLKVTKQNQRQVD---------GRDKLEETEVLKSFIKEIEEVEDNKISINSLEQ 714
            + +D       +N  + +           D  +E EV     KE E+VE    S   +E 
Sbjct: 857  VEVDTEEDAEVENSEKTEFIKVKAELGNLDAPKEAEVTAELNKENEDVEVAATSKEDIET 916

Query: 715  QLLE-----------------EKTANNILRRDYY----KLQERGKRLCHEFQ----DLQD 819
            +  E                 +K A  + + D      K+ E  K +  + +    ++ D
Sbjct: 917  KCSEPAETPIEDGTCTEAEVSKKDAEAVTKEDENMENSKIAEALKDVTGDQEIDDINISD 976

Query: 820  DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKT-QFSQKEKQYSQKYIYIEKYMSHVK 996
            ++ + ++  E E Q +K+          N   DK  +  + EK+ S   + +E+ ++  K
Sbjct: 977  EFQRTVELPELEKQDIKD----------NKGEDKELEVEETEKETSLPDLVVEENITEEK 1026

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRY 1176
             E  ++E+E ++L F   +++ K        +A  N +N F   + + E+ K A  +D +
Sbjct: 1027 NEIKQEEEEVSQLDFNETESISK--------EAPNNDENGFEDQSTR-ENPKKASADDIF 1077

Query: 1177 HKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
              + +   + L+  K  D   SE  AL   L   ++T +T E + K
Sbjct: 1078 KDILDETNEFLEQLKIVDD--SELNALLQSLDAKDSTTQTTEQSKK 1121

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 55/260 (21%), Positives = 114/260 (43%), Gaps = 12/260 (4%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS-LEQQL 720
            ++K L+   + L +   QN +    + KLE T++      E  E++   ++IN  LE   
Sbjct: 158  SQKQLEEVQEQLTEYESQNLKL---KKKLEATKI------ENSELQSTIVTINKELENLE 208

Query: 721  LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 900
             E+++A +I    + + + + + L  E +++ + +SK++K    +  +L  +V+ L  + 
Sbjct: 209  KEQESAEDI----FLEYESKIEALQDEQRNMIETHSKELKASRKDKDQLSVQVQELMIIL 264

Query: 901  TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN----------KKEDECNRLKFVVD 1050
             NLK DK+    +     Q     E   + ++   N           K +E +R K +  
Sbjct: 265  ENLKQDKSDLKDERDDLKQALELHESEKTALQNSVNDLELKIEELVSKREEESREKDLEV 324

Query: 1051 KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQK-DAHLEDRYHKVKEFMEQKLQTSKNN 1227
            K ++    L+  L+A  N       +  + ED K D  ++++Y   +E  +  LQ  K  
Sbjct: 325  KALR--SQLDTELEAHNNDITILENLKKEIEDMKEDVSMKEKYE--EESKQHVLQIGKLR 380

Query: 1228 DPSCSEAEALDNVLGLIENT 1287
              +    E L   L +++ +
Sbjct: 381  HEAIILNEHLTKALAMLKKS 400

 Score = 39.3 bits (90), Expect = 0.021
 Identities = 59/262 (22%), Positives = 114/262 (43%), Gaps = 13/262 (4%)
 Frame = +1

Query: 646  LKSFIKEIEEVEDNKISINS----LEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL 813
            +K   K++EEV++      S    L+++L   K  N+ L+     + +  + L  E +  
Sbjct: 155  MKESQKQLEEVQEQLTEYESQNLKLKKKLEATKIENSELQSTIVTINKELENLEKEQESA 214

Query: 814  QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN-LKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            +D +     + E +++ L++E + +   ++  LKA +    Q   Q  +  I +E    +
Sbjct: 215  EDIFL----EYESKIEALQDEQRNMIETHSKELKASRKDKDQLSVQVQELMIILE----N 266

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
            +KQ+ +  +DE + LK            LE     +T  QNS     V D + K   L  
Sbjct: 267  LKQDKSDLKDERDDLK----------QALELHESEKTALQNS-----VNDLELKIEELVS 311

Query: 1171 RYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTK---KC 1341
            +  + +E  E+ L+         +E EA +N + ++EN  K +E   +  S   K   + 
Sbjct: 312  K--REEESREKDLEVKALRSQLDTELEAHNNDITILENLKKEIEDMKEDVSMKEKYEEES 369

Query: 1342 LKYVTGSSRLKE-----NEHIT 1392
             ++V    +L+      NEH+T
Sbjct: 370  KQHVLQIGKLRHEAIILNEHLT 391

>Kpol_520.42 s520 (101479..102954) [1476 bp, 491 aa] {ON}
            (101479..102954) [1476 nt, 492 aa]
          Length = 491

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 63/303 (20%), Positives = 125/303 (41%), Gaps = 28/303 (9%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE--DN 687
            YH  ++ +  N K +      ++K  K N+ ++  ++KL + +  K  +K+I+     +N
Sbjct: 67   YHGDIKLEIKNLKEI------IIKFNKLNKLEIFYQNKLNQWKSSK--VKQIQSASSTNN 118

Query: 688  KISINSLEQQLL---------EEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
            KI+IN   Q LL         +E T +N    +     E+       F + +DD   +  
Sbjct: 119  KITINCNYQPLLKTYLNQIDPDESTLSNQFNSNLSINDEKLIYTNESFTEDEDDTGDEDN 178

Query: 841  QKEYEVQKLKNE---------VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS-- 987
              ++      N+         +K L N  + +KAD  Q       Y +   +IE  ++  
Sbjct: 179  DIDHSNNHTNNDEDPFLILSNIKLLENCQSTIKADINQLEFLLSNYKKDLKFIENELNSQ 238

Query: 988  HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
            ++K +YN           ++ + + KI+   + L  +     + +  +V D+D+K     
Sbjct: 239  NLKTKYNIT---------LMQEKLDKINIKRKKLLIKIGLSKNKNLTSVLDKDEKII--- 286

Query: 1168 DRYHKVKEFMEQKLQTSKNNDPSCSEAE---ALDNVLGLIE---NTMKTLEGNSKYYSTT 1329
                 + +F+  K+ +   ND   ++ E    L+  + L E   N +  LE + K Y + 
Sbjct: 287  --IENINDFINSKINSL--NDQLSNKKENSIVLNQKINLWEQVINQLNDLENSLKIYLSK 342

Query: 1330 TKK 1338
             KK
Sbjct: 343  NKK 345

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 64/317 (20%), Positives = 140/317 (44%), Gaps = 11/317 (3%)
 Frame = +1

Query: 349  VNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQL 528
            VN+     N+ + ++ + +  D     E  A+  +   + K E ER     D+    E+ 
Sbjct: 45   VNKLQEFNNLQSNNLRLHATVD-----ELKALCTSKVDSLKKETERLIRENDT----EKQ 95

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
             +  L E+  Q+  +  L + +    + + ++ +E+  VLKS  +E+ ++ + KIS    
Sbjct: 96   RRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKIS---- 151

Query: 709  EQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFL 888
              +L   K  +  L  D   L+++     +E Q L+      +  K  E++ +K +V  L
Sbjct: 152  --ELEASKVESQELVNDNKNLRQQLMETQNEVQTLK---CNGLGDKS-ELEIVKQQVGML 205

Query: 889  TNMNTNLKADKTQFSQKEKQYSQKY-IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKK 1065
            T  N  L+ + T  +++  +Y Q+    ++K +  V +  N  + E +  +F++ KN + 
Sbjct: 206  TKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEI 265

Query: 1066 IDHLERSL--------QAQTNAQNSFSAVTVQDE--DQKDAHLEDRYHKVKEFMEQKLQT 1215
               L+  L        +  T  Q     ++++ +  D +D  L+    +++   E+   T
Sbjct: 266  SQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEEKHNST 325

Query: 1216 SKNNDPSCSEAEALDNV 1266
              +N  S  +A  +D++
Sbjct: 326  EADNLQSTQQARFMDDL 342

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 47/231 (20%), Positives = 94/231 (40%), Gaps = 3/231 (1%)
 Frame = +1

Query: 712  QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
            Q++  E+ + N++      LQ   + L  E Q     +   + Q E +  +LK E+   +
Sbjct: 774  QKISVERNSLNLMVTQLQTLQSERENLLKESQA---SHKAAIAQLEVQTSELKTEI---S 827

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID 1071
            + +  +KA +     + K + +K   +      ++ E   K     +L+  V+   KKI+
Sbjct: 828  SKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIE 887

Query: 1072 HLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNND---PSCS 1242
              +  + +     ++ +  T Q + +KD          K  +E K   S+N +    S +
Sbjct: 888  ESDSRIASYKTLNDAGNGETTQGQLRKDLE--------KTMIELKHAYSQNEEFKQISST 939

Query: 1243 EAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
              E L N+    E   + L+ N++ Y     +  + V   S LK+N    N
Sbjct: 940  AEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCV---SNLKKNIDFLN 987

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 53/285 (18%), Positives = 108/285 (37%), Gaps = 53/285 (18%)
 Frame = +1

Query: 598  NQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKL-- 771
            +Q+QV   D+L E    K   K ++E + N   I    + ++E+    N+LR     L  
Sbjct: 1178 HQKQVALEDELAEAR--KKLFK-LQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRN 1234

Query: 772  -----QERGKRLCHEFQDLQD---------------------------DYSKKMKQK--- 846
                 QE+   L  E   LQ                            D + + K++   
Sbjct: 1235 AVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHD 1294

Query: 847  ----------------EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
                            E E+  LK E++  +  NT+L     +F++ +KQ  +K    + 
Sbjct: 1295 ILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDL---NDRFTRLKKQAHEKLNASKI 1351

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDA 1158
              +++  E N+ +    +++ ++ +   K+ +LE+ L                + D + A
Sbjct: 1352 AQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLL---------------TERDSESA 1396

Query: 1159 HLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMK 1293
            + ED  H++ + +E+  +       +   +E L + L    N++K
Sbjct: 1397 NNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLK 1441

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 52/274 (18%), Positives = 109/274 (39%), Gaps = 32/274 (11%)
 Frame = +1

Query: 664  EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            EIE +  +  SI     Q  EE T ++   RD  K+Q   + L  +  DL  +     + 
Sbjct: 86   EIENLMKDNDSIRLERSQAQEESTQSS---RDKQKIQNEVESLQEKLSDLDQERETLKQD 142

Query: 844  KEYEVQKLKNEVKFLTNMNT------------------------NLKADKTQFSQKEKQY 951
            K   V  L+ ++K L +  T                        NLK+ + +   + +  
Sbjct: 143  KREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVT 1131
            +Q+   ++K    +++E   K ++      ++    K  D L+R      + +N      
Sbjct: 203  TQRLTILQKNSQWLEEEVTSKTEQ------LISTRRKNDDELDRLTSESLSCKNE----- 251

Query: 1132 VQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS--------CSEAEALDNVLGLIENT 1287
            +Q E  ++  +  +  ++ + +++KL   K+   S          E      ++ L+EN 
Sbjct: 252  LQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQ 311

Query: 1288 MKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHI 1389
            +K+L+G  +  ++  K  ++ +    R  ENE +
Sbjct: 312  VKSLQG--ELNASLDKDNVELLASGERNTENEKL 343

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 68/273 (24%), Positives = 116/273 (42%), Gaps = 18/273 (6%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE 642
            N     ERS+   +S       +K     +SLQ  +  L       +R+   +DK E   
Sbjct: 94   NDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDL-----DQERETLKQDKREVVA 148

Query: 643  VLKSFIKEIEEVE-DNKISINS---LEQQLLEEKTANNILR----RDYYKLQERGKRLC- 795
            VL+  IKE+E    +++ S++    L QQ+LE +T    L+    RD  ++Q   +RL  
Sbjct: 149  VLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTI 208

Query: 796  --HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY 969
                 Q L+++ + K +Q     +K  +E+  LT+ + + K +      + +  + K   
Sbjct: 209  LQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEE 268

Query: 970  IEKYMSHVKQEYNKKEDECNRLK--FVVDKNMKK--IDHLE---RSLQAQTNAQNSFSAV 1128
            + K +     E     D   R K  F  + +MK+  ID LE   +SLQ + NA       
Sbjct: 269  LTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS------ 322

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
               D+D  +       +   E + Q+L T K N
Sbjct: 323  --LDKDNVELLASGERNTENEKLIQELITLKEN 353

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 62/272 (22%), Positives = 123/272 (45%), Gaps = 23/272 (8%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE 636
            E +++ + +  ++ +DS+    Q  K++L  K+  +  D   +V K  ++  +   +++ 
Sbjct: 850  ENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTF-LVTDLESEVRKLEKQVEESEARIQS 908

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD-- 810
             +VL        EVE +  S  SL ++L  EKT  N+   D Y   ++ K L    ++  
Sbjct: 909  YQVLSG-----SEVETSPES--SLRKEL--EKTKINL--SDTYAEIDQYKNLLSTTEESL 957

Query: 811  --LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK----------ADKTQFSQKEKQYS 954
              L  DY+   ++ + +V+ L+NE   L ++   L            D  + ++ EK   
Sbjct: 958  SQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTL 1017

Query: 955  QKYI---YIEKYMSH-VKQEYNKKEDECNR-LKFVVDKNMKKIDHLERSLQAQTNAQNSF 1119
            QK I     E   SH +K+EY+ +  +  R L+       +   + E  LQ  +N   + 
Sbjct: 1018 QKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTI 1077

Query: 1120 SAVTVQDEDQKD----AHLEDRYHKVKEFMEQ 1203
            S   ++++ QKD      L++   +V++ +EQ
Sbjct: 1078 S--ELREQSQKDRIAITRLKNSEEQVRQVLEQ 1107

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 58/270 (21%), Positives = 117/270 (43%), Gaps = 34/270 (12%)
 Frame = +1

Query: 517  HEQLEKKD------LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKE---- 666
            + QL K+D      +  K L ++ + + +  K N   +  ++ L+E E  K F++E    
Sbjct: 834  YNQLVKEDPWFNLFIRIKPLLISSNDMSRTKKFNDLIIKLKNDLQEMESKKKFLEEKNQK 893

Query: 667  -IEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
             I E++D +  + SLE++ L++    ++L R    ++   + L  +F D   + ++  KQ
Sbjct: 894  TINELKDTQ-ELLSLEKENLKKN--ESLLNR----VKSSSETLQKQFDDTVLEKNEISKQ 946

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE-------KQYSQKYIYIEK---YMSHV 993
            K   +Q L+   + + ++  ++K  +T             KQ S     I K     S +
Sbjct: 947  KLQIMQNLEKAEQIIQDLQESIKERETALGNLRSKNDELIKQISNLNYDISKEQNSQSLI 1006

Query: 994  KQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQA------------QTNAQNSFSAVTVQ 1137
            K+   K E E  RLK V++    +I+  ++ L +            + N   + S +   
Sbjct: 1007 KESKLKLESEIKRLKGVINLKENEINSFDKKLSSSEEDLDIKLVTLEKNCNIAMSRLQSL 1066

Query: 1138 DEDQKDAHLE-DRYHKVKEFMEQKLQTSKN 1224
              +  D H + D + K K  +  +L+  +N
Sbjct: 1067 VAENSDLHSKNDNFKKEKAMLNTQLKNKEN 1096

 Score = 39.3 bits (90), Expect = 0.027
 Identities = 77/389 (19%), Positives = 147/389 (37%), Gaps = 72/389 (18%)
 Frame = +1

Query: 442  VGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            +   H   RK + E S +  D   Y  + E  +   KSL+   D L  +  +++  +   
Sbjct: 1345 ISALHSKFRKIQGEDSLSPSD--IYKIKFEASEERVKSLE---DKLKTMPLRDRTNLPVG 1399

Query: 622  DKLEETEVLKSFIKEI-----------EEVEDNKISINSLEQQLLEEKTANNILRRDYYK 768
            D ++  + +  + +EI           E + ++   ++ L   L + K+   +L     +
Sbjct: 1400 DIIKNRDSISKYEEEIRYYKLENYKFQEILNESNGKLSQLALDLRQSKSKEVLLSEQLDR 1459

Query: 769  LQ------ERGKRLC--------HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN 906
            LQ      ER K L          +F+D  DD      +    +  LK   + + +M + 
Sbjct: 1460 LQKDFESTERQKELLSSTIKQQKQQFEDCMDDLQGNELRLREHIHALKQAEEDVKSMASI 1519

Query: 907  LKADKTQFSQKEK--------------QYSQKYIYIEKY----------MSHVKQEYNKK 1014
            ++  KTQ  QKE+              Q  +  + +++           ++H+K+     
Sbjct: 1520 IEKLKTQNKQKERLIWEREMERNDSDMQLQETLLELKRVQDVKKILSDDLTHLKERLGAV 1579

Query: 1015 E------DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQ------DEDQKDA 1158
            E      DE NRLK          + L  +L+ +TN +  FS +  +      D + K +
Sbjct: 1580 EDRSQYTDEINRLK----------EELNCALKTETNLKKEFSTLKYKLETSNNDSEAKIS 1629

Query: 1159 HL---EDRYHKVKEFMEQ--------KLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEG 1305
             L    D Y KV E +          + +  +  +   +E ++L   +G +  T + LE 
Sbjct: 1630 ELLKQLDHYTKVVEMLNNEKDAVSLGEKELYQRYEAVSTECQSLKKTIGSLTKTKEELE- 1688

Query: 1306 NSKYYSTTTKKCLKYVTGSSRLKENEHIT 1392
             S     T    L     S  ++EN+ I+
Sbjct: 1689 -SDLNQKTEALELSNAAFSKSVRENKEIS 1716

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 49/215 (22%), Positives = 95/215 (44%), Gaps = 34/215 (15%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKS--LQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            EC+  K  I SL   ++  + DLN+K+  L+++     K  ++N+   +    LEET  L
Sbjct: 1669 ECQSLKKTIGSLTKTKEELESDLNQKTEALELSNAAFSKSVRENKEISEKIQYLEETLKL 1728

Query: 649  K--SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD 822
            +     +  E V+  + S +   ++  +EK  N  L  +   LQ+    L    ++LQD 
Sbjct: 1729 QMEQNARNGELVKKLQSSCSEYREKFDDEKQKNIHLFEENQTLQKFNTDLQSHIENLQDR 1788

Query: 823  YSKKMKQKEY--EVQKLKNEVKFLTNM-------NTNLKA-------------------- 915
             S   ++  +  ++ +L+N V   T++       N NL+                     
Sbjct: 1789 LSDTTEKNAWLAKIHELENLVSQETDLKYEEMKRNKNLERIVGELQNRNSQQTDVIGLAN 1848

Query: 916  -DKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
             ++++F +   +Y  +   +EKY+S  +QE N K+
Sbjct: 1849 KNRSEFEETALKYEAQISELEKYIS--QQELNMKK 1881

 Score = 31.6 bits (70), Expect = 6.3
 Identities = 50/224 (22%), Positives = 100/224 (44%), Gaps = 21/224 (9%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK-VTKQN---QRQVDGRDKLEETEV- 645
            E+++  I  L   E +++++    +L+   D L+K ++  N    ++ + +  ++E+++ 
Sbjct: 955  EKAEQIIQDL--QESIKERETALGNLRSKNDELIKQISNLNYDISKEQNSQSLIKESKLK 1012

Query: 646  LKSFIKEIEEVEDNKIS-INSLEQQLLEEKTANNI----LRRDYYKLQERGKRLCHEFQD 810
            L+S IK ++ V + K + INS +++L   +   +I    L ++      R + L  E  D
Sbjct: 1013 LESEIKRLKGVINLKENEINSFDKKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVAENSD 1072

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            L        K+K     +LKN+   L  M   +   + + +   KQ        EK  + 
Sbjct: 1073 LHSKNDNFKKEKAMLNTQLKNKENELKKMKEKIDNHQKELAIFSKQRDDAVNEHEKITAE 1132

Query: 991  VKQ------EYNK-----KEDECNRLKFVVDKNMKKIDHLERSL 1089
            +K+      EY       K++  N  + + +K  KK D L  SL
Sbjct: 1133 LKETRSQLTEYKSKCQMIKDEYSNFQRQIKEKEQKKRDSLIGSL 1176

>Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {ON}
            complement(59840..61795) [1956 nt, 652 aa]
          Length = 651

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 53/246 (21%), Positives = 106/246 (43%), Gaps = 6/246 (2%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRK-AECERSKN----AIDSLYYHEQLEKKD 540
            +P     IS    +    E   + +T + + K  ECE  +     +I +L +   +E ++
Sbjct: 118  LPDIQYQISKKKTMCNELEKEILQLTSQLDLKEGECELQRKNEELSISNLQFKYSVEVQE 177

Query: 541  LNEKSLQMAIDHLLKVTKQN-QRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQ 717
            L  +     ++  L   K N +RQV    +LE  E  +   +EI++++D  + +N+  ++
Sbjct: 178  LENE-----LEEKLNKEKLNWERQVL---ELENMEPSEKIAQEIKDLKDELVQVNAEWKK 229

Query: 718  LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNM 897
            +      +N  +R  Y+ +            L +++    KQKE  +  L  E K L   
Sbjct: 230  V----QLDNETQRKKYESK------------LAEEFVTFKKQKEEPMISLLKEQKELEAK 273

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
              NLK +      +     Q  I IEK +  + Q +   E++ + L    +K  K+ +  
Sbjct: 274  KENLKKENENLEDEINNKVQMCIDIEKEIESLNQNFASLENKLSPLNNDYEKVSKEFETA 333

Query: 1078 ERSLQA 1095
            E++L++
Sbjct: 334  EKNLKS 339

>Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {ON}
            YJR134C (REAL)
          Length = 705

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 82/385 (21%), Positives = 151/385 (39%), Gaps = 46/385 (11%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            +YER  +  DD   EV+            P    + SS   L +  + L   +  E  + 
Sbjct: 128  EYERLNKRIDDLTNEVSKK----------PQIETTDSSFFKLIKEKDDLIDQLKKEGEKL 177

Query: 472  AECE-RSKNAIDSL---YYHEQLEKKDLNEKSLQ--------MAIDHLLK--VTKQNQRQ 609
            AE E R  N I +L     + + E   LN+ S Q         ++ H ++  +T+   + 
Sbjct: 178  AETELRQSNQIKALKTKVKNLEYEVSSLNDDSTQNVENYNELQSLYHNIQEQLTETTSKL 237

Query: 610  VDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKR 789
             D   + E  EVLK  IKE +++      I +L+Q L   +T   +L  +  + Q   K 
Sbjct: 238  KDTDKQKELLEVLKGSIKEKDDL------ITNLQQSLDHMRT---LLEEEKAEFQMEKKA 288

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKN-------------------EVKFLTN-----M 897
            L     D       K++Q   E+    N                   EVK  T+     +
Sbjct: 289  LQEATIDQVTSLETKLEQLRIELDSCSNDSNGKSSGGDFVDNDDGSSEVKQYTSSQYMLL 348

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
               L++ K  ++  E   + K + +E +++   +E  K E+E    +  +       DHL
Sbjct: 349  KEQLESSKVNWNSIEYALNSKIVDLENHLASTIKEKKKFEEE---YQTALRSTETLSDHL 405

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDA--HLEDRYHKVKEFME-QKLQTSKNND-----P 1233
            E+  +    A +    +  Q E  K +   + D Y+ +K+  + Q+ Q  KN D      
Sbjct: 406  EKEREGHLKAISQVKELERQIETLKLSLQSINDDYNLLKKKYDIQRAQFEKNEDGVKLHQ 465

Query: 1234 SCSEAEALDNVLGLIENTMKTLEGN 1308
              S+ + ++ +   + N++ ++  N
Sbjct: 466  ETSDRKIIEKIPAELTNSLNSMNEN 490

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
            YGR130C (REAL)
          Length = 807

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 62/290 (21%), Positives = 126/290 (43%), Gaps = 48/290 (16%)
 Frame = +1

Query: 487  SKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE-VLKSFIK 663
            SK   D + Y E++ +  L +   +    +    T  ++R  D +++++E E  +K+  K
Sbjct: 409  SKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRK 468

Query: 664  EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            E  E  +  +S N L +Q+++  TA+N             K+L   F+D ++  ++K+++
Sbjct: 469  ETSEKIE--VSKNRLVKQIIDVNTAHN------------NKKLMI-FKDTENMKNQKLQE 513

Query: 844  KEYEVQK---LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQ-------KYIYIEKYMSHV 993
            K+  + K   +K+E+  L +  TN++ +   ++      SQ       K   I    S V
Sbjct: 514  KDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKV 573

Query: 994  KQEYN----KKED---ECNRLKFVVDKNMKKIDHLERS---------------------- 1086
            + E +    KKED   +    K + ++N++ ++ +E                        
Sbjct: 574  QNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTI 633

Query: 1087 -LQAQTNAQNSFSAVTVQDEDQKDAH-------LEDRYHKVKEFMEQKLQ 1212
              Q   N +   SA+T + ED++ AH        E+R  K +  +E++ Q
Sbjct: 634  IRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 683

 Score = 37.4 bits (85), Expect = 0.095
 Identities = 42/215 (19%), Positives = 92/215 (42%), Gaps = 13/215 (6%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL-------KSFIKEIEEVE 681
            ++ + +L +  +Q  ID L K  +    Q +   KL E  V        K ++ +I ++ 
Sbjct: 562  KINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDI- 620

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
            DN++S    +  ++ ++ AN          +   +R  HE Q L+ +  ++ +++E  ++
Sbjct: 621  DNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQ-LKLEAEERKRKEENLLE 679

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
            K + E+                    E+Q  Q  +  E+ ++ VKQ YN +  E      
Sbjct: 680  KQRQEL--------------------EEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLA 719

Query: 1042 VVDKNMKKIDHL------ERSLQAQTNAQNSFSAV 1128
              +K ++ +         E++++ QT  ++S  A+
Sbjct: 720  AEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEAL 754

>SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {ON}
            weakly similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 816

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 56/290 (19%), Positives = 131/290 (45%), Gaps = 15/290 (5%)
 Frame = +1

Query: 427  FETLAV--GITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQN 600
            FETL      +H+ N      ++   ++   Y + + +K  N+K  Q+   +++K+T+  
Sbjct: 253  FETLTPLKSHSHQGNSTLHQLKADFNLELKQYEKDIAQK--NDKIRQLN-QNIVKLTQDY 309

Query: 601  QRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQER 780
                    +L+ T +  + ++   +V   K+S N++  QL E+K   +++++D  KL+ER
Sbjct: 310  DSVTQ---ELDSTRIKYTTLQADYKVY--KVSQNNVNDQLEEQKETLDLMKQDKEKLEER 364

Query: 781  GKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKF-------LTNMNTNLKADKTQFSQK 939
              +L    +   +++  ++K      Q L+ + +        L  +N  L   K Q  ++
Sbjct: 365  IAKL----KSRNNEFKNEVKMLNQNAQILQEKFQLQIDENVQLAKLNQQLSESKVQAEEQ 420

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKK---EDECNRLKFVVDKNMKKIDHL--ERSLQAQTN 1104
             +Q +++    E +   +++E  +    E E N+ + V +   K+++    E++L  +  
Sbjct: 421  LRQLNEETKNYETHAMRLQEEAKRSKLLEQEFNKKEAVYEAKFKELEAAVGEKNLLLEEF 480

Query: 1105 AQNSFSAVTVQDEDQKDAHLE-DRYHKVKEFMEQKLQTSKNNDPSCSEAE 1251
                  +   + E Q +   + D   + ++ + ++L   K  D  C E+E
Sbjct: 481  QSKLKDSQQKRKESQSELEQQIDELSRERDGLREELSLFK--DGVCRESE 528

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 63/328 (19%), Positives = 135/328 (41%), Gaps = 52/328 (15%)
 Frame = +1

Query: 397  ISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLE-KKDLNEKSLQMAID 573
            +  +++  + +ET A+ +  E  R    E+  N  +++Y  +  E +  + EK+L +  +
Sbjct: 421  LRQLNEETKNYETHAMRLQEEAKRSKLLEQEFNKKEAVYEAKFKELEAAVGEKNLLLE-E 479

Query: 574  HLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILR 753
               K+    Q++ + + +LE+         +I+E+   +  +   E  L ++        
Sbjct: 480  FQSKLKDSQQKRKESQSELEQ---------QIDELSRERDGLRE-ELSLFKDGVC----- 524

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ--------------KLKNEVKFLT 891
            R+  + QE+ K+   E     D  +K +KQ  YE++              +LK ++   T
Sbjct: 525  RESEEAQEKLKQYMSE----NDQLAKDLKQLNYELEELKENSERDKEQMYQLKTQLDLAT 580

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEK-------YMSHVKQEYNKKEDECNRLKFVVD 1050
            +      A+ T+F+Q   +  Q  + +E+        +   K ++ +K  EC +L   ++
Sbjct: 581  DQLEVKTAEVTEFTQDIDEIKQSKMLLEESIKAREDTIQEWKDKFEEKAKECEKLSIELE 640

Query: 1051 KNMKKIDHLE--------------RSLQA----------QTNAQNSFSAVTVQDEDQKDA 1158
             N  K  +LE               SLQA          Q  A+N+     +++   K+ 
Sbjct: 641  SNNFKSGNLEAEHLADLEDLHEKLTSLQATLKENSEEVGQLGAENTTLKSQLEEFKSKNC 700

Query: 1159 HLEDRYHK------VKEFMEQKLQTSKN 1224
             L ++  K      + E + +K+Q  +N
Sbjct: 701  DLNEKVQKLAHSSALDEELNKKIQLLEN 728

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
            Anc_5.414 YDR356W
          Length = 1040

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 66/326 (20%), Positives = 132/326 (40%), Gaps = 20/326 (6%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEK-KDLNE------KSLQMAIDHLLK-VTKQNQRQVDGRD 624
            K E    KN   +L   +QL K KD N         LQ  +D L + V  ++    +  +
Sbjct: 162  KDEDPTGKNIDKNLKLIDQLTKEKDKNNLLLRDNTQLQTELDKLTEQVNNKDDTTTNENE 221

Query: 625  KLEETEVLKSFIKEIEEVEDNKISINSLEQQL--LEEKTANNILRRDYYKLQERGKRLCH 798
            +    +  +   + + ++ED++  +  L+ +L  LE  T ++              RL +
Sbjct: 222  EESHAQCQEEKDRLLAKLEDDQTELTKLQDKLTALENSTESS----------SELNRLNN 271

Query: 799  EFQDLQDDYSKKMKQKEYEVQ------KLKNEVKFLTNMNTNLKADKTQFSQKEKQ---- 948
               DLQ +      +K+Y++Q      KLK+  + L     + + + T  S+K K+    
Sbjct: 272  TIVDLQAN------EKKYQIQISQLDIKLKDSTRLLETKEGSYQREVTSLSEKVKETTLK 325

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV 1128
             +Q+    EK  + +KQ+ +   ++  + +   D++ +++  L+ ++++ +N    F   
Sbjct: 326  LTQQREEFEKVNNDLKQKLSALREDLRKKE---DQHERELRKLKDTIKSSSNDNTEFIES 382

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGN 1308
              +D + K   L          +E  LQ SK           L++ L  I      ++  
Sbjct: 383  LKKDVETKRTRLAQ--------LETDLQKSKR------RVTELESTLNTINTQYSDIQKE 428

Query: 1309 SKYYSTTTKKCLKYVTGSSRLKENEH 1386
             K Y   T + L  +  S +    EH
Sbjct: 429  FKEYQIDTDRRLNNIDNSDKRHLVEH 454

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 53/274 (19%), Positives = 120/274 (43%), Gaps = 18/274 (6%)
 Frame = +1

Query: 460  TNRKAECERSKNAID---SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL 630
            T ++ E E+  N +    S    +  +K+D +E+ L+   D +   +  N   ++   K 
Sbjct: 327  TQQREEFEKVNNDLKQKLSALREDLRKKEDQHERELRKLKDTIKSSSNDNTEFIESLKKD 386

Query: 631  EETEVLKSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ-ERGKRLCHEF 804
             ET+  ++ + ++E +++ +K  +  LE  L    T  + +++++ + Q +  +RL    
Sbjct: 387  VETK--RTRLAQLETDLQKSKRRVTELESTLNTINTQYSDIQKEFKEYQIDTDRRL---- 440

Query: 805  QDLQDDYSKKMKQKEYEVQKLK-NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY 981
             ++ +   + + +   E++++K + +  +T +  N  +  T+ +  + + S+K    E  
Sbjct: 441  NNIDNSDKRHLVEHSKEIERVKADHLLEMTQLEKNYDSLLTELNSSKAELSEKLEGAESE 500

Query: 982  MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDA- 1158
            ++  K+E N K+ E  RL    + N+K +         Q  +  S       D  +K+A 
Sbjct: 501  LAKCKEELNSKKIEHERLINSHETNVKSLKDQIYDQTTQIRSLESTVDDLSADIGRKEAA 560

Query: 1159 ---------HLEDRYHKVKEFME--QKLQTSKNN 1227
                      L DRY    E  +  +K+  S  N
Sbjct: 561  LLLLQTKYDELSDRYQSNNEISQDVEKITRSLEN 594

 Score = 38.9 bits (89), Expect = 0.033
 Identities = 66/342 (19%), Positives = 150/342 (43%), Gaps = 29/342 (8%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGIT---HET 462
            D E+   + ++   ++N  +N    L  + TK   +SS S+   +  T    +T   H+ 
Sbjct: 584  DVEKITRSLENQINDLNHKLNHANIL--LSTKDAELSSTSNELSSATTSIKKLTAQIHDK 641

Query: 463  NRKAECERSK-NAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK---- 627
              K E  R+K + ++S  +++ ++    + K+++     +  +T+Q ++     D+    
Sbjct: 642  TEKIEQSRAKISQLESQLFNKTIKASKESLKTIETKNAQIDDLTEQLEKAKSEFDRALKT 701

Query: 628  --LEETEVLKSFIKEIEEVED------NKISINSLEQ-----QLLEE--------KTANN 744
              + E ++ + +  +I+++ED      N + I + E+     QL E+         T N+
Sbjct: 702  NNILEEQISRKYQDQIKDLEDEVDGLSNTLRIRTREENERIKQLNEDIQEWQDRYDTLND 761

Query: 745  ILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKT 924
             L+    K     +     F+  ++   +++ +K+ E+ KLK +   +   N NL+    
Sbjct: 762  TLQSQISKRSHSTRAEQLSFKRERESLLQEVAEKDGEIDKLKQKNTSILEENDNLR---- 817

Query: 925  QFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTN 1104
             + +   + S  +   E+ M+  K   + K     R+  +  +N++  + L R+   + +
Sbjct: 818  DYLKSSSKLSSGF---EQLMTKYK---DMKRTFAERVASLEKENLELEESLHRT---RID 868

Query: 1105 AQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNND 1230
            A +  S+    + D+  A L D Y+++K   E     + NND
Sbjct: 869  ALSRDSSGPSPNVDRTHADLAD-YYRIKYHNE----VTHNND 905

>NDAI0C04240 Chr3 complement(966340..967737) [1398 bp, 465 aa] {ON}
            Anc_5.338 YDR312W
          Length = 465

 Score = 43.9 bits (102), Expect = 7e-04
 Identities = 63/295 (21%), Positives = 124/295 (42%), Gaps = 3/295 (1%)
 Frame = +1

Query: 334  EVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLY 513
            +++  +NR Y      +KH    S+ +L +  +  ++ + H+ N       S++ +D   
Sbjct: 216  DISKNLNRLYK-----SKHNLSKSVPNLHRKEDISSLILDHDLNAYT----SESEVDDDA 266

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI 693
                ++KKD+  K++ M         ++ Q   +  D+  +  +  + I+E  + E+   
Sbjct: 267  IVRVVDKKDIRGKNINMV--------QKKQSSPENNDEDGDINMDGNAIEENHDEEE--- 315

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY-SKKMKQKEYEVQKLK 870
               S+ ++++ E     + R+   +L E G RL  +   +++   S K+   E+ V+K  
Sbjct: 316  ---SIVKKVVVEDDTPVVPRKKAIRLTELGPRLTLKLVKIEEGICSGKVLHHEF-VEKSS 371

Query: 871  NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
             EV+ L                 EK+++ K          +K+E  KKE E N  K    
Sbjct: 372  AEVRIL-----------------EKRHAAKM--------KLKEE-RKKEQEANIAKKKAV 405

Query: 1051 KNMKKIDHLERSLQAQTNAQN--SFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
            K  KK   LER    +   +N    +  +V+  D+ D+   D Y  V E ++  L
Sbjct: 406  KEAKKQRKLERRKARELEQENEDGENKQSVESSDESDSDSSDHYSDVPEDLDSDL 460

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 59/266 (22%), Positives = 121/266 (45%), Gaps = 22/266 (8%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVN-RCYALCNIPTKHISISSISDLAQTFETLAVGITHETNR 468
            D ER    + + FKE+ ++++ +   L +I      +++  D ++ FE   +    E+  
Sbjct: 973  DLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSES-- 1030

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLN--------EKSLQMAIDHLLKVTKQNQRQVDGRD 624
            ++     KN I+SL  +E+L+ K+ +        E + ++ I  L +   + + ++D + 
Sbjct: 1031 ESLVSDLKNEIESL--NEKLKSKESSVGLQESEIENAKKILIAELEEKLNKTKSELDLKH 1088

Query: 625  KLEETEVLKSF--------IKEIEEVEDNKISINSLEQ--QLLEEKTANNILRRDYYKLQ 774
            K EE +VLK+         + E EE    KI + S E+   ++E K A            
Sbjct: 1089 K-EELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVA------------ 1135

Query: 775  ERGKRLCHEFQDLQDDYSKKMK---QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK 945
                       DL++DY KK++    +  +++K+K E  F  N+   + A K  F + ++
Sbjct: 1136 -----------DLEEDYKKKLETVSAESTDIEKIKQE--FEDNL---VNAKKKAFEEGKQ 1179

Query: 946  QYSQKYIYIEKYMSHVKQEYNKKEDE 1023
            Q S K  ++E  ++ ++ +    E +
Sbjct: 1180 QASMKTKFLENKIAKLESQLQNNESD 1205

 Score = 38.9 bits (89), Expect = 0.034
 Identities = 68/328 (20%), Positives = 125/328 (38%), Gaps = 13/328 (3%)
 Frame = +1

Query: 319  DDTFKEVNDAVNRCYALCNIPTKHISI--SSISDLAQTF----ETLAVGITHETNRKAEC 480
            +DT  E  + +       N+    I    S IS+L  +     E+      + +N   + 
Sbjct: 386  NDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYHSNLVKDL 445

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSL-QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSF 657
            E SK +  S Y    +E  + + ++L     D L+ + K+    +   +KL  T +  S+
Sbjct: 446  E-SKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKL--TLLQNSY 502

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
                 E E+     + LEQQL EE+   N +  DY K +                     
Sbjct: 503  DLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKT-------------------- 542

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ----EY 1005
                  +    N +  L N    L+ +     Q+ K   ++   ++    H++Q    E 
Sbjct: 543  -----NLLDFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEI 597

Query: 1006 NKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE--DRYH 1179
            +K  D+   L+  + K  ++   LER LQ   N       +   + DQ   + +  D+Y 
Sbjct: 598  SKYTDKVKELELNISKLNEQKLILERKLQ---NKNIEIDDLNSSNYDQISWYQKKLDQYE 654

Query: 1180 KVKEFMEQKLQTSKNNDPSCSEAEALDN 1263
            K  + +E +L     N  +  E +AL++
Sbjct: 655  KTIKTLESRLPADTQNSKALVEDKALED 682

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 64/305 (20%), Positives = 127/305 (41%), Gaps = 24/305 (7%)
 Frame = +1

Query: 481  ERSKNA-IDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSF 657
            ERS N  +D ++   + E+  L+++ +    D  ++V   +   V        +++L +F
Sbjct: 750  ERSANLEVDDIFVSLRYERDTLSDQVVNYEKD--MQVILADLESVQSELNAANSQIL-NF 806

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
              +   V+D+K   N  E+ L+E+ T       +  +L+ER   L  E   L ++     
Sbjct: 807  ENQRAMVQDHKKG-NVNEETLIEKLT-------ELDELKERNMELTQEIHALNENNIALK 858

Query: 838  KQKEYEVQKLKNEVKFLTNMN------------TNLKAD--KTQFSQ----KEKQYSQKY 963
             Q E  +++LK     ++ +N            +N KA+  KT+F++     +   ++  
Sbjct: 859  CQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDL 918

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            I ++K +    +E  +  D  NRLK       +  + L  S  AQ N     + +  ++ 
Sbjct: 919  INLQKQVEEKSKENEELSDRFNRLK------KQANERLHASKVAQNNLTEQSNELKARNT 972

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSE-----AEALDNVLGLIENTMKTLEGN 1308
            D  + +L ++  + KE +E  +        S  +     A ALD      E  +KT+  +
Sbjct: 973  D-LERNLSEQMERFKE-LENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSES 1030

Query: 1309 SKYYS 1323
                S
Sbjct: 1031 ESLVS 1035

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 63/352 (17%), Positives = 145/352 (41%), Gaps = 50/352 (14%)
 Frame = +1

Query: 487  SKNAIDSLY-YHEQLEKKDLNEK----SLQMAIDHL----LKVTKQNQRQVD--GRDKLE 633
            ++ +ID L  Y+E  + +   +K    +L + I H+    LK++ Q +  ++     K++
Sbjct: 25   NETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQHINNDNLKLSNQLKNIIEKFNLSKID 84

Query: 634  ETEVLKSFIKEIEEVEDNKISINSLEQQLLEEK-TANNILRRDYYKLQERGKRLCH-EFQ 807
            + + +++   ++ ++E+   ++NS    L ++  T NN L     +L+     +   E +
Sbjct: 85   QNKTIENLKLKLFKLENENKTLNSTNLNLTDKNDTLNNNLNLKLIELKNLNDNITELELK 144

Query: 808  -----DLQDDYSKKMKQKEYEVQKL------KNEV------------------------- 879
                  L+D   +++  K   + KL      KNEV                         
Sbjct: 145  RNNDIQLKDKLIQQLNSKIENLLKLGKSPKFKNEVEIINDSKTINDDIENSKATIPPSPA 204

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNM 1059
            K L+  N  LK+D   +  + +Q        +  + +++   NKK      L+    +N+
Sbjct: 205  KALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENL 264

Query: 1060 KKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM-EQKLQTSKNNDPS 1236
            K +D +++++  ++   +S  A+ +Q  D          H+++  +    +Q   N   S
Sbjct: 265  KLMDSMKKTINEKS---SSIEALDIQRTDLA--------HQLQYLLIHSSIQNDNNGPLS 313

Query: 1237 CSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHIT 1392
             SE   + N++   +  +     +S   S  + + +K+    S  ++N  +T
Sbjct: 314  KSEILFMQNLINKDKQRL-----SSDVQSVISDRLIKFKDIVSLQEKNMELT 360

>KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.636
            YOR216C
          Length = 473

 Score = 43.9 bits (102), Expect = 7e-04
 Identities = 45/236 (19%), Positives = 92/236 (38%), Gaps = 14/236 (5%)
 Frame = +1

Query: 673  EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS-------- 828
            EV D +  I  L+ +L   K+   +   D  +       L  E  +++  Y         
Sbjct: 77   EVTDLRKQIAQLQAELDRAKSEKTVTESDTNRDSSEVASLKEERDEIKSQYDTLLSRLSS 136

Query: 829  -----KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
                  KMK+ + E++  K  +K   + N  LK   +  ++ + + +     + K + ++
Sbjct: 137  MKTVFNKMKEAQQELEITKESLKEYESQNLKLKNKLSNATKDQTELTTTVTTLHKEIENL 196

Query: 994  KQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
            +++      +C++ +       ++ID ++  LQA      +      +D D   A ++D 
Sbjct: 197  ERDCENMTSKCHQYE-------RQIDEMQSRLQAGDKNHMTLLETLRKDNDMLSAKIQD- 248

Query: 1174 YHKVKEFMEQKLQTSK-NNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
                   +   L TSK NN     E E     +  +E  ++TLE   K   T  ++
Sbjct: 249  -------LTIVLDTSKQNNADLIEEKEESQQTIITLEKHIQTLEEKIKSLETQVEE 297

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 63/329 (19%), Positives = 136/329 (41%), Gaps = 22/329 (6%)
 Frame = +1

Query: 388  HISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMA 567
            HI ++ +  L +  E L          K  C+   +A+ +     + E    ++   Q+ 
Sbjct: 781  HIMVTQLQTLQKERENLL------DETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLE 834

Query: 568  IDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL--------- 720
             D+  K+ +  Q +++   K  E+ V+ S  ++  EVE  +  I SLE+++         
Sbjct: 835  EDNDSKI-EWYQNKIETLRKDHES-VMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT 892

Query: 721  ---LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV---- 879
               L+E   ++ LRR+   L++    L   +  +Q +Y K  +  +  +Q++ +++    
Sbjct: 893  YNVLDESINDDSLRRE---LEKSKINLTDAYSQIQ-EYKKLYETTDKSLQEMSSQLDESN 948

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNM 1059
            K  +N   NL  +KT    K     ++   +   +    Q   K++ E  +   ++  N 
Sbjct: 949  KAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNN 1008

Query: 1060 KKIDHLERSLQAQTNA------QNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK 1221
            K+I+ ++   +++ +       Q +  A T Q+  +++        K    + ++L T K
Sbjct: 1009 KEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYK 1068

Query: 1222 NNDPSCSEAEALDNVLGLIENTMKTLEGN 1308
                   + E L+   G  E  +K  E N
Sbjct: 1069 ------GQVETLNLARGQFEKALKENETN 1091

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 56/304 (18%), Positives = 120/304 (39%), Gaps = 11/304 (3%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLE-KKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            +EC++ ++ I  L   +Q     DLN KS        L + + N+  ++     +  + L
Sbjct: 167  SECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYL 226

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQD--- 819
                K    + + +  +N +      EKT N++LR+   +L +  +    + + L D   
Sbjct: 227  SYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSN 286

Query: 820  ----DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ--FSQKEKQYSQKYIYIEKY 981
                D+S ++  K+  +  L++++  +     N +        S   KQ   +   + K 
Sbjct: 287  SEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKD 346

Query: 982  MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
            +   K +  + E+EC RL  + ++  K+    +  L +++N         +  E +   H
Sbjct: 347  LQLTKHKLVQCENECLRLSSITEEAGKE----DGILTSKSNGDFILLKKQLIKEKRAKEH 402

Query: 1162 LEDRYHKVKEFMEQKLQTSKNNDPSCSEAE-ALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
            L+++       +E K+    +        E  L+N   L+E+T        K      +K
Sbjct: 403  LQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEK 462

Query: 1339 CLKY 1350
              +Y
Sbjct: 463  LAEY 466

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 80/349 (22%), Positives = 139/349 (39%), Gaps = 20/349 (5%)
 Frame = +1

Query: 397  ISSISDLAQTFET----LAVGITHETNRK-AECERSKNAIDSLY-YHEQLEKKDLNEKSL 558
            I+S  +   T E      A+ + H +N K A+ +  K   + L  Y +++         L
Sbjct: 421  INSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480

Query: 559  QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTA 738
               I +LL     N    D +  L + E+   FI+ I +  D+  +  S  Q+++ E+  
Sbjct: 481  CRQIQYLLVT---NSVSNDSKGPLRKEEI--KFIQNILQ-NDDSATTESDSQKIVTERLV 534

Query: 739  NNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD 918
                 RD  +LQE+   L    ++L D    K++  E    K KN +K + N   N   +
Sbjct: 535  EF---RDIIQLQEKNSELLRVTRNLAD----KLESNE---NKSKNYLKNIENETINEAKE 584

Query: 919  KTQFSQKEK-QYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQA 1095
                 Q +K Q   K   +EK     K     +E   N      +  ++++   +R L++
Sbjct: 585  AILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPN------NSVIQQLTETKRELES 638

Query: 1096 QT-NAQNSFSAVTVQDEDQK---DAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA-EALD 1260
            QT + Q   S VT +  +     +  L+D Y   K  +  +L   K++     E  + L 
Sbjct: 639  QTQDLQARISQVTRESTENMSLLNKELQDLYDS-KSSLSIELGREKSSRILAEERFKLLS 697

Query: 1261 NVLGLI--------ENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
            N L L         + ++      SK  S T +    YV+  S+L   E
Sbjct: 698  NTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIE 746

>Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR023W
            (REAL)
          Length = 1929

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 81/385 (21%), Positives = 152/385 (39%), Gaps = 72/385 (18%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE 633
            H+  RK + E S ++ D   Y  + E  +   KSL+   D L  +  +++  +   D ++
Sbjct: 1350 HDKFRKIQGEGSLSSSD--IYKLKFEASEERVKSLE---DKLKTMPLRDRTNLPVGDIIK 1404

Query: 634  ETEVLKSFIKEIE--EVEDNKIS---------INSLEQQLLEEKTANNILRRDYYKLQ-- 774
              + +  + +EI   ++E+ K+          ++ L   L +  +   +L     +LQ  
Sbjct: 1405 NRDSISKYEEEIRYYKLENYKLQEILNESNGKLSKLTHDLRQSNSKEAMLSEQLDRLQKD 1464

Query: 775  ----ERGKRLC--------HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD 918
                ER K L          +F++  DD      Q    V  LK   + + +M T ++  
Sbjct: 1465 LESTERQKELLSSTMKQQKQQFENCMDDLQGNELQLREHVHALKQAQEDIKSMATIIERL 1524

Query: 919  KTQFSQKEK--------------QYSQKYIYIEKY----------MSHVKQEYNKKE--- 1017
            KTQ  QKEK              Q  +  + +++           +SH+K+     E   
Sbjct: 1525 KTQNKQKEKLIWEREMERNDSDMQLQETLLELKRVQDVKKILSDDLSHLKERLGAVEDRS 1584

Query: 1018 ---DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQ------DEDQKDAHL-- 1164
               DE NRLK          + L  SL+ +TN +  F+ +  +      D + K + L  
Sbjct: 1585 QYTDEINRLK----------EELNHSLKTETNLKKEFATLKYRLETSNNDSEAKISDLLK 1634

Query: 1165 -EDRYHKVKEFMEQK---LQTSKNN-----DPSCSEAEALDNVLGLIENTMKTLEGNSKY 1317
              D Y KV E +  +   +  S+N      +   +E ++L + +  +    + LE N K 
Sbjct: 1635 QLDHYTKVVEMLNNERDAVSLSENELYQKYEALNTECKSLKSAVASLSKVKEELESNLK- 1693

Query: 1318 YSTTTKKCLKYVTGSSRLKENEHIT 1392
               T +     +  S  ++EN+ I+
Sbjct: 1694 -QKTEELDASSIAFSKSVQENKEIS 1717

 Score = 35.8 bits (81), Expect = 0.31
 Identities = 56/269 (20%), Positives = 108/269 (40%), Gaps = 39/269 (14%)
 Frame = +1

Query: 322  DTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAI 501
            D  K++ D   +   + N     +S+S  ++L Q +E L            EC+  K+A+
Sbjct: 1631 DLLKQL-DHYTKVVEMLNNERDAVSLSE-NELYQKYEAL----------NTECKSLKSAV 1678

Query: 502  DSLYYHEQLEKKDLNEKSLQMAIDHLL--KVTKQNQRQVDGRDKLEETEVLKSFIKE--- 666
             SL   ++  + +L +K+ ++    +   K  ++N+   +    LEET  LK  I++   
Sbjct: 1679 ASLSKVKEELESNLKQKTEELDASSIAFSKSVQENKEISEKMKYLEET--LKLQIEQNAR 1736

Query: 667  ----IEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS-- 828
                + +++DN    N   ++  +EK  N  L  +   LQ+    L    ++LQD  S  
Sbjct: 1737 NGELVRKLQDNS---NVFREKFDDEKQKNIDLFEENQSLQKLNTDLQSHVENLQDRLSDT 1793

Query: 829  ----------------------------KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKT 924
                                        KK K  E  V+ L+N+    T +      ++ 
Sbjct: 1794 SEKKAWLAKIHELENLVSQETDLKYEEMKKNKNMERIVEDLQNKNSQQTEVIELANRNRG 1853

Query: 925  QFSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
            +F +   +Y  +   +EKY+S  + +  K
Sbjct: 1854 EFEETALKYEAQISELEKYISQQELDIKK 1882

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
            Component of the eisosome with unknown function;
            GFP-fusion protein localizes to the cytoplasm;
            specifically phosphorylated in vitro by mammalian
            diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 54/267 (20%), Positives = 114/267 (42%), Gaps = 18/267 (6%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL-------KSFIKEIEEVE 681
            ++ + +L +  +Q  ID+L K  +    Q +   KL E  V        K ++ +I ++ 
Sbjct: 571  KINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDI- 629

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
            DN+IS    E  +++++ AN   +      +   +R  HE Q L+ +  ++ +++E  ++
Sbjct: 630  DNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQ-LKLEAEERKRKEENLLE 688

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
            K + E+                    E+Q  Q  +  E+ ++ VKQ YN +  E      
Sbjct: 689  KQRQEL--------------------EEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLA 728

Query: 1042 VVDKNMKKID------HLERSLQAQTNAQNSFSA-----VTVQDEDQKDAHLEDRYHKVK 1188
              +K ++ +         E++++ QT  +N+  A     ++ Q +  +  H  +  HK+ 
Sbjct: 729  TEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAEN-HKIP 787

Query: 1189 EFMEQKLQTSKNNDPSCSEAEALDNVL 1269
                QK  +    D S  E    ++V+
Sbjct: 788  NDRSQKNTSVLPKDDSLYEYHTEEDVM 814

 Score = 35.8 bits (81), Expect = 0.29
 Identities = 54/247 (21%), Positives = 108/247 (43%), Gaps = 38/247 (15%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDH------LLKVTK--QNQRQVDGRDKLEETEVLKSFIKEI--- 669
            ++ K  L +K + +  +H      +LK T+  +NQ+  +  + L++   +KS I ++   
Sbjct: 484  EVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNE 543

Query: 670  -----EEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL--QDDYS 828
                 +E  D   ++++L QQL  +    N +     K+Q     L  + +DL  Q + +
Sbjct: 544  KTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEEN 603

Query: 829  KKM-----------KQKEY---------EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
            KK+           + KEY         ++  L NEV  +   N N   +KTQ S   K+
Sbjct: 604  KKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENAN---EKTQLSAITKR 660

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV 1128
               +    E+ +    +E  +KE+       +++K  ++++  E++ QAQ + +   + V
Sbjct: 661  LEDERRAHEEQLKLEAEERKRKEEN------LLEKQRQELE--EQAHQAQLDHEQQITQV 712

Query: 1129 TVQDEDQ 1149
                 DQ
Sbjct: 713  KQTYNDQ 719

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 63/331 (19%), Positives = 139/331 (41%), Gaps = 30/331 (9%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLE----KKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE--TEVLK 651
            KN ++  + +E+LE    + + + K L+   + L  +  +  + +D  +KLE+   +  +
Sbjct: 833  KNKLE--FENERLESTRARHEKSTKDLEKVKEELKSLESEEVKILDDINKLEDCIAKDNE 890

Query: 652  SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK 831
              +++  E++   ++ NSLE+ ++E   +  + +R+Y +L+E  ++L  E          
Sbjct: 891  ELVQKQIELDKKSLTTNSLEETIVEISNSMQMTKREYEELKEDIEKLTLE---------- 940

Query: 832  KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY-MSHVKQEYN 1008
                    V  LKN    +TN++  +++   +    +K  S          + + K    
Sbjct: 941  -------RVNTLKN--CKITNIDLPVRSSSLEDLPMDKMDSATIEIANSIDIDYTKLTAK 991

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA-------QNSFSAVTVQDED--QKDAH 1161
             KE   + ++    +++KKI+H    LQ  + A       Q  +  +  + E    K+  
Sbjct: 992  YKESNGDLVRQDFQESLKKIEHALLELQPNSKAVERYEETQMRYDVINGETESLKAKEKK 1051

Query: 1162 LEDRYHKVKEFMEQKLQTSKNN--------------DPSCSEAEALDNVLGLIENTMKTL 1299
            + ++Y KVK+   +  + + N+              DP  + A A  +    +E+  +  
Sbjct: 1052 IREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEPY 1111

Query: 1300 EGNSKYYSTTTKKCLKYVTGSSRLKENEHIT 1392
                KY++T   K         R K+ EH++
Sbjct: 1112 LAGIKYHATPPMK---------RFKDMEHLS 1133

 Score = 38.9 bits (89), Expect = 0.034
 Identities = 35/185 (18%), Positives = 82/185 (44%), Gaps = 6/185 (3%)
 Frame = +1

Query: 853  EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR 1032
            + ++L+NE+  L   NT +   +TQ +Q ++   +  + I+ +   VK+EY  K D    
Sbjct: 713  KARELENEISVL---NTEISGLRTQLNQIQRSLKENKVEIQYHEDMVKKEYIPKIDSLRN 769

Query: 1033 LKFVVDKNMKKIDHLERSLQAQT-NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKL 1209
                 +  + + +H + +LQ +           ++++ +Q    +  +  K  + +++++
Sbjct: 770  KAAQCEARVSQFEHEKETLQERIYKGITEKLGFSIKEYEQHSGEIMRKQAKELQQLQKQI 829

Query: 1210 QTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRL-----K 1374
               KN      E E L++     E + K LE   +   +   + +K +   ++L     K
Sbjct: 830  MNIKNKLE--FENERLESTRARHEKSTKDLEKVKEELKSLESEEVKILDDINKLEDCIAK 887

Query: 1375 ENEHI 1389
            +NE +
Sbjct: 888  DNEEL 892

>KLLA0C13794g Chr3 (1178848..1182747) [3900 bp, 1299 aa] {ON} some
            similarities with uniprot|P53935 Saccharomyces cerevisiae
            YNL091W NST1 Protein of unknown function mediates
            sensitivity to salt stress interacts physically with the
            splicing factor Msl1p and also displays genetic
            interaction with MSL1
          Length = 1299

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 65/287 (22%), Positives = 115/287 (40%), Gaps = 5/287 (1%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR----QVDGRDKLEETEVLKSF 657
            +N  + + Y +  E   LNE    +   H   +   N        DG D   ++E     
Sbjct: 593  ENEDEDIIYDDLHENVKLNEDPSAVPNGHTQLIHHDNSVTSNVSEDGIDDNYDSE----- 647

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERG-KRLCHEFQDLQDDYSKK 834
            +   E +E+ +  I     +LL++K   +   ++  K +ER    L  E    ++   KK
Sbjct: 648  LDHAERLEEGRRLIQIAITKLLQKKLIASYQEKEAEKNRERLLMELEAEENQKKEKEKKK 707

Query: 835  MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK 1014
            +K+KE E +K + +          L  ++ +  Q+E++   K    EK ++  ++   KK
Sbjct: 708  LKKKEKEKEKKRQQ---------QLAKEEEKKRQEEEEIRLKKEAEEKEIAR-REAQRKK 757

Query: 1015 EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
             +E  R     +K  KK+    R  + Q   +        Q E+++     ++  K +EF
Sbjct: 758  VEEAKRKND--EKRKKKLAEQRRREEEQERIRKEKEEQKRQREEEQKQKKMEKERKQREF 815

Query: 1195 MEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTK 1335
             EQ+L   K       EAE L     L EN     +   K   TTT+
Sbjct: 816  EEQRLLKKK-------EAEQLQK---LKENQKLNEKSMQKNQDTTTE 852

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
            (REAL)
          Length = 1316

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 69/301 (22%), Positives = 130/301 (43%), Gaps = 7/301 (2%)
 Frame = +1

Query: 421  QTFETLAVGITHETNRKA----ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKV 588
            Q F+ +   + +  N K     + +R  N+ID +         DL++  LQ  +D+  KV
Sbjct: 262  QDFQKILSKVENLKNAKISISDQVKRLSNSIDII---------DLSKPDLQNLLDNFSKV 312

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYK 768
                   +D  ++L++ E   S +K+ +    N+   NSL ++  E +       ++   
Sbjct: 313  L------MDKNNQLKDLEASTSNLKDRQSSLQNRS--NSLIRRQGELEAGKETYEKNLNH 364

Query: 769  LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
            L    +   H FQDL D  +  M Q  +++ + K    F+++  TN  A K +   + K+
Sbjct: 365  LSSLKEAFQHRFQDLSDIKNNDMAQINHKMSQFK---AFISHDLTN-TAKKFEEEIQLKE 420

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV 1128
             S   +     +     EYNKK+    R K + D         E   +   + +NSF+  
Sbjct: 421  TSLSELVKSITVDSQNLEYNKKD----RTKLICD--------TEELAEKIRSFKNSFT-- 466

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNND--PSCS-EAEALDNVLGLIENTMKTL 1299
                ED     L++    +K + E KLQT +N +  P  + + E  +N + ++EN ++  
Sbjct: 467  ----EDD----LKNELENLKTYKE-KLQTWENENIIPKLNQQIEEKNNEMIILENQIEKF 517

Query: 1300 E 1302
            +
Sbjct: 518  Q 518

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 66/309 (21%), Positives = 125/309 (40%), Gaps = 9/309 (2%)
 Frame = +1

Query: 328  FKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDS 507
            F++++D  N   A  N            DL  T +     I  +    +E  +S   +DS
Sbjct: 376  FQDLSDIKNNDMAQINHKMSQFKAFISHDLTNTAKKFEEEIQLKETSLSELVKSIT-VDS 434

Query: 508  LYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN 687
                + LE    +   L    + L +  +  +      D   E E LK++ ++++  E+ 
Sbjct: 435  ----QNLEYNKKDRTKLICDTEELAEKIRSFKNSFTEDDLKNELENLKTYKEKLQTWENE 490

Query: 688  KISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD---YSKKMKQKEYEV 858
             I I  L QQ+ E+     IL     K Q+R  +  ++  DL        K +  K  E+
Sbjct: 491  NI-IPKLNQQIEEKNNEMIILENQIEKFQDRIMK-TNQQADLYAKLGLIKKSVGAKSDEL 548

Query: 859  QKL------KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED 1020
            QK+       ++++ +  +  + K D  Q S  E  + + +I ++K ++      NK+  
Sbjct: 549  QKIIQTLLNNSKIRQIFPIMQDFKQD-FQGSDLEMDFQKLFINMQKNIA----INNKEMH 603

Query: 1021 ECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFME 1200
            E +R K+     +   + +E+ L  Q N Q+      + +E+  +    D Y  V E  E
Sbjct: 604  EIDR-KYT--NALYNFNTIEKDL--QENQQSKQKVTQLLNENLPEDCTIDEYSDVLEESE 658

Query: 1201 QKLQTSKNN 1227
               +T+  N
Sbjct: 659  LSYKTALEN 667

>KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {ON}
            similar to uniprot|Q12234 YOR216C Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 471

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 54/257 (21%), Positives = 107/257 (41%), Gaps = 40/257 (15%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEK------------------KDLNEKSLQMAIDHLL 582
            E   + E ER +N + +L   +QLEK                  KD N +     +    
Sbjct: 55   EAGLRKEVERLQNEVSNL--RQQLEKQTKHGSKDEKDEKDEKDEKDENSEKTNKEVKDEE 112

Query: 583  KVTKQNQRQVDGRDKLEET-----EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
            ++T +  +  + RD+ E         L S      ++ +++  + S ++QL E ++ N  
Sbjct: 113  ELTTKLAKIQEERDQFENQYNSLLSRLSSMKSVFNKMRESQEELESCQEQLREYESQNLS 172

Query: 748  LR-------RDYYKLQERGKRLCHEFQDLQDD---YSKKMKQKEYEVQKLKNEVKFLTNM 897
            LR       R++ +LQ     L  E   L D+    S+++ +   +  K + ++K L++ 
Sbjct: 173  LRNKLENSNREHEELQNTVVTLNQEVSGLNDECESLSQELSEAVEKSSKFEEDLKTLSSH 232

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK----- 1062
            N N          +   +  K+  +E  +S++KQ+    ++E   LK  ++K+ +     
Sbjct: 233  NAN----------ERHTWETKFKELELLLSNMKQDMESLKEEREDLKQRLEKSERLKETS 282

Query: 1063 --KIDHLERSLQAQTNA 1107
               +  LER L+ Q  A
Sbjct: 283  EANLAELERQLELQQQA 299

>TBLA0G02190 Chr7 complement(568903..573144) [4242 bp, 1413 aa] {ON}
            Anc_4.327 YLR442C
          Length = 1413

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 61/297 (20%), Positives = 134/297 (45%), Gaps = 2/297 (0%)
 Frame = +1

Query: 481  ERSKNAI-DSLYYHEQLEKK-DLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS 654
            ER+KN   + L     L K+ ++N +S  ++ D+  ++ KQ ++Q    +K EE +  K 
Sbjct: 260  ERAKNRQNEQLLLSRGLSKQINMNLRSEVISDDNATEIEKQVEKQ---EEKQEEKQEEKQ 316

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK 834
              K+ E+  +NK       ++  EEK  +     +   ++E  + +  E ++ +D+    
Sbjct: 317  EEKQEEKQVENK-------KEEAEEKDQD-----EQEVMKEMEEEVMEEIEEDEDE---- 360

Query: 835  MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK 1014
              ++E E ++L++EVK           +  +   ++++  +    IE+     ++E + +
Sbjct: 361  --EEEEEEEELEDEVK-----------EGVEGGVEDEEDEEVMEEIEEVEDESEEEEDSE 407

Query: 1015 EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
            E+E         KNMK+    + ++  + N         V+D+DQ+D      Y    ++
Sbjct: 408  EEEAKE----TSKNMKQ----DTTIDEKNNTSFEHDTEDVEDDDQEDGDEISIYEDAPDY 459

Query: 1195 MEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSS 1365
            ++    +S  N+   +  + LDN+    EN++  L  +      TTK+ + + +  S
Sbjct: 460  LKTTRTSSSQNNVDSN--KILDNLND--ENSLPKLNKDD-----TTKRSIFHTSSQS 507

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 56/293 (19%), Positives = 118/293 (40%), Gaps = 31/293 (10%)
 Frame = +1

Query: 373  NIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEK 552
            N+ ++ IS  + +++ +  E        +   K E ++ +  +++    E+ E+KD +E+
Sbjct: 283  NLRSEVISDDNATEIEKQVEKQEEKQEEKQEEKQEEKQEEKQVENK--KEEAEEKDQDEQ 340

Query: 553  SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL----------------KSFIKEIEEVED 684
             +   ++   +V ++ +   D  ++ EE E+                 +  ++EIEEVED
Sbjct: 341  EVMKEMEE--EVMEEIEEDEDEEEEEEEEELEDEVKEGVEGGVEDEEDEEVMEEIEEVED 398

Query: 685  NKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK 864
                    E++  +E + N  +++D    ++      H+ +D++DD            Q+
Sbjct: 399  ESEEEEDSEEEEAKETSKN--MKQDTTIDEKNNTSFEHDTEDVEDD-----------DQE 445

Query: 865  LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN----KKEDECNR 1032
              +E+    +    LK  +T  SQ         +   K + ++  E +     K+D   R
Sbjct: 446  DGDEISIYEDAPDYLKTTRTSSSQNN-------VDSNKILDNLNDENSLPKLNKDDTTKR 498

Query: 1033 LKFVV-----------DKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDA 1158
              F             D ++  +   +  LQ + + QNS S    Q ED  DA
Sbjct: 499  SIFHTSSQSDEPDSSSDSDVISVSETQVELQDKFHPQNSLSP---QLEDMYDA 548

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 65/316 (20%), Positives = 132/316 (41%), Gaps = 33/316 (10%)
 Frame = +1

Query: 412  DLAQTFETLAVGITH-ETNRKAECERSKNAIDSLYYHEQL--EKKDLNEKSLQMAIDHL- 579
            DL  T E+L   +   +     +    ++  DSL   ++    +++L E++++   + + 
Sbjct: 973  DLQATHESLIASMEEIKKENTMQMSNLESKFDSLSQEKESFQSERELLEENIRKLKETIS 1032

Query: 580  -LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE-DNKISINSLEQ------QLLEEKT 735
             L++TK+         K +    +    +++E V  +N  S+N + +       L  E  
Sbjct: 1033 TLELTKEEAITKFNSSKEDYESQIGLLKEQLETVATENGESVNKISELSHNIDDLKGELE 1092

Query: 736  ANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKA 915
                 + D     E  K++  E Q  +    ++  Q E E+ K+K +   L N+  NLK+
Sbjct: 1093 TQKNFKDDLEAKLEASKKVLKETQANEQHLKEEKLQLEGEITKIKEQ---LDNLRDNLKS 1149

Query: 916  DKTQFSQKEKQYSQKYIYIEKYMSHV---KQEYNKKEDEC-NRLKFVVDKN--------- 1056
                    EK+  +    +E+Y   +   ++EYN K  E  N +  V  KN         
Sbjct: 1150 -------LEKENKESVAQVEEYKKQISDKEKEYNGKLSELNNEINSVQQKNETICQNNEK 1202

Query: 1057 -MKKIDHLERSLQAQTNAQNS-FSAVTVQDEDQKDA------HLEDRYHKVKEFMEQKLQ 1212
               +I+ +E++ + Q+N + S   A+  Q E+ +++       L D    +K  ME+  +
Sbjct: 1203 LKGEIEEIEKASEDQSNLKGSKIEALNAQIEELEESKQITETKLLDSVKNMKTEMEKMRE 1262

Query: 1213 TSKNNDPSCSEAEALD 1260
              K +D    +   L+
Sbjct: 1263 LQKESDAKMVKINELE 1278

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {ON}
            Anc_2.15
          Length = 616

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 55/270 (20%), Positives = 117/270 (43%), Gaps = 36/270 (13%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQ--------NQRQVDGRDKLEETEVLKSFIK--EIEEVEDNKI 693
            NEK+ Q A +   K  K+        +QR  DG  K EE + LK+ ++  +++ ++ N+ 
Sbjct: 237  NEKARQQARNEYNKTVKRFATFIKKIDQRMKDGAKKAEEEKKLKNELRRQQLDAMKKNRT 296

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV----- 858
            + N +EQ    E  +   +  D+ ++++R  R   E  +     + K+   + E+     
Sbjct: 297  NGNQVEQPSDFELQSWQAVDEDWDEIEKRYAR-ADEITEEDLLTASKIPINDDEIIIYEC 355

Query: 859  ----QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY--------IEKYMSHVKQE 1002
                +  K+E ++  ++NT L   K + ++ EK+  ++++         ++++ S  +  
Sbjct: 356  FICSKNFKSEKQYENHVNTKLH--KRRLNEIEKEIKKEHMEFGLDNLSDLDEFSSAAESV 413

Query: 1003 YNKKEDEC---------NRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD 1155
              +++DE          N     +DK  +++  +ER L   T+  ++   + V+ +D   
Sbjct: 414  NGQEQDELAEKVMTDNINVADLDLDKLNEELAEIERQLAEATSGSDTEDEIEVEIDDVSS 473

Query: 1156 AHLEDRYHKVKEFMEQKLQTSKNNDPSCSE 1245
                D    V E  + K    KN  P   E
Sbjct: 474  VESPD----VTEEKQNKEGKVKNEPPKIEE 499

>Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] {ON}
            complement(173760..175733) [1974 nt, 658 aa]
          Length = 657

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 58/279 (20%), Positives = 122/279 (43%), Gaps = 19/279 (6%)
 Frame = +1

Query: 592  KQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL----LEEKTANNI---- 747
            + N   +   D +   E++KS   E+  V+ N+  I ++  Q     LE++  +N+    
Sbjct: 13   RPNIEDLRKEDDVVRDELIKSLEYELNTVQ-NEFEIQNMRLQRQYNHLEKQYKSNLDTLE 71

Query: 748  -LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKL-------KNEVKFLTNMNT 903
                D  +L  R + L     +L+ +YS+ +++KE + + L       K E +FL N   
Sbjct: 72   KTLNDMQELHVRNESLNRNLSELKKEYSEVIEEKEIQFKTLNSDYDVVKEECEFLRNQYQ 131

Query: 904  NLKA---DKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDH 1074
             + +   D+ ++ + E + SQ  I +       + E +K+  +   LK +V +   +++ 
Sbjct: 132  TMASRVGDQEEYKKLETEASQNLIKM------YENELSKQNKQIISLKKLVTEKDGELED 185

Query: 1075 LERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEA 1254
            L+ +   +T+   +++   +Q+    +  L+D+   VKE  E  +Q +        + E+
Sbjct: 186  LKANGVIKTH--QNYNTEELQELTVVNKLLKDQQVYVKELEEANMQQANELKKIRLQNES 243

Query: 1255 LDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRL 1371
                    EN  K    NS + +T     L+ +   S+L
Sbjct: 244  HHYWKNAFENLQKE---NSNFNATVQDLELENIKLKSQL 279

>TPHA0E00390 Chr5 complement(64714..67113) [2400 bp, 799 aa] {ON}
            Anc_7.488 YBL047C
          Length = 799

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 69/334 (20%), Positives = 137/334 (41%)
 Frame = +1

Query: 322  DTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAI 501
            D  K +N+ +NR  A     TK    + + DL          +TH+ N K   +   N I
Sbjct: 295  DKEKRINNELNRINA-----TKKQIETKLEDLH---------VTHDKNVKETEQLELNLI 340

Query: 502  DSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE 681
                   Q E K L +   Q+ +D+  ++TK NQ            E LK  IK+  +  
Sbjct: 341  Q-----RQNELKALQKHLDQLELDNTSELTKINQLN----------ENLKIAIKKKNDFT 385

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
             N  ++ S  + L ++      +  D  K +++   L    + L+   +K     + E+ 
Sbjct: 386  KNITTLKSSSETLTKK------IEEDQIKYKQQSSLLDVNRKQLETTETKN-NNFQSELS 438

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
             L   +    +  T+   ++    Q+  +  +KY  ++   + +K    K  +E   ++ 
Sbjct: 439  LLSASLPTFISKFTSFLENQKIVEQQHAKLQEKYKGLDNRNNELKAYETKIAEETKEIED 498

Query: 1042 VVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK 1221
               K  +KID L++     T  Q  + A   +++  K  H+ D   +++E  E++++ + 
Sbjct: 499  NEQKCDQKIDRLQQLFDEFTARQKEYEA---ENDKLKSRHV-DYAQELQELTERQMKLNL 554

Query: 1222 NNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYS 1323
             + P   +    D ++ L     KT++ +SK  S
Sbjct: 555  GDIPDNVD----DILIKLDMYNKKTVDVDSKIES 584

>KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {ON}
            Anc_5.296 YDR285W
          Length = 875

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 47/209 (22%), Positives = 87/209 (41%), Gaps = 25/209 (11%)
 Frame = +1

Query: 598  NQRQVDGRDKLEETEVLKSFIKEIEE--------VEDNKISINSLEQQLLEEKTANNILR 753
            +Q +     K+EE   L   IKE+E+         E  KI   + + +L+ +   N++L 
Sbjct: 542  SQLRTQETGKMEENVQL---IKELEQCKAENKRITESLKIERANFDNKLISQNGINSVLV 598

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKM----------KQKEYEVQKLKNEVKFLTNMNT 903
             +   L++R   L    Q++Q D + ++          ++   E  +LK     L   N 
Sbjct: 599  SENDTLKQRVLELEDYRQNVQRDQTNRLDKFQKINEQLQKLNVESVQLKARGLELEEENR 658

Query: 904  NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN-------KKEDECNRLKFVVDKNMK 1062
            NL+ D    + KE   +Q+   +   M +V  E         K ED+C RL+  ++K   
Sbjct: 659  NLRKDLENSTSKEDDNAQEVQSLRNQMLNVNAEKQEVLLAKYKLEDDCERLRSNIEKMRH 718

Query: 1063 KIDHLERSLQAQTNAQNSFSAVTVQDEDQ 1149
            KI+ L+   + + +   +   V +    Q
Sbjct: 719  KINTLQEEQKRKVSDPETKENVNIAVSQQ 747

>KAFR0K01510 Chr11 (311581..314298) [2718 bp, 905 aa] {ON} Anc_3.425
            YGR089W
          Length = 905

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 67/304 (22%), Positives = 129/304 (42%), Gaps = 12/304 (3%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKS 555
            +P+    I  I+ L QT       +   T  + +   S ++ D L   +  EK DL   S
Sbjct: 619  VPSCSYDIQFINRLNQTAVFFNTDLIIRTKGQGDRNVSDDSADKL--SKNFEKLDLTFPS 676

Query: 556  LQ--------MAIDHLLKVTKQN---QRQVDGRDKLEETEVLKSFIKEIEEVEDNKISIN 702
                      + + H +  T  N   +R    + K E T+ L +F +EI+ ++      N
Sbjct: 677  YYHRKFLSPLLTLKHSVLTTNANLSDERLKLKKTKKEITKKLNAFKQEIDHLK------N 730

Query: 703  SLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
             L+Q    E+  ++ +      LQ+    +     +L++++ K + + E+E+     E +
Sbjct: 731  KLKQNASTEEKNSSKVENLKIALQQNENSVA----ELEEEF-KNVSKDEFEL-----EDR 780

Query: 883  FLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK 1062
            +L   N +LK +  +FS+ E+   +K   +   M  ++ EYN+      +L+        
Sbjct: 781  YLEKKNYHLKKE-LEFSKAEENLKKKLDEVTGKMGKLETEYNQLLSRKEKLE-------A 832

Query: 1063 KIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ-TSKNNDPSC 1239
            + D L++ L         F A  +Q ++++ +  ED   + +E  E +LQ      D S 
Sbjct: 833  RRDRLQKELDQNNEIFEVFKANFLQKKEKERSKRED--IRAREINELELQIKGLEQDISR 890

Query: 1240 SEAE 1251
             EAE
Sbjct: 891  LEAE 894

 Score = 38.9 bits (89), Expect = 0.032
 Identities = 29/139 (20%), Positives = 67/139 (48%), Gaps = 5/139 (3%)
 Frame = +1

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
            N NL  ++ +  + +K+ ++K    ++ + H+K +  +            +KN  K+++L
Sbjct: 697  NANLSDERLKLKKTKKEITKKLNAFKQEIDHLKNKLKQNAS-------TEEKNSSKVENL 749

Query: 1078 ERSLQAQTNAQNSFSAVTVQDE----DQKDAHLEDRYHKVKEF-MEQKLQTSKNNDPSCS 1242
            + +LQ     QN  S   +++E     + +  LEDRY + K + ++++L+ SK  +    
Sbjct: 750  KIALQ-----QNENSVAELEEEFKNVSKDEFELEDRYLEKKNYHLKKELEFSKAEENLKK 804

Query: 1243 EAEALDNVLGLIENTMKTL 1299
            + + +   +G +E     L
Sbjct: 805  KLDEVTGKMGKLETEYNQL 823

>SAKL0C03652g Chr3 (344282..347464) [3183 bp, 1060 aa] {ON} weakly
            similar to uniprot|P33338 Saccharomyces cerevisiae
            YNL243W SLA2 Transmembrane actin-binding protein involved
            in membrane cytoskeleton assembly and cell polarization
            adaptor protein that links actin to clathrin and
            endocytosis present in the actin cortical patch of the
            emerging bud tip dimer in vivo
          Length = 1060

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 50/268 (18%), Positives = 120/268 (44%), Gaps = 3/268 (1%)
 Frame = +1

Query: 433  TLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQV 612
            T   GI    N++ + E  +  +      EQ  ++ L ++  Q A+       +Q QR++
Sbjct: 325  TQPTGIDFWNNQQVQYEAEQRRL------EQERQQQLLQQQQQQAL------FEQQQREL 372

Query: 613  DGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQE---RG 783
              + + ++ +  +   +++ + +  +  ++SL+  LL      N   RD   L++   R 
Sbjct: 373  QQQQQQQQQQQQQQLQQQMLQQQQTQGQVSSLQNDLL---ALRNQYERDQMLLEQYDQRV 429

Query: 784  KRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
            ++L +E   +  + ++++  K+ ++  L+ +++   N   +L    +Q  Q+  Q  QK+
Sbjct: 430  QQLENEITAINTNATQQLTNKDEQLGTLQEQLQIWKNKYESLAKLYSQLRQEHLQLLQKF 489

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
              +++  S  ++  +K+E     LK    KN++  D +    +A+ +           D+
Sbjct: 490  KKLQQTASSAQEAIDKREKLERDLK---AKNIELADLIRERDRARLDGDR-----LKGDK 541

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
            D+K   LE +  ++   +E +  T   N
Sbjct: 542  DRKIDDLELQLRELTRRLEDQESTHSEN 569

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 44/254 (17%), Positives = 106/254 (41%), Gaps = 8/254 (3%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV- 645
            + E ++ + +++SL      +KK   E  L   +   +KV    ++    +++ E  +  
Sbjct: 240  RQESDKLRKSVESL---RDFQKKK-GEIELHSRLLPYVKVKDHKEKLNVYKEEYERAKAN 295

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
            L++ +K+ +     K ++ +  ++L E+ +  N    D+ K +E+   +  +   ++DD 
Sbjct: 296  LRAILKDKKPFAHTKKTLENRVEELTEKCSMKN---HDFLKAKEKVNEIFEKLNTIRDDV 352

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV---K 996
             KK  Q EY   + K        +  N+ + K    + ++   Q Y+        +   +
Sbjct: 353  IKKKSQNEYYRGRTK-------KLQANIISTKEDLLRNQEILGQTYLPENSVFEDIDITR 405

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDH----LERSLQAQTNAQNSFSAVTVQDEDQKDAHL 1164
            ++   KE     L   +D     I+H    ++R  + +T +  +   + + ++DQ    +
Sbjct: 406  KDIISKEGGIRDLISEIDAKANAINHEMRGIQRQAEGKTKSLTTTDKIGILNQDQDLKEV 465

Query: 1165 EDRYHKVKEFMEQK 1206
             D    ++   E K
Sbjct: 466  RDAVWMIRNDAEMK 479

>YNL091W Chr14 (452408..456130) [3723 bp, 1240 aa] {ON}  NST1Protein
            of unknown function, mediates sensitivity to salt stress;
            interacts physically with the splicing factor Msl1p and
            also displays genetic interaction with MSL1
          Length = 1240

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 47/222 (21%), Positives = 96/222 (43%), Gaps = 2/222 (0%)
 Frame = +1

Query: 571  DHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
            D +L   +    + D  +  +E +   S + E + +E+ +  I     +LL+ +     +
Sbjct: 557  DDILDGDEDEPEEEDENEGDDEEDTYDSGLDETDRLEEGRKLIQIAITKLLQSR-----I 611

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
               Y++ Q    RL    Q+L+++  KK ++KE + QK + + K    +    K ++ + 
Sbjct: 612  MASYHEKQADNNRL-KLLQELEEEKRKK-REKEEKKQKKREKEKEKKRLQQLAKEEEKRK 669

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQ 1110
             ++EK+  +K   +E+     ++   KK +E  R         KK +  +R L+ Q   +
Sbjct: 670  REEEKERLKK--ELEEREMRRREAQRKKVEEAKR---------KKDEERKRRLEEQQRRE 718

Query: 1111 NSFSAVTVQDEDQKDAHLED--RYHKVKEFMEQKLQTSKNND 1230
                    Q E+ K    E+  R  + K   ++KLQ  K  +
Sbjct: 719  EMQEKQRKQKEELKRKREEEKKRIREQKRLEQEKLQKEKEEE 760

>Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON}
            (32401..36405) [4005 nt, 1335 aa]
          Length = 1334

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 45/175 (25%), Positives = 85/175 (48%), Gaps = 2/175 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI--KEIEEVEDNKI 693
            ++ E+K   ++  +     LL+V K+ +R    + K EE E LK     +E+E  E  + 
Sbjct: 718  KEKEEKKQRKREKEKEKKRLLQVAKEEER----KKKEEEAERLKKEAEEREMERRETQRK 773

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
             + + +++  EEK      +R   + QER +++  E +  +D+   + KQKE E +K K+
Sbjct: 774  KVEAAKKKKDEEKKRKLEEQRKREEEQERQRKIKEEQKRKKDE---ERKQKELEKKK-KD 829

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK 1038
            E K         +  + +  +KE++  QK +  +K +     E  + E+E  RLK
Sbjct: 830  EEK---------RIQEEEKRKKEEEAEQKTLNEKKRLDVEIMEQKRLEEEEKRLK 875

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 53/301 (17%), Positives = 125/301 (41%), Gaps = 26/301 (8%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITHETNRKAEC---------ERSKNAIDSLYYHEQLEKKDLNEKSLQ 561
            SD +    T    +T+ +N+ +           ++SK  ++     +      L   +L+
Sbjct: 565  SDASAKLSTATTELTNLSNQMSSLTNQASINNEKKSKTEMELKRVTDMKNSMQLKLTTLR 624

Query: 562  MAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTAN 741
               D  +K  +  Q  ++  +  E T +    +      +++++ +N L  Q  E +  N
Sbjct: 625  QTNDKTIKDIENTQLSINTINN-ENTNLQTQLVTLENTNKESELKLNELTAQFNESQKLN 683

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADK 921
            + L+     +      L ++ ++L+  Y K+    +   ++L+ +   +  +NT L    
Sbjct: 684  DELKEKMTTINTTTNDLENKIEELKSVYQKEKSMTDVNSKQLELKEINVETLNTEL---- 739

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF---VVDKNMKKIDHLERSLQ 1092
            +   +K   Y +K   ++ Y + V+Q++ + E    +L      +++   ++D   +++ 
Sbjct: 740  SDLQEKIDIYLKKQKELDDYKTQVEQQHAQLESTYQQLATKTNELNERQNELDLQNKNIV 799

Query: 1093 AQTNA--QNSFSAVTVQDE--------DQKDAHLEDRY----HKVKEFMEQKLQTSKNND 1230
             Q N   QN     ++ DE        DQ +A L  ++     +V++  E+K+Q S    
Sbjct: 800  EQENVYKQNVERLDSMFDELKKRKESFDQSNAELHQQHIDYAQRVQDLSEKKMQLSMGEL 859

Query: 1231 P 1233
            P
Sbjct: 860  P 860

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 56/276 (20%), Positives = 115/276 (41%), Gaps = 52/276 (18%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSL------QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS--FIKEI 669
            Y ++LEK     K L      ++ ++  L  TK+ + ++    +   +E++ +   IK I
Sbjct: 433  YDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQEMIKNI 492

Query: 670  EEVEDNKIS-INSLEQQLLEE----KTANNILRRDYYK-LQERGKRLCHEFQDLQD---- 819
            E+ +DN    +N+ E+ + +     +T NN  + DY K ++E  ++L  E   L++    
Sbjct: 493  EKKKDNAEKLVNTTEKSITQTNNKLETLNN-QQEDYTKQIEELNEKLKIEKSKLEEIKIS 551

Query: 820  --------------------DYSKKMKQKEYEVQKLKNEVKFLTNMNTNL---------- 909
                                 Y  ++++K  ++Q L++E+  L     NL          
Sbjct: 552  LKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEIISIKKL 611

Query: 910  ----KADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
                K    + S+K   + Q+ +   K +     E+NK   +   ++  +D + +K +  
Sbjct: 612  IEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDS 671

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKV 1185
              SL   +N QN  S +T   + QK   +   Y ++
Sbjct: 672  RTSL---SNVQNKNSVLTALFKLQKSGRISGFYGRL 704

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 59/245 (24%), Positives = 106/245 (43%), Gaps = 6/245 (2%)
 Frame = +1

Query: 535  KDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV--LKSFIKEIEEVEDNKISINSL 708
            K++N++ L M     +  T+ N  +     +  E E+  L S +KE +E+ D + S N+ 
Sbjct: 886  KEMNQEILHMK--EQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQE-SNNND 942

Query: 709  EQQLLEEKTANNILRRDYYKLQERGKRLCHEF----QDLQDDYSKKMKQKEYEVQKLKNE 876
            E ++ ++K     L+++YY L ++ K    E     Q + D    ++K +  +V  L N+
Sbjct: 943  EIKVADDKL--QALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQ 1000

Query: 877  VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN 1056
            +K +   N+  K DK+               I+K  + +K    K ++E N  K      
Sbjct: 1001 LKIV---NSKQKNDKSA--------------IKKNNNILK----KLQNELNTTK------ 1033

Query: 1057 MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS 1236
                   + SL+ +TN +NS   VT+  E+   A LE   +  +   E+ L     N   
Sbjct: 1034 -------DNSLEFKTNLENSKKKVTLLSEEL--AKLESDINDTQNAKEEILLNIDGNKEK 1084

Query: 1237 CSEAE 1251
              E E
Sbjct: 1085 AQELE 1089

>NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa] {ON}
            Anc_5.267
          Length = 1876

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 62/281 (22%), Positives = 120/281 (42%), Gaps = 25/281 (8%)
 Frame = +1

Query: 517  HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE----TEVLKSFIKEIEEVED 684
            H+  EKKDL  K L+     L   +  +Q +     KL+E    T       +E+E V D
Sbjct: 1205 HQIEEKKDLIAK-LRFTETRLASSSFDSQMRRAQLKKLKEIVEKTNPSLDLARELENVTD 1263

Query: 685  NKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQ------DDYSKKMKQK 846
              +++  L  ++   K    +  + +Y  +     L  +F  +Q      D +  K +  
Sbjct: 1264 EGVNVEKLILEVEYLKRQLELETKAHYDAENVASALHEKFTRIQRVDSSSDIFKLKYEAS 1323

Query: 847  EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI--YIEKYMSHVKQEYNKKED 1020
            E  V+ L+ ++K     +T LK D+T     +   +++ I  Y E    H  + Y  +E+
Sbjct: 1324 EERVKGLEQKLK-----STPLK-DRTNIPVGDIFKNRESISKYEEDVKFHKLENYKLQEN 1377

Query: 1021 --ECN----RLKFVVDKN-------MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
              +C+    RLK  + ++       ++++DHL+  LQ+  + ++ ++    Q ++Q    
Sbjct: 1378 LVDCHNTISRLKHDIIQHGNKERLLIEQLDHLQTELQSSEHQKDLYATTMKQQKEQYQNC 1437

Query: 1162 LEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIEN 1284
            LED      +  E  L   +  D        + ++ G+IEN
Sbjct: 1438 LEDLETNENQLSEYSLALKQAED-------NIQSMSGIIEN 1471

 Score = 34.3 bits (77), Expect = 0.93
 Identities = 58/298 (19%), Positives = 130/298 (43%), Gaps = 18/298 (6%)
 Frame = +1

Query: 475  ECERSKN--AIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            E E+SK+  A    +    LEKK   E  L  +++  L+  K+N   +    +  E E  
Sbjct: 919  ELEKSKDLSAEKEKFIGTLLEKKSALEDKL-CSLETDLENKKENYSNIVAAKQKAEQE-- 975

Query: 649  KSFIKEIEEVEDNKISINSLEQQL------LEEKTANNILRRDYYKLQERGKRLCHEFQD 810
             + +K+ E++  N+  I +L+++L      L+ K A   L ++ +  + R + L  E  D
Sbjct: 976  SNDLKQREQL--NQEEIRALKKKLEMSGEGLDIKLAT--LEKNCHAAKTRLESLVGENGD 1031

Query: 811  LQDDYSKKMKQ----------KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQK 960
            L++  +   K+          KE E+ +L++++        ++   + +   ++     +
Sbjct: 1032 LRNKLTLSRKESKNLGNQLNLKEAEISRLRSKMDQHQKEIISVSNQRDELINEQNNAVSE 1091

Query: 961  YIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD 1140
                +K +S +K EY K E+E   LK     + ++  +L++  Q  T+   +     + +
Sbjct: 1092 LNRTKKELSSIKLEYQKLEEEMKILK----SHSEETQNLQKGQQEDTSRVRNLEK-RLSE 1146

Query: 1141 EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSK 1314
            E   + +L     K+   +++++  S   +   SE  + D ++    +    L+  +K
Sbjct: 1147 EISLNEYLS---RKLSSNLQEEMHPSLKGNIFFSEDVSKDQLIAYFNDMKLKLDDATK 1201

>NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1890

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 47/217 (21%), Positives = 95/217 (43%), Gaps = 3/217 (1%)
 Frame = +1

Query: 664  EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            +I + +     INSLEQ++   +   NI +    +  E   +   E + + +   +K+K+
Sbjct: 832  DISKTKTFNDKINSLEQKIEAVEIERNITK----ETNELVNKELKELRSILETEKEKLKE 887

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDE 1023
            KE  +   K + + L     +    K    +++ +   +Y  I + + + K E  +KE  
Sbjct: 888  KELVLLSTKEKTELLEKQLVDAVKLKDAIEEEKWKLKDEYEAIVEDIKNSKVESQEKESS 947

Query: 1024 CNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQ 1203
              +L+        +++ L+  L +Q  A+ +        E +  A L+++ +K++E   Q
Sbjct: 948  LKQLEEKYQTLQIEVNTLQEKLTSQKEAREALLHAKYLQEKEL-AQLKEK-NKLQELEIQ 1005

Query: 1204 KLQTSKNNDPSCSEAEALDNVLGLIE---NTMKTLEG 1305
            KLQ   N+       E LD  +  +E   N+ KT  G
Sbjct: 1006 KLQNDVNH-----SGEDLDLKIASLEKSCNSAKTRLG 1037

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 63/268 (23%), Positives = 107/268 (39%), Gaps = 54/268 (20%)
 Frame = +1

Query: 451  THETNRKAECERSKNAIDSLYYHEQL-------EKK-------DLNEKSLQMAIDHLLKV 588
            + E   K +  R K  ++S+ Y + L       +KK       DL+E   Q+  +     
Sbjct: 1411 SREELHKEQIVRLKKNLESIEYQKGLLLTTIDQQKKRFDECVQDLHENETQL--NEYKLA 1468

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIE------EVEDNKISINSLEQQLLEEKTA---N 741
             KQ +  V+    +   E LKS  K+ +      E E N++ +  L++ LLE K     N
Sbjct: 1469 LKQAESDVNSMSSI--IEKLKSQNKQKDKTIWERETEKNELDMQ-LQESLLELKRIQDLN 1525

Query: 742  NILRRDYYKLQER------GKRLCHEFQDLQDDYSKKMK--------------------- 840
            N+L  D   L+ER            E + L+ D ++ M                      
Sbjct: 1526 NLLNADLAHLKERLTSTQDTSYYTDEIERLKSDIAESMNTETSLKKEVATLKYKLDSTSN 1585

Query: 841  QKEYEVQKLKNEVKFLTNMNTNL--KADKTQFSQKE--KQYSQKYIYIEKYMSHVKQEYN 1008
            + E +V +L  +V   +N+   L  + D +Q S  E  K+Y +    +    S V+   N
Sbjct: 1586 ESESKVSELLKQVAHYSNLVGILSNERDVSQASHAELSKRYEELIAKVNSLTSTVESLSN 1645

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
            +K +  +RL+ +     K  D   +SLQ
Sbjct: 1646 EKSNLASRLEELKSAMGKTTDDFSKSLQ 1673

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 50/232 (21%), Positives = 98/232 (42%), Gaps = 27/232 (11%)
 Frame = +1

Query: 409  SDLAQTFETL--AVGITHETNRKAECERSKNAIDSLYYHEQLE-------KKDLNEKSLQ 561
            S+LA   E L  A+G T +   K+  E+ K + +  Y  E L        +  L  K LQ
Sbjct: 1648 SNLASRLEELKSAMGKTTDDFSKSLQEKDKISSNVAYLQETLAFQQEQNARNGLLVKQLQ 1707

Query: 562  MAIDHL-----------LKVTKQNQRQVDGRDKLEET-EVLKSFIKEIEEVEDNKISINS 705
             ++D L           +++ ++NQ  +    +L+E    ++S + +  E +   I I+ 
Sbjct: 1708 ESVDTLKNALNQEKEKNIELYQENQTLIKMDSQLKEKLNSMQSQLSDSSEKDAWLIKIHE 1767

Query: 706  LEQQLLEEKTANNILRRDYYKLQ------ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKL 867
            LE+ + +E   +++   +  K+Q      E  K+  +   ++ D  +K  K+ E E+QK 
Sbjct: 1768 LEELVNKE---SSLKYEELKKVQTMDRVIEDLKKKNNRQSEVIDIANKDRKEFEEEIQKH 1824

Query: 868  KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDE 1023
               +  L         D  +  +    Y  + + +EK +S  K ++     E
Sbjct: 1825 TGHIIELERHIDKQDVDLKKIVRDNAYYQDRVMELEKEISFWKDQFQSLNAE 1876

>Ecym_3189 Chr3 complement(364109..366115) [2007 bp, 668 aa] {ON}
            similar to Ashbya gossypii AAL069C
          Length = 668

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 48/213 (22%), Positives = 95/213 (44%), Gaps = 17/213 (7%)
 Frame = +1

Query: 451  THETNRKAECERSKNAIDSLYYHEQLEKKDLNE---------KSLQMAIDHLLKVTKQNQ 603
            +H   ++ +     NA+D + +  +   + LNE         K +Q   D L ++T++  
Sbjct: 446  SHILEKRMDETEKLNALDGVIFEAENAYRALNEDKTPLTDSEKRVQRTQDELQRLTEKFD 505

Query: 604  RQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL--LEEKTA-----NNILRRDY 762
                 +++LEE     S   +IEE    K  +NSL+ QL  L E+ A     N+ LR DY
Sbjct: 506  MLNARKNELEELLSSNSLDSKIEE---KKAKLNSLQSQLKPLYEENARRTNRNDALRMDY 562

Query: 763  YKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE 942
             K       L    + L++       +KE   ++LK        M  +   ++++  ++ 
Sbjct: 563  QKKSSEAANLSMILKTLRE-------RKETLAKELKGPA--TQWMALSATQEESRLHEEL 613

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKE-DECNRLK 1038
             Q  Q+  ++ +Y+  +K +Y   + +E +R++
Sbjct: 614  TQLKQQRQFLSRYVEKMKTQYEITDLEEISRIQ 646

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
            Anc_8.604 YOR195W
          Length = 756

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 62/330 (18%), Positives = 127/330 (38%)
 Frame = +1

Query: 394  SISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID 573
            S S+   + +  E+L   +    N   E       ++S     + EKK++ E+ L+    
Sbjct: 353  SQSTTDFMKKEIESLQKSLEDSANILEELSEHSKELESKLSTVEQEKKNMEEEKLK---- 408

Query: 574  HLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILR 753
             LLK  K    Q+ G+D   E   L+  IK++   E N     SL  Q+        +L 
Sbjct: 409  -LLKENKHVMNQLSGKDN--EIVSLEGKIKDLVNSERNHSK--SLIDQIA-------VLT 456

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS 933
             +   L+E+ K+  ++FQ    +    +K+KE       +E+   T    + K D T+  
Sbjct: 457  NEKMSLEEQVKKSENQFQSEISELQDTLKEKE-------SELLDTTRALNDAKEDNTKLI 509

Query: 934  QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQN 1113
             +    +++   ++K         + +  E   L   ++   +   HLE ++        
Sbjct: 510  NEMMDRTKEVQSLKKTYEEANDHASVRTAEVTELNNQIETLKESQRHLETTIDLLQEKIG 569

Query: 1114 SFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMK 1293
            ++ +   +D+ +K+  L      +   ++ +  +S  + P+ +E          +    K
Sbjct: 570  TWKS-KYEDQIEKERELNLEIETLNARVKDEEHSSTGDAPNSAE----------LHQMRK 618

Query: 1294 TLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
              E   K  S + K+       +S+   NE
Sbjct: 619  EKEELQKKLSDSVKRIELMTAETSKTSPNE 648

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 58/280 (20%), Positives = 121/280 (43%), Gaps = 28/280 (10%)
 Frame = +1

Query: 538  DLNEKSLQMAI-DHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKI----SIN 702
            +LNE   Q+A  D   K+ +     V+   K+   EV +   ++I+++ ++ +    +I 
Sbjct: 571  ELNELKKQIASKDDEFKIWQSKYENVEDEAKIRNAEVTE-LNRDIDDLRESNLHLQETIT 629

Query: 703  SLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
             LE ++ + +   ++ + ++ K     + L  +  ++Q ++ K+++     +  L+NE+K
Sbjct: 630  ELENKVHDLENEYDLEKENFEKTSLELESLQLKNSNIQAEHIKELENLHENLMSLQNELK 689

Query: 883  F-------LTNMNTNLKA------DKTQFSQKEKQYSQKYI-YIEKYMSHVKQEYNKKED 1020
            F       LT  N  LK       +    S  +K    + I  + K +   K++Y  KE 
Sbjct: 690  FSSDRIATLTKENEILKEQNNSNNNSVTLSNNQKDKDDEQIKLLRKQLQDWKEKYEAKEK 749

Query: 1021 ECN-RLKFVVD--------KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
            + N RLK + +        K+ +K+  L++    +   Q+ F  + +++           
Sbjct: 750  DTNKRLKLLAEDLYIQYSSKHEQKVKLLKKGY--ENKFQSKFDQLNLEN----------- 796

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMK 1293
                K   E+  Q  K  D   SE +   ++L L+EN  K
Sbjct: 797  ----KSLSEEIEQLKKQLD---SERKEKQDLLKLLENEKK 829

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 47/278 (16%), Positives = 115/278 (41%), Gaps = 1/278 (0%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            D ++ +E  D T    N  +NR   L     + ++ +  ++     +   + + H+ N +
Sbjct: 262  DNDKEYEENDIT----NSHINRLTPLYETSVRDLNYNE-NERNHCGDDSKLDVRHD-NFQ 315

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNE-KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
                R++   D +Y+  Q     +++ +S+    +   K+ K +Q+ +D  +  E+ E L
Sbjct: 316  IVARRNEELTDQIYHLNQKVNTLISQNESISFQYE---KLNKNHQQLIDSSN--EKVEKL 370

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
             +      E E+N   +   ++++ E  T   +L  +   LQE+      +  +L+ ++ 
Sbjct: 371  ST------ERENNISKVEKFKKRIKELNTEIKVLNSNQKILQEKYDDSITDLNNLRSEHE 424

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
              +       + L  +   L N+   L+ +  + S+ +   ++        ++    E N
Sbjct: 425  NTVNTLHINEKNLNEKNVELENVKEELRTNVDKLSEYQAMVNE--------LNSCITELN 476

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS 1122
             K +  N    V+     ++D+L+ SL+   +    F+
Sbjct: 477  DKIESTN---IVLKSKETELDNLKLSLKETLSISKDFN 511

>TDEL0F03070 Chr6 (559392..562025) [2634 bp, 877 aa] {ON} Anc_3.425
            YGR089W
          Length = 877

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 44/202 (21%), Positives = 88/202 (43%), Gaps = 2/202 (0%)
 Frame = +1

Query: 532  KKDLNEK--SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS 705
            KK++++K  +L+  IDH      QN    +      + E LK+ +++ E+      ++  
Sbjct: 683  KKEISKKLNALRQEIDHYKSKISQNAS--NDEKSASKVESLKTAVQQSEK------TLAK 734

Query: 706  LEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKF 885
            LEQ L +      +L  +Y K ++   R   E+  L+D    ++   + + QKL+ ++  
Sbjct: 735  LEQHLKQTSDKEALLEEEYLKQKDAHLRKQMEYSKLEDLLKTELNTAKSKSQKLQQDLNQ 794

Query: 886  LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKK 1065
            L      L A K +  QKE   + +   + K     K+E ++ +   NR +   +  M  
Sbjct: 795  LNAKKEKLSA-KQERLQKEVDQTTEAFELFKSQFVAKREKDRAKRFENRAREANEFEM-N 852

Query: 1066 IDHLERSLQAQTNAQNSFSAVT 1131
            I+ LE+ +        +   +T
Sbjct: 853  INGLEQDISRLEGENGNIQKIT 874

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = +1

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN-------KKEDECNRLKFVVDKN 1056
            NTNL   + +  + +K+ S+K   + + + H K + +       K   +   LK  V ++
Sbjct: 669  NTNLAEGRVKLKKSKKEISKKLNALRQEIDHYKSKISQNASNDEKSASKVESLKTAVQQS 728

Query: 1057 MKKIDHLERSLQAQTNAQNSFSAVTVQDE--DQKDAHLEDR--YHKVKEFMEQKLQTSKN 1224
             K +  LE+ L+     Q S     +++E   QKDAHL  +  Y K+++ ++ +L T+K+
Sbjct: 729  EKTLAKLEQHLK-----QTSDKEALLEEEYLKQKDAHLRKQMEYSKLEDLLKTELNTAKS 783

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
            to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
            Protein that functions in a complex with Kel1p to
            negatively regulate mitotic exit interacts with Tem1p and
            Lte1p localizes to regions of polarized growth potential
            Cdc28p substrate AND similar to YHR158C uniprot|P38853
            Saccharomyces cerevisiae YHR158C KEL1 Protein required
            for proper cell fusion and cell morphology functions in a
            complex with Kel2p to negatively regulate mitotic exit
            interacts with Tem1p and Lte1p localizes to regions of
            polarized growth potential Cdc28p substrate
          Length = 905

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 54/254 (21%), Positives = 108/254 (42%), Gaps = 12/254 (4%)
 Frame = +1

Query: 655  FIKEIEEVEDNKISINSLEQ--QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            F K I+ + D   S  +L +  +++ EK  NNIL+    +L E  K+L  +        +
Sbjct: 597  FDKSIDVITDADKSPVTLSEPARIVSEKNENNILK----ELLEELKQLKEDTVTSATSAN 652

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS--QKEKQYSQKYIYIEKYMSHVKQE 1002
             ++ + E E  +LK ++  L+++N  +K      +  Q E    +KY+ +E     + ++
Sbjct: 653  SRIMELELENTELK-QLNQLSHLNDMIKHQTEVIAKLQSEVDNKEKYVDLESKYIVLSEK 711

Query: 1003 YNKKEDECNRLKFVVDKNMKKI-DHLERSLQAQTNAQNSFSAVTVQDEDQK---DAHLED 1170
            Y     E +  K  +++N+KK  + L+  L      Q +   V  + ++     D  L +
Sbjct: 712  YESLTKELDSKKQFINENIKKCSESLDTLLDGMRQKQKAHETVVTRHKETMTGLDRKLSE 771

Query: 1171 RYHKVKEFMEQKLQT----SKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
               + KE    + Q     SK  D   S+ E L  +     + + ++  +         +
Sbjct: 772  VILQNKELTTSRDQLFTEYSKLKDEHASKHEELTKMEREYRSVIDSVHNSGNAMEKLQNE 831

Query: 1339 CLKYVTGSSRLKEN 1380
             +K    +SRLK +
Sbjct: 832  IIKLRQENSRLKSD 845

>Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {ON}
            YLR309C (REAL)
          Length = 910

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 56/294 (19%), Positives = 128/294 (43%), Gaps = 8/294 (2%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV-LKSF 657
            E+ +N  D    +E++E +  N K    +     ++ K  +       +L +T+  LK  
Sbjct: 336  EKHENCEDWRLKYEEMEAELKNTKESGAS-----QLAKSAEELKTLNTELSDTKKSLKEK 390

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
              E+EEV D    + ++  +L++ K     ++    K  E  K +  E  +L+   +  +
Sbjct: 391  NSELEEVRD---MLRTVGNELVDAKDE---IKGFSSKQTEEAKAVKLELDNLRHKNATMV 444

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
            +  E +  +LKN +  L     +LKA   +  +++     K + + + +S +  E +   
Sbjct: 445  EAHEIKNAELKNRLDSLNKKVEHLKALSVEKEKEQTTLKNKVVKLNEEISQLTAEKSSTT 504

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVK--- 1188
             E N L+    +  K + +LE  ++ Q + Q   +    +   ++ A++ +R   +K   
Sbjct: 505  KELNSLRTSYKQKEKTVGYLEEQVK-QFSEQKDAAEKFTEQLKKEHANMSNRLDLLKREN 563

Query: 1189 EFMEQKLQTSKNN-DPSCSEAEALDNVLGLIE---NTMKTLEGNSKYYSTTTKK 1338
            E +   +  + N+ +    E   L   L +++   NT++ ++ NS  +  + K+
Sbjct: 564  ESLHSDIAKNGNSYEAYLKENGKLSERLNILQEKYNTLQNVKSNSNEHIDSIKR 617

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 57/240 (23%), Positives = 98/240 (40%), Gaps = 24/240 (10%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEE--VEDNKIS 696
            +LE  +L  K+  M   H +K  +   R      K+E  + L S  KE E+  +++  + 
Sbjct: 430  KLELDNLRHKNATMVEAHEIKNAELKNRLDSLNKKVEHLKAL-SVEKEKEQTTLKNKVVK 488

Query: 697  INSLEQQLLEEKTAN----NILRRDYYKLQERGKRL---CHEFQDLQDDYSKKMKQKEYE 855
            +N    QL  EK++     N LR  Y + ++    L     +F + +D   K  +Q + E
Sbjct: 489  LNEEISQLTAEKSSTTKELNSLRTSYKQKEKTVGYLEEQVKQFSEQKDAAEKFTEQLKKE 548

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY--------IYIEKY--MSHVKQEY 1005
               + N +  L   N +L +D  +     + Y ++         I  EKY  + +VK   
Sbjct: 549  HANMSNRLDLLKRENESLHSDIAKNGNSYEAYLKENGKLSERLNILQEKYNTLQNVKSNS 608

Query: 1006 NKKED----ECNRLKFVVDKNMKKIDHLERSLQAQTN-AQNSFSAVTVQDEDQKDAHLED 1170
            N+  D    +C  L   + ++ KKI  LE  L    N  Q+             D+H +D
Sbjct: 609  NEHIDSIKRQCEELNIKLKESTKKILSLEDELNEYANIVQDKTREANTLRRLVSDSHADD 668

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 77/372 (20%), Positives = 151/372 (40%), Gaps = 32/372 (8%)
 Frame = +1

Query: 295  YERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKA 474
            YE+++      +K       +  A+  I  ++  IS+I D   T       + ++ N  +
Sbjct: 54   YEQKYPLLLSAYKNEKLKSEKFDAVEKILAENTPISNIDDAVDTLPAFFQDLNNKNNLLS 113

Query: 475  E------------------CERSKNAIDSLYYHEQLEKKDLN--EKSLQMAIDHLLKVTK 594
            +                  CE  K   +     EQ  K D++  EK ++     L  + K
Sbjct: 114  DEIKRLTKENSDAAPETVTCETLKVTEERFLKKEQEYKDDIDGLEKKIEALNSELTSLHK 173

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDY-YKL 771
                   G    E+   L++ +KE +E E  ++ I+  +  L EE  ANN+   DY  K+
Sbjct: 174  DKNDTTSGLR--EKITALENMLKEEKETEKQEVEISLAK--LKEELIANNLTLEDYKTKV 229

Query: 772  QERGKRLCHEFQDLQDDYSKK------MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS 933
             +  + L      +++  SK       +K+KE ++ +L+ ++K         +A KT  S
Sbjct: 230  TKLEQELVSNNTIVEEKSSKLAELDVILKEKEQKLSELEKKLK---------EAPKTVIS 280

Query: 934  QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD--KNMKKIDHLERSLQAQTNA 1107
                         +   ++ ++  N+ + + N+    VD     +  D+L  + + +   
Sbjct: 281  N------------QNVGNNNRRRKNRNKSKKNKGNATVDDLNEEESFDNLINTAEYEKLK 328

Query: 1108 QNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS--CSEAEALDNVLGLIE 1281
            ++      +Q   +K  + ED   K +E ME +L+ +K +  S     AE L  +   + 
Sbjct: 329  ED------LQVLQEKHENCEDWRLKYEE-MEAELKNTKESGASQLAKSAEELKTLNTELS 381

Query: 1282 NTMKTL-EGNSK 1314
            +T K+L E NS+
Sbjct: 382  DTKKSLKEKNSE 393

>ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weakly
            similar to uniprot|Q07732 Saccharomyces cerevisiae
            YDL239C ADY3 Protein required for spore wall formation
            thought to mediate assembly of a Don1p- containing
            structure at the leading edge of the prospore membrane
            via interaction with spindle pole body components
            potentially phosphorylated by Cdc28p
          Length = 928

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 61/300 (20%), Positives = 118/300 (39%), Gaps = 16/300 (5%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL-EETEVLKSFIKE 666
            K++ ++   +EQ    D+  +S  + ++   +   QN       D L +ET  L      
Sbjct: 139  KSSANNANPNEQQNLSDVVGQSTPLTLEKNRRPATQNSDDAKDYDGLVKETHWLH----- 193

Query: 667  IEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK---M 837
             EE+   K  +   E Q +E+            K+ E G+ L ++   LQ++  +K   +
Sbjct: 194  -EEIAQLKDQLLRSESQKVEKDA----------KIVELGESLQNKSSSLQNNLREKENSI 242

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
               + E++KLK +       N +    K Q  Q+ ++ SQ+ I  E  +SH + + +  E
Sbjct: 243  STLQDEIKKLKEQWAIGNKRNESEMDKKLQLIQEMERRSQEAIQ-ELKLSHQRDQDSLNE 301

Query: 1018 D------------ECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH 1161
                         E  + K + D +  + ++  ++ + Q   +     + V DE  +   
Sbjct: 302  KLKKLDTNWHENLENEKQKLIADIDSLEAEYDNKTTEFQNTIKEKIQQLEVSDEALRK-- 359

Query: 1162 LEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKC 1341
                  K +E    +    K ND   ++ E L+ V   +++    L G SK       KC
Sbjct: 360  ------KTQELDSLRNDMCKKNDELANKLEELEEVRKNLKDKDSELAGKSKELQELQSKC 413

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 47/241 (19%), Positives = 113/241 (46%), Gaps = 14/241 (5%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-RDKLEETEVLKSFIKEIEEVEDNKIS 696
            E++++ ++++++L+     L  +     ++ D   +KLEE E ++  +K+    +D++++
Sbjct: 345  EKIQQLEVSDEALRKKTQELDSLRNDMCKKNDELANKLEELEEVRKNLKD----KDSELA 400

Query: 697  INSLEQQLLEEKTA-------NNILRRDYY------KLQERGKRLCHEFQDLQDDYSKKM 837
              S E Q L+ K         N++  +D         L++R + + H+ + + +  S  +
Sbjct: 401  GKSKELQELQSKCEQRERNLQNDLKSKDERINVLSDLLKQRDQNISHKDERITE-LSDLL 459

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
            KQ++ ++     E +        LKA + +FS+K  ++S+K    +      K+  + K 
Sbjct: 460  KQRDQDISHKDEENRQKVR---ELKALEAKFSEKNDEFSRKSKDFDLLQESRKEVLSAKS 516

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
                +L+    +  K  D   R  +   N Q      +++DE ++  +L+D+  +V +F 
Sbjct: 517  QVEQQLRKSEIQTKKVEDRFHRQ-RMDYNEQIKQLQQSLEDEKKRHDNLKDKMKEVDQFA 575

Query: 1198 E 1200
            +
Sbjct: 576  Q 576

>KAFR0J01250 Chr10 complement(230562..234002) [3441 bp, 1146 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1146

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 43/227 (18%), Positives = 101/227 (44%), Gaps = 3/227 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLK---VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNK 690
            ++ E+ +   K +Q+AI  LL+   +   + RQ D              +K ++E+ED +
Sbjct: 501  DEAERLEEGRKLIQIAITKLLQSRIMDSYHARQADNNR-----------LKLLKELEDEQ 549

Query: 691  ISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLK 870
            +     +++ L++K      ++     +E  +R   E ++     ++K + +  E+Q+ K
Sbjct: 550  LKKKEKKEKKLKKKEKEKEKKKQQQLAKEEAQRRKAEEEERLRQENEKRELERRELQRQK 609

Query: 871  NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
             E           K  K +  +++ +  +K   +++    +K+E  +K++E  RLK    
Sbjct: 610  VE---------EAKRKKDEEKRRKLEEQRKREELQEKQRKIKEEQRRKKEEEKRLK-EEQ 659

Query: 1051 KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
            K +K+ + L+  +Q +   +         + D K+  L++   K K+
Sbjct: 660  KRIKEENRLQLEMQRKAEQEQ-------MERDTKEKELQEIETKQKQ 699

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 39/188 (20%), Positives = 78/188 (41%), Gaps = 33/188 (17%)
 Frame = +1

Query: 757  DYYKLQERGKRLCHEF-QDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFS 933
            DY   +E      H+F QD ++ Y  + +  E E  + ++EV    ++N N + +   F 
Sbjct: 428  DYEDYEEDDHHHHHQFYQDDENSYEDEDRDDEDEEDEAEDEVDE-DDINENDEVENGNFD 486

Query: 934  QKEKQYSQKY------------------IYIEKYM-SHVKQEYNKKEDECNRLKFVV--- 1047
            +  +   ++Y                  I I K + S +   Y+ ++ + NRLK +    
Sbjct: 487  ENNEHDDEEYESEIDEAERLEEGRKLIQIAITKLLQSRIMDSYHARQADNNRLKLLKELE 546

Query: 1048 DKNMKKIDHLERSLQA----------QTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
            D+ +KK +  E+ L+           Q  A+        ++E++     E R  + +E  
Sbjct: 547  DEQLKKKEKKEKKLKKKEKEKEKKKQQQLAKEEAQRRKAEEEERLRQENEKRELERRELQ 606

Query: 1198 EQKLQTSK 1221
             QK++ +K
Sbjct: 607  RQKVEEAK 614

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 65/289 (22%), Positives = 123/289 (42%), Gaps = 27/289 (9%)
 Frame = +1

Query: 526  LEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINS 705
            ++K +   K +++  D LL ++          +KL+E E   +  KEI+    NK+++ S
Sbjct: 680  IQKYNSAAKRMKVLEDELLVIS----------NKLKEQESASAKTKEIQ----NKLNLVS 725

Query: 706  ----LEQQLLEEKTANNILRR-------------DYYKLQERGKRLCHEFQDLQDDYSKK 834
                + Q+ L E  A  I++R             +  + Q    +L  E + +QDD  + 
Sbjct: 726  HKLSIFQRTLNENPATQIIKRNDDLTRQIRECEEEIEQKQSYMSQLQDEIRKIQDDMEEF 785

Query: 835  MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK 1014
               K  +++KLK E+  LT     L       S  +K+Y   Y  ++     +  E +  
Sbjct: 786  NNDKGTKLEKLKKEIDSLTKEIGKLD------SITDKKY-DLYQNLQLETEQLTSEISSD 838

Query: 1015 EDECNRLKFVVD--KNMKK-----IDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
            ED    +   +D  +N KK     ++H E +L A  +++       + D D++   L   
Sbjct: 839  EDALEHMNTSLDNFQNQKKSLIAELEHAEHTL-ADVHSEVDEEKKRLVDIDEELKELNGL 897

Query: 1174 YH---KVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
             H   + K  +E +LQ  KN+      + +     G+ ++  + LEG+S
Sbjct: 898  IHAKAEKKSSLELELQQLKNDITKFQNSTS-----GIEQSISQLLEGHS 941

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 49/214 (22%), Positives = 92/214 (42%), Gaps = 48/214 (22%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQ---------------RQVDGRD-KLEETEV 645
            Y +Q +   + E+ L+ A++ L+    QN                +++  +D ++E   +
Sbjct: 855  YEKQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDII 914

Query: 646  LKSFIKEIEEVEDNKISINSLE-----------------QQLLE---EKTANNILRRDYY 765
            LK+ +KEIE+     ++ +S+E                 Q +L+   E   N  + R   
Sbjct: 915  LKAKLKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMARTRK 974

Query: 766  KLQ-ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD----KTQF 930
            +L+ E  +RL  E + L D Y+ K+K  +   + LK + K+   + T LK +    K +F
Sbjct: 975  ELEKEYEERLSKESEKLSDQYNNKLKD-DLSEELLKIDKKYAMELETKLKNETDESKKEF 1033

Query: 931  SQ-------KEKQYSQKYIYIEKYMSHVKQEYNK 1011
                     K K  S+K  ++E  +  +K E  K
Sbjct: 1034 QDALGTEQTKNKILSKKIEFLETQIKELKDEQTK 1067

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 38/210 (18%), Positives = 89/210 (42%), Gaps = 6/210 (2%)
 Frame = +1

Query: 487  SKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV------L 648
            ++  IDS  +++      +NE + +  +   L   K   + ++ + KL+E ++       
Sbjct: 655  TRGTIDS--FNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKY 712

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS 828
            KS IK  ++  D   +   ++   L     +  + ++  ++ E  K++  + ++L +   
Sbjct: 713  KSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLD 772

Query: 829  KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
            +  + K+    KL NE K   N    L+ D     + + +  Q+ + +E     +++E  
Sbjct: 773  RFARLKKQAKDKL-NEFKGTEN---KLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIV 828

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQAQ 1098
            K +DE       +D N +  + L    + Q
Sbjct: 829  KMKDELMTSNNELDNNQRSQEELRNEYEKQ 858

>YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Subunit
            of MRX complex, with Mre11p and Xrs2p, involved in
            processing double-strand DNA breaks in vegetative cells,
            initiation of meiotic DSBs, telomere maintenance, and
            nonhomologous end joining
          Length = 1312

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 67/321 (20%), Positives = 127/321 (39%), Gaps = 21/321 (6%)
 Frame = +1

Query: 409  SDLAQTFETLAVGITHET--NRKAECERSKNAIDSLYYHEQLEKKDL--NEKSLQMAIDH 576
            +DL   F+ L + +      N K   E  +   ++LY    +EK DL  N+KS +  I  
Sbjct: 574  ADLEMDFQKLFINMQKNIAINNKKMHELDRRYTNALYNLNTIEK-DLQDNQKSKEKVIQL 632

Query: 577  LLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRR 756
            L +   ++    +  D LEETE+      E  ++    +  N    ++ E  +   +  R
Sbjct: 633  LSENLPEDCTIDEYNDVLEETELSYKTALENLKMHQTTLEFNRKALEIAERDSCCYLCSR 692

Query: 757  DYYKLQERGKRLCHEFQDLQDDYSKKMK-----QKEYEVQKLKNEVKFLTNMNTNLKADK 921
             +     + K L         ++ K +K     +KEY       E   +T  + N K D 
Sbjct: 693  KFENESFKSKLLQELKTKTDANFEKTLKDTVQNEKEYLHSLRLLEKHIITLNSINEKIDN 752

Query: 922  TQ-----FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL--KFV-VDKNMKKIDHL 1077
            +Q       ++ K    K   +E   + +K E    E E   L  KF  ++K +K +++ 
Sbjct: 753  SQKCLEKAKEETKTSKSKLDELEVDSTKLKDEKELAESEIRPLIEKFTYLEKELKDLENS 812

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT----SKNNDPSCSE 1245
             +++  + +  N     T +D  Q    L D+  K+ + + +  +T        D    E
Sbjct: 813  SKTISEELSIYN-----TSEDGIQTVDELRDQQRKMNDSLRELRKTISDLQMEKDEKVRE 867

Query: 1246 AEALDNVLGLIENTMKTLEGN 1308
               + N++   E T+  +E +
Sbjct: 868  NSRMINLIKEKELTVSEIESS 888

 Score = 34.7 bits (78), Expect = 0.69
 Identities = 65/305 (21%), Positives = 117/305 (38%), Gaps = 11/305 (3%)
 Frame = +1

Query: 421  QTFETLAVGITHETNRKA----ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKV 588
            Q F+ +   + +  N K     + +R  N+ID L         DL++  LQ  + +  KV
Sbjct: 262  QDFQKILSKVENLKNTKLSISDQVKRLSNSIDIL---------DLSKPDLQNLLANFSKV 312

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYK 768
                  Q            L+    +I  ++D + S+ SL   L+  +      +  Y K
Sbjct: 313  LMDKNNQ------------LRDLETDISSLKDRQSSLQSLSNSLIRRQGELEAGKETYEK 360

Query: 769  ----LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQ 936
                L    +   H+FQ L +  +  M Q  +E+ + K  +        +  A   Q  +
Sbjct: 361  NRNHLSSLKEAFQHKFQGLSNIENSDMAQVNHEMSQFKAFISQDLTDTIDQFAKDIQLKE 420

Query: 937  KEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNS 1116
                   K I ++        EYNKK+    R K + D      + L   L+       S
Sbjct: 421  TNLSDLIKSITVDSQ----NLEYNKKD----RSKLIHDS-----EELAEKLK-------S 460

Query: 1117 FSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT--SKNNDPSCSE-AEALDNVLGLIENT 1287
            F +++ QD       L      +K + E KLQ+  S+N  P  ++  E  +N + ++EN 
Sbjct: 461  FKSLSTQDS------LNHELENLKTYKE-KLQSWESENIIPKLNQKIEEKNNEMIILENQ 513

Query: 1288 MKTLE 1302
            ++  +
Sbjct: 514  IEKFQ 518

>NDAI0K01770 Chr11 (395335..396270) [936 bp, 311 aa] {ON} Anc_2.563
            YKL042W
          Length = 311

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 53/236 (22%), Positives = 104/236 (44%), Gaps = 25/236 (10%)
 Frame = +1

Query: 511  YYHEQLEKKDLNEKSL--------QMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKE 666
            Y +  + K+D+N   L          AID L++  +Q +R + GRD  EE E L+     
Sbjct: 27   YNYPNVTKEDINGDKLLPKEAKLSTRAIDELIEQNRQLRRDLLGRD--EENEKLRILNTS 84

Query: 667  IEEVEDNKISINSLEQQLLEEKT----ANNILRRDYYKLQERGKRLCHEFQ--------D 810
            +   ++  I    L + L +EKT     N+ LR+   +L+   K+L             D
Sbjct: 85   L---KNKLIKYTDLNKILQDEKTDLEFDNSNLRKRNDRLRTTIKKLSLSTNILADDADFD 141

Query: 811  LQDDYSKKMKQKE---YEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ--YSQKYIYIE 975
            +++D S +++ K+    ++ K K+      N+++ L  ++     K      ++K   + 
Sbjct: 142  VENDASAQLESKDDNCIQIPKRKH-----VNVSSTLSRNEDMHKSKNSSEILNEKLDKLI 196

Query: 976  KYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            +Y+S VK+E   K+   +     V  N++ I+  E+ L      Q S     ++++
Sbjct: 197  EYLSQVKKETGNKDTSSH---LAVQPNLEHINPTEKILTTDPVIQESLEIRELEEK 249

>SAKL0H25608g Chr8 complement(2243456..2244070) [615 bp, 204 aa] {ON}
            similar to uniprot|Q07843 Saccharomyces cerevisiae
            YLL033W
          Length = 204

 Score = 41.6 bits (96), Expect = 0.002
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 6/167 (3%)
 Frame = +1

Query: 712  QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
            + L+ E    ++++  Y +L  R K    + + +QD Y       EY   K K+E   L 
Sbjct: 32   ENLINEYPREDVIKITYRRLI-RLKPFVSQRKMVQDTYV------EYLRYKYKSEDYKLK 84

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID 1071
            +   N++ + T+ S  E Q +Q   +I K +SH++        + N L   + KN+  ++
Sbjct: 85   SSLCNIRIEHTEASDLE-QATQSLQFILKAVSHIESGSCPSAVD-NTLCRKILKNLLTME 142

Query: 1072 HLERSLQAQTNAQN------SFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
            + +++L  Q+   N      SF  +    +D++D H+  RY+ + E+
Sbjct: 143  YYKQTLIRQSPTSNYQLLRKSFGYLAPSKDDKRDNHINSRYNSMGEY 189

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 62/264 (23%), Positives = 109/264 (41%), Gaps = 34/264 (12%)
 Frame = +1

Query: 322  DTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAI 501
            D  K++ D   +   + N     IS++   DL Q +E L           A+C+     I
Sbjct: 1629 DLLKQL-DHYTKVVEMLNNEKDAISLAE-KDLYQKYEIL----------NAKCQSLTEKI 1676

Query: 502  DSLYYHEQLEKKDLNEKS--LQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK--SFIKEI 669
             SL   +Q  + DLN+K+  L+++   LLK T++N++  +    LEET  L+     +  
Sbjct: 1677 GSLTKTKQELEFDLNQKTDALEVSSAALLKSTQENKQISEKIKYLEETLKLQMEQNTRNG 1736

Query: 670  EEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS------- 828
            E V+  + S      +L +EK  N  L  +   LQ+    L    ++LQD  S       
Sbjct: 1737 ELVKKLQDSCGEFRGKLDQEKQKNIDLYEENQTLQKLNTDLQSHVENLQDRLSDTTEKNA 1796

Query: 829  -----------------------KKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
                                   KK K  E  V++L+ +    T++      ++++F + 
Sbjct: 1797 WLSKIHELECMVSFETNLKYEEMKKNKSLERAVEELQTKNSQQTDVIELSNKNRSEFEES 1856

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNK 1011
              +Y  +   +EKY+S  + E  K
Sbjct: 1857 ALRYEAQISELEKYISQQELEMKK 1880

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 62/276 (22%), Positives = 110/276 (39%), Gaps = 22/276 (7%)
 Frame = +1

Query: 625  KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEF 804
            +L  TEV KS   EIEE ++    +   E +L      N  ++    KL++    +    
Sbjct: 1237 QLAFTEVTKSLENEIEEKKNLISRLRFTETRLASSSFENQKIKAQIKKLKKLVLDIDPSI 1296

Query: 805  Q--DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
            Q   + D+ S     KE ++ KL  EV++L      L  +       E   S  +    K
Sbjct: 1297 QLNTILDEQSNNSSSKESDINKLMLEVEYL---KRQLDIETKAHYDAENAISALHSKFRK 1353

Query: 979  YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV--TVQDEDQK 1152
                ++ E +    E  +LKF  + + +++  LE  L+       +   V   +++ D  
Sbjct: 1354 ----IQAEGSMSSSEIYKLKF--EASEERVKSLEDKLKTMPLRDRTNLPVGDIIKNRDSI 1407

Query: 1153 DAHLED-RYHKVKEFMEQK---------------LQTSKNNDPSCSE-AEALDNVLGLIE 1281
              + E+ RY+K++ +  Q+               L+ SK+ D   SE  E L   L   E
Sbjct: 1408 SKYEEEIRYYKLENYKLQEILNESNGKMSQLTLDLRQSKSKDALLSEQLERLQKDLESTE 1467

Query: 1282 NTMKTLEGNSKYYSTTTKKCLKYVTGSS-RLKENEH 1386
               + L    K      + C+  + G+  RL+E+ H
Sbjct: 1468 RQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIH 1503

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 68/316 (21%), Positives = 132/316 (41%), Gaps = 28/316 (8%)
 Frame = +1

Query: 439  AVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG 618
            A+   H   RK + E S ++  S  Y  + E  +   KSL+   D L  +  +++  +  
Sbjct: 1343 AISALHSKFRKIQAEGSMSS--SEIYKLKFEASEERVKSLE---DKLKTMPLRDRTNLPV 1397

Query: 619  RDKLEETEVLKSFIKEIE--EVEDNKIS---------INSLEQQLLEEKTANNILRRDYY 765
             D ++  + +  + +EI   ++E+ K+          ++ L   L + K+ + +L     
Sbjct: 1398 GDIIKNRDSISKYEEEIRYYKLENYKLQEILNESNGKMSQLTLDLRQSKSKDALLSEQLE 1457

Query: 766  KLQ------ERGKRLC--------HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNT 903
            +LQ      ER K L          +F++  DD      +    +  LK   + + NM +
Sbjct: 1458 RLQKDLESTERQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIHALKQAEEDVKNMAS 1517

Query: 904  NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED--ECNRLKFVVDKNMKKIDHL 1077
             ++  KTQ  QKEK      +  E+ M     +   +E   E  R++ V       + HL
Sbjct: 1518 IIEKLKTQNKQKEK------LIWEREMERNDSDMQLQETLLELKRVQDVKKILSDDLAHL 1571

Query: 1078 ERSLQA-QTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEA 1254
            +  L A    +Q +     +++E      +E    K    ++ KL+TS N+    SEA  
Sbjct: 1572 KERLSAVDDRSQYTNEINRLKEELSCSLKVETNLKKDFATLKYKLETSNND----SEAR- 1626

Query: 1255 LDNVLGLIENTMKTLE 1302
            + ++L  +++  K +E
Sbjct: 1627 ISDLLKQLDHYTKVVE 1642

>SAKL0F05918g Chr6 (444390..446882) [2493 bp, 830 aa] {ON} similar to
            uniprot|P53253 Saccharomyces cerevisiae YGR089W NNF2
            Protein that exhibits physical and genetic interactions
            with Rpb8p which is a subunit of RNA polymerases I II and
            III computational analysis of large- scale
            protein-protein interaction data suggests a role in
            chromosome segregation
          Length = 830

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 45/210 (21%), Positives = 94/210 (44%), Gaps = 10/210 (4%)
 Frame = +1

Query: 382  TKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSL--YYHEQ------LEK- 534
            TK      +S L Q  + L V I        + E+S + +D+L    H+       LEK 
Sbjct: 635  TKKELSKKLSGLRQEIDHLKVKICQNA---VQDEKSSSKVDNLKTLLHQSESQIASLEKD 691

Query: 535  -KDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLE 711
             K LN + +QM  ++L K  K  Q+Q+       E   L++ + E  E+ +  + ++ L+
Sbjct: 692  LKSLNVQQVQMESNYLQKKDKHLQKQM-------EYSNLEASLNE--ELREYTVKLSKLQ 742

Query: 712  QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT 891
            Q+  +  +    +   + KLQ+   + C EF++ +  +  K ++   + ++L+  ++   
Sbjct: 743  QEFAQLTSKKEKMTVKHEKLQKEVDQYCQEFENFKTQFLVKREKDRQQREELR--IREAN 800

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEKY 981
            +    +K  +   S+ E +    +  I+ Y
Sbjct: 801  DYELKIKGLEQDISRLEGENGNMHKLIQGY 830

 Score = 35.8 bits (81), Expect = 0.29
 Identities = 34/149 (22%), Positives = 69/149 (46%), Gaps = 2/149 (1%)
 Frame = +1

Query: 898  NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQE--YNKKEDECNRLKFVVDKNMKKID 1071
            NTNL  ++ +  + +K+ S+K   + + + H+K +   N  +DE         K+  K+D
Sbjct: 622  NTNLAEERAKLKKTKKELSKKLSGLRQEIDHLKVKICQNAVQDE---------KSSSKVD 672

Query: 1072 HLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAE 1251
            +L ++L  Q+ +Q +     ++  + +   +E  Y + K+   QK     N + S +E  
Sbjct: 673  NL-KTLLHQSESQIASLEKDLKSLNVQQVQMESNYLQKKDKHLQKQMEYSNLEASLNEE- 730

Query: 1252 ALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
                   L E T+K  +   ++   T+KK
Sbjct: 731  -------LREYTVKLSKLQQEFAQLTSKK 752

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 49/271 (18%), Positives = 103/271 (38%), Gaps = 11/271 (4%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAID---SLYYHEQLEKKDLN 546
            +P+    I  ++ LA+  + L   +   T+ K     +K  +D     YYH +     L 
Sbjct: 556  VPSCSYDIQFVNRLAEMEDYLIADLIIRTSSKDGS--NKELLDFSFPSYYHRKFLSPILT 613

Query: 547  EKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLE 726
             K       H +  T  N  +   + K  + E+ K      +E++  K+ I   +  + +
Sbjct: 614  LK-------HSVLTTNTNLAEERAKLKKTKKELSKKLSGLRQEIDHLKVKI--CQNAVQD 664

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT----N 894
            EK+++ +                       D+    + Q E ++  L+ ++K L      
Sbjct: 665  EKSSSKV-----------------------DNLKTLLHQSESQIASLEKDLKSLNVQQVQ 701

Query: 895  MNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDH 1074
            M +N    K +  QK+ +YS     + + +     + +K + E  +L    +K   K + 
Sbjct: 702  MESNYLQKKDKHLQKQMEYSNLEASLNEELREYTVKLSKLQQEFAQLTSKKEKMTVKHEK 761

Query: 1075 LERSL----QAQTNAQNSFSAVTVQDEDQKD 1155
            L++ +    Q   N +  F     +D  Q++
Sbjct: 762  LQKEVDQYCQEFENFKTQFLVKREKDRQQRE 792

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
            YGR130C (REAL)
          Length = 831

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 55/278 (19%), Positives = 118/278 (42%), Gaps = 36/278 (12%)
 Frame = +1

Query: 487  SKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKE 666
            SK   D + Y E++ +  L +   +    +  K T+  ++  D +++++E E   + +K+
Sbjct: 432  SKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIE---NSMKQ 488

Query: 667  IEEVEDNKISINS--LEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
            + E    KI +N   L +Q+++  T +N  +   +K  E  K+   E ++   +    +K
Sbjct: 489  LREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVK 548

Query: 841  QKEYEVQKLKNEV-KFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
             +  E+   K+ V K   +  TNL +   Q   +  + +Q  +   K  + +     +K+
Sbjct: 549  SEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKK 608

Query: 1018 D---ECNRLKFVVDKNMKKIDHLERS-----------------------LQAQTNAQNSF 1119
            D   +    K + +KN++ ++ +E                          Q   N +   
Sbjct: 609  DLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHL 668

Query: 1120 SAVTVQDEDQKDAH-------LEDRYHKVKEFMEQKLQ 1212
            SA+T + ED++ AH        E+R  K +  +E++ Q
Sbjct: 669  SAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 706

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
            YGR130C (REAL)
          Length = 839

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 69/327 (21%), Positives = 131/327 (40%), Gaps = 56/327 (17%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAEC--------ERSKNAIDSLYYHEQLEKKDLNEKS 555
            SS S  AQ   T A      T  K E           SK   D + Y E++ +  L +  
Sbjct: 404  SSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLR 463

Query: 556  LQMAIDHLLKVTKQNQRQVDGRDKLEETE-VLKSFIKEIEEVEDNKISINSLEQQLLEEK 732
             +    +  K  +  ++  D +++++E E  +K+  KE  E  +  +S N L +Q+++  
Sbjct: 464  AREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIE--VSKNRLVKQIIDVN 521

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK---LKNEVKFLTNMNT 903
             A+N             K+L   F+D ++  ++K+++K   + K   +K+++  L +  T
Sbjct: 522  AAHN------------NKKLMI-FKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKT 568

Query: 904  NLKADKTQFSQKEKQYSQ-------KYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK 1062
            N++ D   ++      SQ       K   I    S V+ E +  E + N L     +N K
Sbjct: 569  NVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEK 628

Query: 1063 -------------------KIDHLERSL-----------QAQTNAQNSFSAVTVQDEDQK 1152
                               +I+ ++  +           Q   N +   SA+T + ED++
Sbjct: 629  LHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDER 688

Query: 1153 DAH-------LEDRYHKVKEFMEQKLQ 1212
             AH        E+R  K +  +E++ Q
Sbjct: 689  RAHEEQLKLEAEERKRKEENLLEKQRQ 715

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 54/259 (20%), Positives = 110/259 (42%), Gaps = 52/259 (20%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHL---LKVTKQNQRQVDGRDKLEET 639
            K + E +   I S  Y ++L+K++L  + L+M ++H+   LK+  Q++ +     K   +
Sbjct: 175  KLDIEYNSILISSEKYLQELDKRELIIEQLKMKLNHIEDELKIKNQSEFEELNNTKDAIS 234

Query: 640  EVLKSFIKEIEEVEDNKISINS------------LEQQLLEEKTANNILRRDYYKLQERG 783
            + + ++  +I+E E NKI  N             L++ + E++   N ++  Y +L    
Sbjct: 235  QKITNYQIKIKEFE-NKIKTNKSQLKINNQNLKLLDELINEKQLELNEIKPQYEELNNVN 293

Query: 784  KRLCHEFQDLQDDYS----KKMKQKEY------------EVQKLKNEVKFLTNMNTNLKA 915
            + L  E   L+D       K  K  ++            E+  L   +  L N    L+ 
Sbjct: 294  QDLKFEINKLKDQEKILIIKNNKYSQFANIEERNEWIQEEINNLNLNLTTLNNTCKGLED 353

Query: 916  DKTQFSQKEKQYSQKYI--------------YIEKYMSHVKQEYNKKED-------ECNR 1032
            ++   +++  + +QK                 IE  +  + + Y K+ D       E N+
Sbjct: 354  EEMDLTREFDEINQKIQDLNTSINESTITIDEIEHEIKDLNEMYTKEIDKRKELWREENK 413

Query: 1033 LKFVVDKNMKKIDHLERSL 1089
            L  V++ N+  I+ +ERS+
Sbjct: 414  LDTVLETNLDSINRIERSI 432

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] {ON}
            similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 51/269 (18%), Positives = 111/269 (41%), Gaps = 9/269 (3%)
 Frame = +1

Query: 391  ISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAI 570
            I I + +  ++    + + +    ++ AE E++     SL     L    L+     +A 
Sbjct: 678  IDIQTFNAASKRLNEMELELKQINSKIAEYEQTSQKTKSLQNELNLATHKLSLAKKSLAA 737

Query: 571  DHLLKVTKQNQRQVD---------GRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL 723
            +   ++ ++N    D          R  L   E  +  IK  +++E+      S  ++L 
Sbjct: 738  NSATQIIRRNNEISDEISSCTAEINRQTLLSEEFEQEIIKIQKDMEEFNQDKGSKLRELK 797

Query: 724  EEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNT 903
            EE T  +    +     E+   L    Q  +D  +  +   +  ++ L+  +K L N   
Sbjct: 798  EEITNLSKKIEEQDAFIEKKFDLYQNLQLEKDQLTSDISASKGSIEDLEQAIKELENTRN 857

Query: 904  NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLER 1083
            +++ D    S ++ + +Q    I+  ++  K      +DE   L+ ++ K  +++ + E 
Sbjct: 858  SIEDD---LSLRQTELNQ----IQNDLNEEKTRLLDIDDEIRELESLLMKKNEQLSNSEL 910

Query: 1084 SLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
             LQ  T+  N F + T + E + ++ LED
Sbjct: 911  ELQKLTHELNKFKSSTDKIEQRIESLLED 939

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 37/167 (22%), Positives = 78/167 (46%), Gaps = 14/167 (8%)
 Frame = +1

Query: 613  DGRDKLEETEVLKSF-IKEI-----EEVEDNKISINSLEQQLLE--------EKTANNIL 750
            D R+K E+T   K   ++EI     EE+E     + + ++  LE        EKT   + 
Sbjct: 176  DRREKAEKTMAKKETKLQEIRTLLEEEIEPKLEKLRNQKRAFLEFQETQTDLEKTLRILN 235

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
              +YY +  +   +    Q+     + ++++    +QK KNE+   +N++ +LK  K Q 
Sbjct: 236  AYEYYDMATKNSTIKETLQNS----TARVEELNNFIQKTKNEI---SNLDEDLKTIKIQ- 287

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID 1071
                    Q+ +  +  +S ++++ N   +E +RLK  +  +++ I+
Sbjct: 288  -------KQEQVQKDGKLSQLEKQENDLANEISRLKTALGISVENIN 327

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 69/313 (22%), Positives = 131/313 (41%), Gaps = 37/313 (11%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVT-----------------KQ 597
            K E +R  N  ++L  +E++++ DL    L   ++     T                 K+
Sbjct: 247  KQEYQRLLN--EALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFIILKKE 304

Query: 598  NQRQVDGRDKLEETEVLKSFIKEIE----EVEDNKISINSLEQQLLEEKTANNILRRDYY 765
             Q+    RD L+E   L+  I E+E    E+ +    IN LE  L +EK  +   +    
Sbjct: 305  IQKLEGQRDLLQEK--LEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKTTIK 362

Query: 766  KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK 945
            +++   K +    + L DD  + ++++  +   L N+++F+   N+       + ++ E 
Sbjct: 363  EIENEKKNIISRLK-LSDDKIETLREENND---LTNQIQFMLISNSIQNDKYGELTENEI 418

Query: 946  QYSQKYIYIEKYMSHVKQEYNKKE---DECNRLKFVVD---KNM----------KKIDHL 1077
            ++  K +  +   +   + YN ++   D   R + V+    KNM          KK+D+ 
Sbjct: 419  KFI-KALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQ 477

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEAL 1257
            E  L+A+  A+N       ++E  K     D   K+KE + +  Q    N P   E    
Sbjct: 478  EHELRAKWEAENDDVLNEAKEEILKVVSESD---KLKEKISELQQQLNANRPVSHEKNGH 534

Query: 1258 DNVLGLIENTMKT 1296
            ++VL   EN + T
Sbjct: 535  ESVLA--ENKLYT 545

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 53/240 (22%), Positives = 100/240 (41%), Gaps = 5/240 (2%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISI 699
            E L+ +++NE S  + I++     K +   VD   K E   +L   +   E++++  + +
Sbjct: 219  ESLKNREINEHSSDINIEY----GKNSSIIVD---KQEYQRLLNEALINNEKIDEYDLKV 271

Query: 700  NSLEQQLLE--EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
              L   + E   KT  N +  D +      K+   E Q L+       ++ EY + +L+N
Sbjct: 272  ARLTATVNEFQSKTGINFVSTDDFCDFIILKK---EIQKLEGQRDLLQEKLEYLIHELEN 328

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
                L N    +   +   S KEK  S      E + + +K+  N+K++  +RLK   DK
Sbjct: 329  HAPELNNQYDKINELELLLS-KEKNTS------EHFKTTIKEIENEKKNIISRLKLSDDK 381

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAH---LEDRYHKVKEFMEQKLQTSKN 1224
                   +E   +   +  N    + + +  Q D +    E+    +K   E+  +TS N
Sbjct: 382  -------IETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFN 434

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 80/383 (20%), Positives = 147/383 (38%), Gaps = 61/383 (15%)
 Frame = +1

Query: 373  NIPTKHI---SISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDL 543
            NIPT  +   + + +  L    +   + + H+ N         ++ D    HEQL    L
Sbjct: 15   NIPTSELLSLNENILEQLKSKVDGDKIVLRHDENA------DNDSTDLQTLHEQLNNITL 68

Query: 544  ------NEKS-LQMAIDHL-LKVTKQNQRQVDGRDKLEETEV----LKSFIKEIEE---- 675
                  NEK+ L   I  L +K+ ++    +  + +LE+  +    L+S  +E+E     
Sbjct: 69   KYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSA 128

Query: 676  VEDNKISINSLEQ---QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM--- 837
            + DN+ +++  EQ   Q L  +  N  L+ D   L+ +  +L   + D +D+  +K+   
Sbjct: 129  MNDNENTLHDEEQYKNQCLNREVIN--LKNDILILETKYDKLLKGYNDTKDNLKEKISEL 186

Query: 838  ------------------KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
                              ++K+Y +  L NE++ L N   N                   
Sbjct: 187  LALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREIN------------------- 227

Query: 964  IYIEKYMSHVKQEYNKK------EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSA 1125
                ++ S +  EY K       + E  RL      N +KID  +  +   T   N F +
Sbjct: 228  ----EHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQS 283

Query: 1126 VT----VQDEDQKD--------AHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVL 1269
             T    V  +D  D          LE +   ++E +E  +   +N+ P  +      N L
Sbjct: 284  KTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINEL 343

Query: 1270 GLIENTMKTLEGNSKYYSTTTKK 1338
             L+ +  K     S+++ TT K+
Sbjct: 344  ELLLSKEK---NTSEHFKTTIKE 363

 Score = 34.3 bits (77), Expect = 0.91
 Identities = 54/283 (19%), Positives = 111/283 (39%), Gaps = 7/283 (2%)
 Frame = +1

Query: 550  KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEE 729
            K L+     L        R++D   K  + ++  + +K + E  DN   I    + +   
Sbjct: 733  KDLRTKEQELQDFISTKNRELDWYQK--KFDIFSTMLKRVAEGNDNNDDIPVKTENI--- 787

Query: 730  KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ---KEYEVQKLKNEVKFLTNMN 900
              +++    D +  Q  G           DD S K +        V ++K+ +K L+N N
Sbjct: 788  -NSSDSFVLDNFSEQVEG-----------DDTSSKERSPSCNNISVFRVKDPMKPLSNNN 835

Query: 901  T-NLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 1077
            T N+ +    F       +   +   +Y   +++E  K ++E  R      + ++K+  L
Sbjct: 836  TDNVTSSNINFKTSSDLNNDFELLFNEYKV-IEKELEKAKNEIMRTSGDAQE-LEKLSEL 893

Query: 1078 ERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEAL 1257
              S   + ++    +    +  +  + H+E    ++K+  +  L+  KN     SE   L
Sbjct: 894  LLSRDQEHSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLL 953

Query: 1258 DNVLGLIENTMKTLEGNSKY---YSTTTKKCLKYVTGSSRLKE 1377
             N    +EN +K     S +   Y   +K+  + +   +RLK+
Sbjct: 954  RNRCKELENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKK 996

>KNAG0M01840 Chr13 complement(341241..345116) [3876 bp, 1291 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1291

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 55/293 (18%), Positives = 125/293 (42%), Gaps = 11/293 (3%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR----- 621
            E++  +E +  ++ ++ L  +++    DL E++      H  +    +++   G      
Sbjct: 495  ESDILSEYDEDEDDLEELSEYDE----DLAEENSCSNASHRYQTLTDSEKANQGHYGADF 550

Query: 622  -DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH 798
             +     E  +S I E + +E+ +  I     +LL+ +     +   Y++ Q    RL  
Sbjct: 551  GEHAHHDEGSESEIDEADRLEEGRRLIQIAITKLLQSR-----IMESYHEKQADANRL-K 604

Query: 799  EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE-----KQYSQKY 963
              ++L+++  KK K+KE + QK K + K         K ++ +   +E     K+  ++ 
Sbjct: 605  LLKELEEEQMKK-KEKEEKKQKKKEKEKEKRKQQQLAKEEEKRRKAEEEERLKKEREERE 663

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
            +   +      +E  +K+DE  + K    +  ++I   +R L+ +   +        +DE
Sbjct: 664  LERREAQRRKVEESRRKKDEERKRKLEEQRKREEIQENQRKLKEEQKRK--------RDE 715

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            ++K   LE +  K ++ +EQ+ + ++       + EA    +   E   K LE
Sbjct: 716  ERKQKELEQKRIKEQKRLEQERKAAEEKRIKEQKLEAERQKIREEEERQKKLE 768

 Score = 32.0 bits (71), Expect = 4.7
 Identities = 58/306 (18%), Positives = 120/306 (39%), Gaps = 16/306 (5%)
 Frame = +1

Query: 382  TKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQ 561
            T  +++  +  L++  ET      +E N        ++ I S Y  ++ + ++L+E    
Sbjct: 464  TNPLTMDQVGKLSKGRET-----DYEDNYDFSDYDDESDILSEYDEDEDDLEELSEYDED 518

Query: 562  MAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTAN 741
            +A ++         + +   +K  +      F +     E ++  I+  ++  LEE    
Sbjct: 519  LAEENSCSNASHRYQTLTDSEKANQGHYGADFGEHAHHDEGSESEIDEADR--LEE--GR 574

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADK 921
             +++    KL +   R+   + + Q D ++    KE E +++K + K         K  K
Sbjct: 575  RLIQIAITKLLQ--SRIMESYHEKQADANRLKLLKELEEEQMKKKEK-------EEKKQK 625

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK----------------FVVDK 1053
             +  +KEK+  Q+           ++E  +K +E  RLK                 V + 
Sbjct: 626  KKEKEKEKRKQQQLAK--------EEEKRRKAEEEERLKKEREERELERREAQRRKVEES 677

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDP 1233
              KK +  +R L+ Q   +          E+QK    E+R  K KE  +++++  K  + 
Sbjct: 678  RRKKDEERKRKLEEQRKREEIQENQRKLKEEQKRKRDEER--KQKELEQKRIKEQKRLEQ 735

Query: 1234 SCSEAE 1251
                AE
Sbjct: 736  ERKAAE 741

>NCAS0C01620 Chr3 (300476..301870) [1395 bp, 464 aa] {ON} Anc_8.659
           YPL146C
          Length = 464

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 38/151 (25%), Positives = 71/151 (47%)
 Frame = +1

Query: 529 EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
           E+  L  +  +  I HL++  + N+ +    D+ EE E         EE E+ +  +N  
Sbjct: 262 EQNRLALEEYKERIKHLMETLEDNEEEESSDDEGEEEE---------EEEEETEEQLNEA 312

Query: 709 EQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFL 888
            +  + E   N   ++  Y   +R K   HE +       KK+KQ+ +E+++L +E++  
Sbjct: 313 IKLSINEAVKNK--KKTKY---QRNKAQKHEEKVKLQQELKKLKQRVHELERL-DEIEGA 366

Query: 889 TNMNTNLKADKTQFSQKEKQYSQKYIYIEKY 981
            +  TN K D T  S+K K+  ++  +  KY
Sbjct: 367 VSKETNEK-DNTSVSEKVKKTKKRAKFGTKY 396

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
            YOR216C
          Length = 471

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 41/238 (17%), Positives = 101/238 (42%), Gaps = 1/238 (0%)
 Frame = +1

Query: 592  KQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKL 771
            ++ +++ +  D+ E T  L+  I  ++E    ++ +   E + L  +T  +     Y  L
Sbjct: 66   EEEEKEEENNDE-ENTSTLEKEIARLKEEHAEQLRMKDTEMEKL--RTERDAKESQYNTL 122

Query: 772  QERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY 951
              R   +   FQ+L+D         + E++ ++ +++   + N  LK   +  S++ ++ 
Sbjct: 123  LSRISSMKDVFQNLRDS--------KQELENVQEQLQEYESQNLRLKNKVSSTSKENEEL 174

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQ-NSFSAV 1128
                  + K    ++ EY   + +    +  ++K   K++H   S   + NA       +
Sbjct: 175  RTTVTTLNKEYDSMESEYENLQKQVTSYERQIEKCEIKLEHATESHSDELNAYIKEIENL 234

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            T++ +    A LE+ +  + +   ++ + + +   S S    L   +  +E T+ T E
Sbjct: 235  TLKIQKLTVA-LENSHQSISDLKSERQELAHDLATSESTLSNLKQTIADLEATLNTKE 291

>TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1504

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 54/219 (24%), Positives = 96/219 (43%), Gaps = 1/219 (0%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE-VLKSFIKEIEEVEDNKIS 696
            ++  +K+   K LQ       K  K+ +R    R +LE  E  +K    + ++VE+NK  
Sbjct: 779  QKKREKEKERKRLQQVAKEEEKRKKEEERI---RSELEAQEREMKRREAQRKKVEENKKK 835

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE 876
             +  +++ LEE+      +    KL+E  KR   E +  Q +  +K KQ+E   +K + E
Sbjct: 836  KDEEKRRKLEEQRRREEEQERQRKLKEEQKRKRDE-ERRQREEEQKRKQEEKLRRKQEEE 894

Query: 877  VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKN 1056
             K L               QKEK+  +K +  +K +   K    KKE E    KF  D+ 
Sbjct: 895  NKRL---------------QKEKEEKEKLLKKQKELEEEKLLKKKKEQE-RLAKFKKDEE 938

Query: 1057 MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
             KK    ++  + +T+ Q       ++  D K  +++ +
Sbjct: 939  AKK---KKQQAEKETSQQLKKDEQNLKKNDTKPHNVKSK 974

 Score = 39.7 bits (91), Expect = 0.020
 Identities = 65/309 (21%), Positives = 126/309 (40%), Gaps = 15/309 (4%)
 Frame = +1

Query: 349  VNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAID-------- 504
            ++R   L +  T HI+ S  +    T  +    I+     K     SK+ I+        
Sbjct: 611  ISRNLKLLSESTSHINDSGNNSEQHTTNSNRNSISEYNKIKNLKNNSKDNINEEVENDED 670

Query: 505  --SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEV 678
              S+ +H   + +  +  S +   D        +   ++  D++++ E   S I E E +
Sbjct: 671  FHSMQHHHSHDHEHEHSDSFEDIADE-----DDDDDDLEDADEIDDDEDYDSGIDETERL 725

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            E+ +  I     +LL+ +   +     Y++ +    RL    ++L+ +  KK K KE + 
Sbjct: 726  EEGRKLIQIAITKLLQARIIES-----YHEKEAENNRL-KLLEELEAE-DKKKKVKEEKK 778

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK-QEYNKKEDECNRL 1035
            QK + + K           ++ +  Q  K+  ++    E+  S ++ QE   K  E  R 
Sbjct: 779  QKKREKEK-----------ERKRLQQVAKEEEKRKKEEERIRSELEAQEREMKRREAQRK 827

Query: 1036 KFVVDKNMKKIDHLER-SLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE---FMEQ 1203
            K  V++N KK D  +R  L+ Q   +          E+QK    E+R  + +E     E+
Sbjct: 828  K--VEENKKKKDEEKRRKLEEQRRREEEQERQRKLKEEQKRKRDEERRQREEEQKRKQEE 885

Query: 1204 KLQTSKNND 1230
            KL+  +  +
Sbjct: 886  KLRRKQEEE 894

>SAKL0B10274g Chr2 (881660..886324) [4665 bp, 1554 aa] {ON}
            uniprot|Q875Q8 Saccharomyces kluyveri MYO2 Myosin- 2
          Length = 1554

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 39/190 (20%), Positives = 88/190 (46%), Gaps = 2/190 (1%)
 Frame = +1

Query: 484  RSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIK 663
            RS   + SL   +  +KK  + K+   +++HL +V+ + + +V         ++ +S  +
Sbjct: 898  RSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKV--------IQLTESLAE 949

Query: 664  EIEEVEDNKISINSLEQQLLEEKTANNIL--RRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
            +++E +     I  L+Q L E      +L  ++D +    + ++  H+ Q   ++  +K+
Sbjct: 950  KVKENKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQF--NEVQEKL 1007

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
               + EV++ K E++ L      LKA+     ++  +  + +   +   S +K E    +
Sbjct: 1008 VNAKKEVEEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLK 1067

Query: 1018 DECNRLKFVV 1047
            DE  RL+  V
Sbjct: 1068 DEIARLQAAV 1077

>Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar to
            Ashbya gossypii AAR042W
          Length = 486

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 58/234 (24%), Positives = 102/234 (43%), Gaps = 4/234 (1%)
 Frame = +1

Query: 361  YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKN-AIDSLYYHEQLEKK 537
            + L   P+K ++ +S+S   +  ETL   +   T+   +  +  N  ++ L  +   E K
Sbjct: 85   HGLNGSPSKDMNYNSVSGSGKVIETLHQQVDALTSTNLQLTKQSNQLLEKLESYNMKEAK 144

Query: 538  DLNE-KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQ 714
             L    SL+   ++L  +  +  R+V  RD   E   LK         ED   S   L+ 
Sbjct: 145  YLETISSLKHENENLNSMLNRKTRRV--RDLDTELGQLK------VSYEDATTSHKHLKD 196

Query: 715  QLLEEKTANNI-LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNE-VKFL 888
            Q LE K AN + L++    LQ +   +    +  ++ Y K++ + +  +  LK +  +FL
Sbjct: 197  Q-LENKFANEVELKQQCQLLQVQYDAVVDAQKRYREHYEKEISELKDILNTLKRDNEQFL 255

Query: 889  TNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
             +  T+L  ++     K  +YS K+  +E        E N K D   RLK  +D
Sbjct: 256  NDYMTSLARNQLDVDNKLGEYSGKFHRMELSQKEAVIELNGKYD---RLKSELD 306

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 61/304 (20%), Positives = 134/304 (44%), Gaps = 13/304 (4%)
 Frame = +1

Query: 382  TKHISISS-ISDLAQTFETLAVG----ITHETNRKAECERSKNAIDSLYYHEQLEKKDLN 546
            TK +S+ S I +L Q ++++       +T     K   E ++ +     Y  +  K +L+
Sbjct: 964  TKILSLQSEIVELRQQYDSMKHDKDNMLTETKKLKKSLEDAERSRSEAAYEIKQLKSELD 1023

Query: 547  EKSLQMAIDHLLKVTKQNQRQV--------DGRDKLEETEVLKSFIKEIEEVEDNKISIN 702
              S +  I+ L   +++  + +          R++LE     K+  +  +++   + +I 
Sbjct: 1024 HSSKE--IEQLNSSSEEKSKNLADAVNTFNKARNELESLN--KTLAEANDKLRSRESTIE 1079

Query: 703  SLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
            SLE++L E K +++       K ++  ++   +F+DL+ + S K +    ++QK   + K
Sbjct: 1080 SLEEKLQELKKSSDEKIASLEKSRKDLEKFQQKFRDLELEKS-KTQDALTDLQKALQDEK 1138

Query: 883  FLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK 1062
                 +  L+ DK +    EK+ S +    E   S V +     ED     K V +   K
Sbjct: 1139 NNHQESLQLQKDKIKQLALEKENSAE--STEALKSEVSKLRQTVEDLNKSHKLVHEDYEK 1196

Query: 1063 KIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCS 1242
            K+  L++    +T +    S++ +Q+    +  LE+   + ++  EQ     + +   C+
Sbjct: 1197 KVSELKK----KTVSLQDESSLRLQEVSALNTELEETRSRAEKLEEQATDLKEKHKNICN 1252

Query: 1243 EAEA 1254
            E ++
Sbjct: 1253 EIKS 1256

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 75/356 (21%), Positives = 150/356 (42%), Gaps = 24/356 (6%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVG--ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAID 573
            S +S L QT E L     + HE   K   E  K  + SL     L  ++++  + ++  +
Sbjct: 1171 SEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTV-SLQDESSLRLQEVSALNTELE-E 1228

Query: 574  HLLKVTKQNQRQVDGRDKLEET-EVLKSFIKEIEEVEDNKISINSLEQQLLEEKT-ANNI 747
               +  K  ++  D ++K +     +KS +K+ E+ +D++I +  L++++   KT  ++I
Sbjct: 1229 TRSRAEKLEEQATDLKEKHKNICNEIKSKVKQ-EKEKDSRILV--LDKEMKSAKTDLSDI 1285

Query: 748  LRR------DYYKLQE----------RGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV 879
            + +      +  KLQE           GK+   +F         K+K+K  EV+K   E 
Sbjct: 1286 VHKLEASNSEIAKLQEIKAEFESQELEGKKQKEDFDAEIKTLRAKLKEKSAEVEK---ER 1342

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK----EDECNRLKFVV 1047
            K L   ++NL          E++YS+K   +E+ +  ++ +++ K    ++E  +L  ++
Sbjct: 1343 KMLNEGSSNL----------EQEYSRKISQLEEELESLESKHSLKHQESDNEKRKLSGLL 1392

Query: 1048 DKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
             K+        R L+    +       +++D++Q+   L        + M ++L  +   
Sbjct: 1393 KKSESSATEKNRELECVRESMKKLRE-SLKDKEQQSEQLSSLQKTQSDKMREELGLANQ- 1450

Query: 1228 DPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 1395
                   EA +      EN    L   +        + L Y+   S+L E E I N
Sbjct: 1451 ----KLEEAREKGRKHKENLEVALSQKASEVKKLKDQALNYL---SKLDEKEAIIN 1499

 Score = 31.6 bits (70), Expect = 6.3
 Identities = 40/205 (19%), Positives = 82/205 (40%), Gaps = 14/205 (6%)
 Frame = +1

Query: 685  NKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ- 861
            +K+S  SLE +L+++KT    L     K +E  K    +     ++  K +K  E E + 
Sbjct: 695  DKVSFESLE-KLIQQKTQ---LEEALLKSEESSKGQIEDLNRSLEELQKALKSTEDEKKA 750

Query: 862  ---KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI---YIEKYMSHVKQEYNKKEDE 1023
                L+N      N+  N    K + +  +K+ S        IE     ++ ++N   D 
Sbjct: 751  AELDLENVRASFKNLEDNYSGTKEELNLLQKENSDLVATNSKIENTKKDLELKFNNNRDA 810

Query: 1024 CNRLK---FVVDKNMKK----IDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHK 1182
              +L+    +V +  K     I+ + R L   +   N     + + +++ +  L     +
Sbjct: 811  LTKLEKELSIVCEQKKAAEDGINKMNRELLVLSREHNELKNTSTKSKNELEKVLAASNEE 870

Query: 1183 VKEFMEQKLQTSKNNDPSCSEAEAL 1257
            +K   +   +   + + S +E E L
Sbjct: 871  LKRLQDFTREKDSSIEKSRAELERL 895

>Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR150W
            (NUM1) - Protein with variable number of tandem repeats
            of a 64 amino-acid polypeptide, potential Ca2+-binding
            site, and pleckstrin homology domain [contig 29] FULL
          Length = 3336

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 41/184 (22%), Positives = 81/184 (44%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
            EKK  N KSLQ   + L    ++  R++   +K  E+  LK    ++E        +  +
Sbjct: 108  EKKSTNLKSLQHEYEALKLTFEKISRRLHSTEK--ESTSLKDHNWDLET------KLQQV 159

Query: 709  EQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFL 888
             QQ+ E + +++  R+D +K     + + ++F +   +     ++ +   QK   EV  L
Sbjct: 160  SQQMKEFRESSDKARKDLHKQLVAFEEMRNKFDEAALEGKGLKEELDSVYQKHAREVADL 219

Query: 889  TNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKI 1068
                 +L  +  Q  QK +  + + I + + +S      N K D   + +   D ++ K+
Sbjct: 220  KRNILDLNEENDQLQQKLEDMNSRLISLSRDVS------NAKRDTSAQTEHKTDSSLHKL 273

Query: 1069 DHLE 1080
            D LE
Sbjct: 274  DMLE 277

>TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] {ON}
            Anc_1.162 YKL179C
          Length = 627

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 56/290 (19%), Positives = 128/290 (44%), Gaps = 19/290 (6%)
 Frame = +1

Query: 490  KNAIDSLYYHEQLEKKDLNEKSLQM----AIDHLLKVTKQNQRQVDGRDKLEETEVLKSF 657
            KN+I+SL      +++  NE ++ +    ++++ L   K+ Q +   + K  E E L   
Sbjct: 108  KNSINSLKVDNSKDQELQNEINVLLKDKESLNNQLNEIKEKQNEESTKLK-NEIETLNKK 166

Query: 658  IKEIEEVEDNKISINSLEQQ--LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDD--Y 825
            ++ + +++ +K   N    Q  LL E+  N+I +     L+ +   L  +   L++D  +
Sbjct: 167  LEILNKLQSDKAKDNQDSPQISLLTEELNNSISKIS--DLENKNNLLTKDLTKLKEDLEH 224

Query: 826  SKKMKQKEYEVQKLKNE-VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK-- 996
            +  +   E  ++ L NE +K   ++N+N     +     +++  +  +    Y S +   
Sbjct: 225  NNIINANEKTIKNLTNENIKLTKDLNSNQLQLTSLKDSSKREIDELKLNSTTYKSELDSI 284

Query: 997  -------QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD 1155
                   Q+YNK +DE + LK +    ++  D  +      TN+ N       ++   KD
Sbjct: 285  RRKLNQFQDYNKIKDELSALKSIEFGTVENDDD-DDDTNEGTNSAN-------KNSSSKD 336

Query: 1156 AHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA-EALDNVLGLIENTMKTLE 1302
            + ++       + +++KL   + +     E  + L+N + ++   + +LE
Sbjct: 337  SKVDSTLLATNKQLQKKLAELRGSTVDLEEKNKNLNNQVNVLNEKISSLE 386

>TPHA0H02060 Chr8 (487254..489296) [2043 bp, 680 aa] {ON} Anc_6.289
            YMR198W
          Length = 680

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 44/188 (23%), Positives = 94/188 (50%), Gaps = 3/188 (1%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKK-DLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV 645
            K + E+ K  ++++   E++ ++ ++ +  L+ A   L  +  QN+ Q++   K E    
Sbjct: 196  KFKWEKQKQELENMKPSEEIAQEIEILKGELESAKIELNNIINQNEIQLNDY-KAELQNK 254

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLE--EKTANNILRRDYYKLQERGKRLCHEFQDLQD 819
             + F KE +   D  IS    ++QL E  EK    I+  +  K Q+  K+   + ++  +
Sbjct: 255  FEEFKKEKKAPLDKLISN---KEQLKENIEKYETEII--NITKEQDLLKKSQEDLREKIE 309

Query: 820  DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 999
            +YS+K+K  E E+  L  ++  ++     LK++  +   KE  + ++ +Y EKY    ++
Sbjct: 310  NYSQKLKNSENEMVPLNEKLMAVSKEFEILKSENDKL--KELAFKEEQLYKEKYEQVEEE 367

Query: 1000 EYNKKEDE 1023
            +  +K+ E
Sbjct: 368  QLRRKKLE 375

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
            Anc_8.604 YOR195W
          Length = 791

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 47/256 (18%), Positives = 107/256 (41%), Gaps = 11/256 (4%)
 Frame = +1

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
            +E  + +D +++I+    +  E K  NN + +D Y+L ++      +F+ ++ +Y    K
Sbjct: 249  EEDGDKDDLELTIDIENNEFRELKMRNNDVIKDNYQLHKKLNEFVIKFEKVKVNYVAVKK 308

Query: 841  QK-------EYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 999
            +        E EV + ++ +K +T    +L   + +   K K    + + + +    +++
Sbjct: 309  EYDNLRNTFENEVNERESTIKEITQERDDLTEKRDKLKAKIKNSKDEILMLNQNQKILQE 368

Query: 1000 EYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYH 1179
            +Y+   +E +  +           +   +L+ + + Q    A+ + +   K   LE    
Sbjct: 369  KYDNLSNENDTWR-----------NNYETLELEISKQKESHAIELNETSTK---LETLKS 414

Query: 1180 KVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTT---TKKCLKY 1350
            ++ E M +    ++ N+    E + +   L      + +LE   K    T   TK+  KY
Sbjct: 415  ELAESMAKSQSLTEKNNDMHEELDTIQQSLQTKNELISSLEATIKEQQNTQDLTKENEKY 474

Query: 1351 -VTGSSRLKENEHITN 1395
                 S  KE + +TN
Sbjct: 475  REQFESLFKEKDELTN 490

 Score = 32.3 bits (72), Expect = 3.4
 Identities = 50/274 (18%), Positives = 108/274 (39%), Gaps = 35/274 (12%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEV----NDAVNRCYALCN------IPTKHISISSISDLAQTFETLA 441
            D E   +  ++ F+E+    ND +   Y L        I  + + ++ ++ + + ++ L 
Sbjct: 256  DLELTIDIENNEFRELKMRNNDVIKDNYQLHKKLNEFVIKFEKVKVNYVA-VKKEYDNLR 314

Query: 442  VGITHETNRKAEC--ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVD 615
                +E N +     E ++   D     ++L+ K  N K   + ++   K+ ++    + 
Sbjct: 315  NTFENEVNERESTIKEITQERDDLTEKRDKLKAKIKNSKDEILMLNQNQKILQEKYDNLS 374

Query: 616  G-----RDKLEETEVLKSFIKEIEEVEDNKIS--INSLEQQLLEEKTANNILRRDYYKLQ 774
                  R+  E  E+  S  KE   +E N+ S  + +L+ +L E    +  L      + 
Sbjct: 375  NENDTWRNNYETLELEISKQKESHAIELNETSTKLETLKSELAESMAKSQSLTEKNNDMH 434

Query: 775  ERGKRLCHEFQDLQD----------------DYSKKMKQKEYEVQKLKNEVKFLTNMNTN 906
            E    +    Q   +                D +K+ ++   + + L  E   LTN    
Sbjct: 435  EELDTIQQSLQTKNELISSLEATIKEQQNTQDLTKENEKYREQFESLFKEKDELTN---K 491

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYN 1008
              A   ++  K ++Y QK I  E  + +++++YN
Sbjct: 492  FNAMNEEYLTKIEEYQQKVIEAETELINIREKYN 525

>Suva_10.279 Chr10 (490526..492937) [2412 bp, 803 aa] {ON} YLR182W
            (REAL)
          Length = 803

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 42/205 (20%), Positives = 84/205 (40%), Gaps = 1/205 (0%)
 Frame = +1

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            +D   ++ S E        +N  +R    K       L +E Q+L +  SK     +YE 
Sbjct: 522  DDKNSTMISKEDSDGTNSGSNKKIRAQLLKNPPETTSLINEVQNLLNSISK-----DYES 576

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK 1038
            + ++   K L N++  L   + + +    Q +         +  +K EY+  +++   LK
Sbjct: 577  ETIQYNEK-LENLHKELNEQRNKLASSRDQLAS--------VKQLKDEYSLMQEQLTNLK 627

Query: 1039 FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS 1218
              +++         + L   T+  +        +  + DA    +   + +FME+KLQT 
Sbjct: 628  SGIEEEEANFREESKKLGIITDESSGID----WESSEYDADEPFKVELISDFMEEKLQTD 683

Query: 1219 KNNDPS-CSEAEALDNVLGLIENTM 1290
             + D S   E+E+ + ++  I N M
Sbjct: 684  YDGDISKLLESESKEQIMEQIRNQM 708

>ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa] {ON}
            similar to uniprot|P31111 Saccharomyces cerevisiae
            YDR285W ZIP1 Synaptonemal complex (SC) protein that
            connects homologous chromosomes partially during zygotene
            and entirely during pachytene potential Cdc28p substrate
            synaptonemal complex protein
          Length = 927

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 45/212 (21%), Positives = 92/212 (43%), Gaps = 29/212 (13%)
 Frame = +1

Query: 463  NRKAECERSKNAID--SLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-RDKLE 633
            +R AE ++  N+    S    EQ +K+D   K  +   D LLK  +  +  + G ++ L 
Sbjct: 206  DRFAEYKKLLNSFSEKSKLLFEQKKKEDTQLKEFKENYDKLLKKVESYKDDIHGLKNNLS 265

Query: 634  ETEVLKS-----FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH 798
            +   LK        K+++E+E  K  ++S   QL EEK  N+ L +++ K+  RG+ + +
Sbjct: 266  QLRFLKKDSDTELAKKVKEIEYLKRELDSCSGQLSEEKLKNSSLVQEFGKI--RGELMVN 323

Query: 799  EFQDLQDDYSKKMKQ----------------KEYEVQKLKNEVKFLTNMNTNLKAD-KTQ 927
              Q+L    S+ +++                  +    +    + +  + TN+ ++ KT 
Sbjct: 324  LTQNLSQGQSQILEKIGILESNFIGAYHVDWNNFSESSISKLTECIGTLRTNISSEFKTS 383

Query: 928  FSQKEKQ----YSQKYIYIEKYMSHVKQEYNK 1011
            F +  +     Y + +I      + +   Y+K
Sbjct: 384  FGENNRSLVDYYQKSFIEFMGRFNQIDGYYDK 415

 Score = 38.9 bits (89), Expect = 0.032
 Identities = 50/271 (18%), Positives = 112/271 (41%), Gaps = 9/271 (3%)
 Frame = +1

Query: 415  LAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQ--------MAI 570
            LAQ   +    +T+    +A     ++ I SL   +      L  K  Q        ++ 
Sbjct: 539  LAQELSSYKESLTNSREYEANISGLQSQISSLQLQKSQALSSLGTKEAQYEDLCNSLISK 598

Query: 571  DHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
            +  L   K+ ++++ G+ +   +EV +   K +   E+N     + E +L+ +       
Sbjct: 599  ETELARFKEIEKELHGKIENISSEVEQQKNKWLRLNEENITLKANSENKLVVQNELLKAF 658

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
            + +   L++R  +L    +D++  Y K+   +  ++Q++  +++ L      LKA + + 
Sbjct: 659  QSENNTLKQRTAQL----EDVRQQYEKENSTRLDKIQRINEQLQKLNVEMVQLKAHELEL 714

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLK-FVVDKNMKKIDHLERSLQAQTNA 1107
             ++ +        +++ +   K E+    D+  RLK  V+     K D +   L+ Q   
Sbjct: 715  EEENRN-------LKRLIEDNKMEFEDTTDDYKRLKQRVIVLESDKQDIVSEKLELQDQM 767

Query: 1108 QNSFSAVTVQDEDQKDAHLEDRYHKVKEFME 1200
            +   + VT     QK + L+   H   + +E
Sbjct: 768  EKMQAVVT--GLKQKVSSLQKNEHDYSKQLE 796

 Score = 38.5 bits (88), Expect = 0.043
 Identities = 42/199 (21%), Positives = 96/199 (48%), Gaps = 13/199 (6%)
 Frame = +1

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN 906
            +K  +N L+++ +K+Q    +L  + Q  Q D  +K+  +  E +KL         +N+ 
Sbjct: 170  QKICSN-LKQELHKVQTENSKLKTQVQSYQSD-KEKIMDRFAEYKKL---------LNSF 218

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED------ECNRLKFV-------V 1047
             +  K  F QK+K+ +Q   + E Y   +K+  + K+D        ++L+F+       +
Sbjct: 219  SEKSKLLFEQKKKEDTQLKEFKENYDKLLKKVESYKDDIHGLKNNLSQLRFLKKDSDTEL 278

Query: 1048 DKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
             K +K+I++L+R L + +          + +E  K++ L   + K++     +L  +   
Sbjct: 279  AKKVKEIEYLKRELDSCSG--------QLSEEKLKNSSLVQEFGKIR----GELMVNLTQ 326

Query: 1228 DPSCSEAEALDNVLGLIEN 1284
            + S  +++ L+ + G++E+
Sbjct: 327  NLSQGQSQILEKI-GILES 344

>YKL105C Chr11 complement(239185..242583) [3399 bp, 1132 aa] {ON}
           Putative protein of unknown function; similar to A.
           gossypii SEG gene which is important for stabilizing
           eisosomes
          Length = 1132

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 41/168 (24%), Positives = 71/168 (42%), Gaps = 8/168 (4%)
 Frame = +1

Query: 463 NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE 642
           N + E E  ++  D L +   +   D N       +D    + K+++  + GR+K EE E
Sbjct: 252 NEETEQELQEDLHDPLEFKPMIISDDENSFIEPSVLDR--SIPKKDKSGLSGREKKEEIE 309

Query: 643 VLKSFIKEIEE----VEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            L   +  +EE    +E  K++    EQ L+ E     +      +L +R   +  E  D
Sbjct: 310 TLLKEVHSLEEKISNIEIAKLNEEEREQSLILELRKVKLDEERRMELLKRELNIVKENAD 369

Query: 811 LQDDYSK----KMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE 942
           L+    K    K KQ  ++ Q++ +EVK +T     L   K  +   E
Sbjct: 370 LEAQELKLIESKRKQHFHKGQEVASEVKSITIRQPTLSEPKPAYVPPE 417

>Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250W
            (REAL)
          Length = 1312

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 59/280 (21%), Positives = 110/280 (39%), Gaps = 27/280 (9%)
 Frame = +1

Query: 541  LNEKSLQMAIDHLLKVTKQNQRQV----DGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
            LN   LQ  ID       Q + Q+    +  DKL ++   + F K + +VE+ K S  S+
Sbjct: 224  LNIHQLQSKIDQFNAEVSQIEAQLNEITEQSDKLFKSN--QDFQKILSKVENLKNSKASI 281

Query: 709  EQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFL 888
              Q+     +  IL      LQ     L   F  +  + + ++K  E  +  LKN+   L
Sbjct: 282  RDQVKRLSDSIEILDLSKTDLQS----LLTNFSKVLMEKNHQLKDLEMNISNLKNQQSSL 337

Query: 889  TNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECN------------- 1029
             N + +L   + +   +++ Y Q   ++       +Q +++  +E N             
Sbjct: 338  QNHSNSLIRRQGELEARKEAYEQNLSHLASLKEDFQQRFHRLSNENNTDMAQTNDEMSQF 397

Query: 1030 RLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFME--- 1200
            + +   D +       +  L  +TN      ++TV D    + + +DR   +++  E   
Sbjct: 398  QTRISQDLSNTAEQFAKEILLKETNVSELVKSITV-DSQNLEYNKKDRTKLIRDTEELTE 456

Query: 1201 --QKLQTSKNNDPSCSEAEALDNVLGLI-----ENTMKTL 1299
              + L+ S   D    E E L+   G +     ENT+  L
Sbjct: 457  EVRLLKNSSTQDDLDHELENLNTYKGKLQAWENENTIPKL 496

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 57/270 (21%), Positives = 117/270 (43%), Gaps = 12/270 (4%)
 Frame = +1

Query: 529  EKKDLNEK--SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI------KEIEEVED 684
            EK+ L  +  +++  ++  + + ++ +      D + E  + KS I      KE+++ E 
Sbjct: 740  EKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEA 799

Query: 685  NKISINSLEQQLLEEKTANNILRRDYYKLQ-ERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
             K S  +  Q+ L+  T  N       KLQ E  K L             K+  +  ++ 
Sbjct: 800  KKNSQINWYQKRLDSLTTTND------KLQVELNKELT------------KINIQRLKIS 841

Query: 862  KLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY---MSHVKQEYNKKEDECNR 1032
             L+  +   TN +++L      F + + +  +K + I +Y   ++  ++  N+ + + N+
Sbjct: 842  DLEKTLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLNK 901

Query: 1033 LKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQ 1212
             + +VD  M+  + L++ L   T   +S +++      ++ A  ED         +QK+ 
Sbjct: 902  QRQIVDDAMEGKEQLDQQLAELTQECSSMNSLL----QKQKAKCED---------DQKII 948

Query: 1213 TSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
              K      +E E L N L  +EN + TLE
Sbjct: 949  QDK-----ATETENLKNSLSSLENKITTLE 973

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa] {ON}
            complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 49/231 (21%), Positives = 92/231 (39%), Gaps = 16/231 (6%)
 Frame = +1

Query: 448  ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKS-----LQMAIDHLLKVTKQNQRQV 612
            + +E   K +  + +N  ++    E  EK+D   +       QM  D++ ++ K   R  
Sbjct: 120  LNNEKVLKEQKLKLRNVEETKVEFEFKEKRDFLRQGHEIHLKQMQSDNIFEINKLKNRS- 178

Query: 613  DGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRL 792
              + KL+   VL+           NK   N   Q L   +   N ++ + ++     +  
Sbjct: 179  --QSKLQRLRVLQ-----------NKSFHNERNQLLNSVEEIRNKIKENQFECSNIKQSC 225

Query: 793  CHEFQDLQ----DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQK 960
              E+  L+    D Y  K ++     + L  E+  L + +  L  D+     K  Q S+ 
Sbjct: 226  QDEYDQLKFEWLDTYQNKWRENVQYTKSLNTELHTLDSKHKKLIQDRNILVNKLNQSSKI 285

Query: 961  YIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMK-------KIDHLERSLQ 1092
            +   ++    VKQE   K+DE   +K  ++  +K       KI+ L+  LQ
Sbjct: 286  HRAKKEAEIEVKQEIKTKQDEIEGMKLEINSMIKERETSICKIEELDGRLQ 336

 Score = 37.4 bits (85), Expect = 0.092
 Identities = 57/298 (19%), Positives = 126/298 (42%), Gaps = 20/298 (6%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLE----KKDLNEKSLQMAI--DHLLKVTKQNQRQVDG 618
            E N + +  +    + S Y  + +E    +++L  K  Q+ +  D LLK  + N+  +D 
Sbjct: 57   ELNERHQDGKENIRLTSFYKEKIIELNKFQEELFRKKFQLDLLKDELLKY-QNNKDTIDF 115

Query: 619  R-DKLEETEVLKSFIKEIEEVEDNKISINSLEQQ---------LLEEKTANNILRRDYYK 768
              D L   +VLK    ++  VE+ K+     E++          L++  ++NI   +  K
Sbjct: 116  NFDTLNNEKVLKEQKLKLRNVEETKVEFEFKEKRDFLRQGHEIHLKQMQSDNIF--EINK 173

Query: 769  LQERGKRLCHEFQDLQD-DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK 945
            L+ R +      + LQ+  +  +  Q    V++++N++K      +N+K         + 
Sbjct: 174  LKNRSQSKLQRLRVLQNKSFHNERNQLLNSVEEIRNKIKENQFECSNIK------QSCQD 227

Query: 946  QYSQ-KYIYIEKYMSHVKQ--EYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNS 1116
            +Y Q K+ +++ Y +  ++  +Y K     N     +D   KK+      L  + N  + 
Sbjct: 228  EYDQLKFEWLDTYQNKWRENVQYTK---SLNTELHTLDSKHKKLIQDRNILVNKLNQSSK 284

Query: 1117 FSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTM 1290
                  + E +    ++ +  +++    +     K  + S  + E LD  L +I +++
Sbjct: 285  IHRAKKEAEIEVKQEIKTKQDEIEGMKLEINSMIKERETSICKIEELDGRLQIIHDSI 342

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
            to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
            involved in control of spindle dynamics
          Length = 816

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 57/278 (20%), Positives = 126/278 (45%), Gaps = 15/278 (5%)
 Frame = +1

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEV-EDNKISINSLEQQLLEEKTANNILRRDYYKL 771
            + Q  VD     E+TE L+  ++++  + E+   ++ +LE+QL E++    +L ++   L
Sbjct: 334  KEQSLVDQERLTEKTEELEDSLEKLTVLREELSTNVANLEKQLHEKQDEIKMLNQNQSIL 393

Query: 772  QERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQY 951
            Q    +   + Q  +++Y     +K+  ++ L+N    +  + + +   KTQ ++     
Sbjct: 394  QHNFDKKLEDEQKAREEYIIIQNEKDKAIEDLRNCKGKVEELESEIITLKTQINEN---- 449

Query: 952  SQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ-AQTNAQNSFSAV 1128
                   E + S + QE    E +   ++       ++I  LE+ LQ A ++ +N+ + +
Sbjct: 450  -------EDWNSKLLQEKTNLEAQVKNIEEKDLLKSEQITELEKKLQDAISSQKNTNTEL 502

Query: 1129 TVQDED--------QKDA-----HLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVL 1269
            +++ E+        +KDA      LE R  ++K  +E K +   N   + S+ E+     
Sbjct: 503  SLKVEELLKTNSSLEKDAITWKYKLESREIELKTTLEGKEKELANATSTLSKYES----- 557

Query: 1270 GLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
             + E   +  +   KY  +T KK  + V   ++++  E
Sbjct: 558  QIRELRSELTDVEMKY--STLKKSFEDVDDDAKIRSAE 593

 Score = 39.3 bits (90), Expect = 0.024
 Identities = 57/277 (20%), Positives = 110/277 (39%), Gaps = 24/277 (8%)
 Frame = +1

Query: 406  ISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK 585
            + +L     TL   I    +  ++  + K  +++    + +E+KDL +      ++  L+
Sbjct: 432  VEELESEIITLKTQINENEDWNSKLLQEKTNLEAQV--KNIEEKDLLKSEQITELEKKLQ 489

Query: 586  VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL------EEKTANNI 747
                +Q+  +    L+  E+LK+     ++    K  + S E +L       E++ AN  
Sbjct: 490  DAISSQKNTNTELSLKVEELLKTNSSLEKDAITWKYKLESREIELKTTLEGKEKELANAT 549

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQ 927
                 Y+ Q R  R   E  D++  YS   K  E      K     +T +N  +   + +
Sbjct: 550  STLSKYESQIRELR--SELTDVEMKYSTLKKSFEDVDDDAKIRSAEVTELNYKIDDLREK 607

Query: 928  FSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD------KNMKK-------- 1065
                E    +K  YI K    +K+E   K+DE ++    ++       N++K        
Sbjct: 608  VENLESSLQEKDDYINK----LKEELQSKKDEHSKTLLELESVHLKNNNIEKEHLAELEG 663

Query: 1066 ----IDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHL 1164
                + HLE  L+++T   N       + ED+K  +L
Sbjct: 664  LHESLSHLEEELKSKTICVNDMKDEISKLEDEKKEYL 700

>Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 57/270 (21%), Positives = 118/270 (43%), Gaps = 11/270 (4%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLYY------HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVD 615
            ++ N+K     SKN   S  Y      H+QL     NE+  ++ I+    +++  + +  
Sbjct: 329  YQLNQKLNSLISKNESISFQYEKLNKSHQQLIDSS-NERVEKLHIEREHSISRVEKFKKR 387

Query: 616  GRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLC 795
             ++   E +VL S  K ++E  DN  SIN L Q   ++   NNIL+R+   L E+     
Sbjct: 388  IKELNTEIKVLNSNQKILQEKFDN--SINELNQVKNDQYNTNNILQRNEKNLNEKNA--- 442

Query: 796  HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE 975
             E + ++ + S  +++       L +    +  +N+ +    +    KE + +   I ++
Sbjct: 443  -ELEKIKKELSTTLEKLSESQTTLNDLNSCIAQLNSKVGDTNSVLISKESELNNLKISLK 501

Query: 976  KYMSHVKQEYNKKE--DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED- 1146
            + +S + ++ N  +   + N L    +   +K+D L        +         ++DE  
Sbjct: 502  ETLS-ISKDSNDSDLIAQLNELISAKNSLQQKLDDLS---NLNDDNLKKLQEKLMEDETA 557

Query: 1147 --QKDAHLEDRYHKVKEFMEQKLQTSKNND 1230
              +KDA +     +++E   +K   SK+N+
Sbjct: 558  LRRKDAEINSLNSELEEL--KKHVISKDNE 585

>NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8.604
            YOR195W
          Length = 846

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 63/294 (21%), Positives = 126/294 (42%), Gaps = 9/294 (3%)
 Frame = +1

Query: 475  ECERSKN-----AIDSLYYHEQLEKKDLNEKSLQMAID----HLLKVTKQNQRQVDGRDK 627
            EC+  KN      ++S    ++L+ KD    S+   ++    H+ ++  +N R  +    
Sbjct: 421  ECDIWKNNYQTLELESTKLKDELKLKDTELNSISSQLNEIDRHMSELGDENVRLKN---- 476

Query: 628  LEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ 807
              E E L S +K IEE   +K S      + +EE      +      L+E  + L  E +
Sbjct: 477  --ENESLNSNLKIIEEKLHSKKSEVDQLNKTIEESLETQRINETSKNLKEEYETLLLEKE 534

Query: 808  DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS 987
            +L+   ++++++    + +L+N++    N   +L+  K +    ++Q   K     K + 
Sbjct: 535  ELEKKTNEQIEEHNRTIFELRNDITAKENEFKDLQDTKNEI---QEQLETK----TKELE 587

Query: 988  HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
             +K +Y    D+ N     V +  + +  L+ S   +T  + + S +    ++ K  +  
Sbjct: 588  ELKIQYEDVNDDANIKGAEVSELCEDLKELKES---KTYLEGTISKLETVVDEWKTKYET 644

Query: 1168 DRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTT 1329
                  K  +E +    +N+D    EAE L  +  L  N M +L+   K +STT
Sbjct: 645  QTTELKKVTVELESLQLRNSD---IEAEHLKELEHLHVN-MSSLQEMLKDHSTT 694

 Score = 34.3 bits (77), Expect = 0.86
 Identities = 47/196 (23%), Positives = 82/196 (41%), Gaps = 3/196 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQ-MAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEV-EDNKI 693
            ++LE   +N  SLQ M  DH   +T+            EE E LK  +K+ + +  +NK 
Sbjct: 672  KELEHLHVNMSSLQEMLKDHSTTITELQ----------EENENLKKMLKDSKTLFHENKE 721

Query: 694  SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
                 E +  E    NNI +R+   L++       E ++ ++ Y+   K           
Sbjct: 722  ENGEGEGEAPENNDENNIDKREIESLKK-------EVEEWKEKYNTHEKD---------- 764

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY-NKKEDECNRLKFVVD 1050
                 TN    L A+         QYS K+   E+ +  +K+ Y NK + E +RL     
Sbjct: 765  -----TNKRLKLLAEDLYI-----QYSSKH---EQKVKLLKKGYENKYQGELSRLNLQNS 811

Query: 1051 KNMKKIDHLERSLQAQ 1098
              +++++ L + L A+
Sbjct: 812  GLIEELEQLNKQLTAE 827

 Score = 32.7 bits (73), Expect = 2.6
 Identities = 37/188 (19%), Positives = 78/188 (41%), Gaps = 15/188 (7%)
 Frame = +1

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK 996
            +D ++      YE + LK     L N N  +     Q   + +    KY+ ++K  S+V 
Sbjct: 300  EDENEDEDLDNYEFKDLKKRNGTLANENYQINKRLNQTVSRLENIRYKYLEVKKDYSYVM 359

Query: 997  QEYNKK----EDECNRLKFVVDKNMKKIDHLERSL-----------QAQTNAQNSFSAVT 1131
            + +++K    +++ N+L    D    + ++L+  L           Q QT  QN +  V 
Sbjct: 360  EVFDEKTKDLKEQINQLSMERDDLSTRRENLKTKLKSCKDELLMLNQNQTILQNKYDTVV 419

Query: 1132 VQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
             + +  K+ +        K   E KL+ ++ N  S S+   +D  +  + +    L+  +
Sbjct: 420  NECDIWKNNYQTLELESTKLKDELKLKDTELNSIS-SQLNEIDRHMSELGDENVRLKNEN 478

Query: 1312 KYYSTTTK 1335
            +  ++  K
Sbjct: 479  ESLNSNLK 486

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
            YDR356W
          Length = 970

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 58/289 (20%), Positives = 120/289 (41%), Gaps = 23/289 (7%)
 Frame = +1

Query: 292  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 471
            + + +    DD   E ++A+   Y   +I T  + I+      +  +T+   +  E   K
Sbjct: 455  EQQNKLIATDDQLNEKHEALKSEY---DIITSELKITK-----KKLDTVNFELKKELELK 506

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV-L 648
                 SK  ++       LE  D + +   +  + LL+ T  +    + R K+   E+ +
Sbjct: 507  KRINNSKQRLEDQVKSLTLEISDKHSEISDLQ-EKLLEYTSNSD---NSRSKISGMELKI 562

Query: 649  KSFIKEIEEVEDNKISINSLEQQLLEEKTA-NNILRRDYYKL---QERGKRLCHEFQDLQ 816
            K+  KE+ E++ NK  +    ++L + K    + + R+  K+   +E   RL  E   LQ
Sbjct: 563  KALQKELVEIKKNKDILQESYEELKQSKLELQSNIDRNLEKISNQKEEISRLKIENDKLQ 622

Query: 817  DDYSKKMK---QKEYEVQKLKNEVKFLTNMNTNLKADKTQ-------FSQKEKQYSQKYI 966
                + +    + + E+++    V+ +T  N  L +D T           +  +  QK  
Sbjct: 623  QTNFENLNLSTKLQSEIEQSNEYVQTITEQNNKLTSDITSKIVRIDDLKNELNENKQKLN 682

Query: 967  YIEKYMSHVKQEYNKK--------EDECNRLKFVVDKNMKKIDHLERSL 1089
             +EK   H+K+  N +          + N L+++ +K  +   +LE+ L
Sbjct: 683  KLEKDYRHIKRSQNDRLPKLLSELNSKNNELQYIENKFKENEKNLEKQL 731

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 40/184 (21%), Positives = 81/184 (44%), Gaps = 5/184 (2%)
 Frame = +1

Query: 568  IDHLLKVTKQNQRQVD-GRDKLEETEVLKSFIKEIEE----VEDNKISINSLEQQLLEEK 732
            +++ LK+ KQ  R +    DK  +T VL S   E E     +E  K+ I  LE+ +    
Sbjct: 740  VNNELKLVKQKIRGLRINLDKEVDTGVLTSKKDERENQLRAIESYKLGIKELEKTIASLA 799

Query: 733  TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
                 L+  Y    + GKR   + +D   ++ ++  ++E +++KL +E+K+      ++ 
Sbjct: 800  DDAQPLKNLY----DEGKRSLMKAKDELSEFKERASKRESKIEKLTDEIKYYEGKKLDML 855

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
               T   Q     S     ++K +   K+    ++     L    ++  K++D + +S+Q
Sbjct: 856  ETITGIEQNITSLSDG---LKKQVESAKRFCTLEQSNSEELPNDQEEIKKELDRISKSIQ 912

Query: 1093 AQTN 1104
               N
Sbjct: 913  RVEN 916

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
            YFR031C
          Length = 1171

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 57/292 (19%), Positives = 125/292 (42%), Gaps = 34/292 (11%)
 Frame = +1

Query: 499  IDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQR----QVD---GRDKLEETEV---- 645
            +D   Y+E  +K    EK L   I+ L +    +QR    Q D    R KL   +     
Sbjct: 679  LDIQRYNESSQKLQSTEKELNEVINSLKQQELNSQRTKVIQNDLNLARHKLSLAQRSIGA 738

Query: 646  --LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ--------ERGKRLC 795
                   K+ EE+      I+  +Q +++ +     L+ D  +++        +RG +L 
Sbjct: 739  NNASQIAKKNEELHHE---ISECQQGIIDNQRLMKTLQEDVERIKRDMDEFSHDRGSKLN 795

Query: 796  H---EFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE-------- 942
                E  DL +  +K+ K  E+E +K +N    +  +N+ +K+D+      E        
Sbjct: 796  ELKLEINDLTESINKQEKISEHEYEKYQNLQVEIEQLNSEIKSDEESLKVTEMNLDKLLK 855

Query: 943  --KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNS 1116
               +  + +  ++K +  ++ E    ++E NRL   +D+ +K++++L   ++ +  A+N 
Sbjct: 856  DKSEIEKNFSSLDKSLVDIRGEL---DEERNRL-LGLDEELKELENL---IKLKIEAKNG 908

Query: 1117 FSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLG 1272
            +       E QK AH   +     + +++K++          + + ++ ++G
Sbjct: 909  YEL-----EYQKLAHDLSKSKANTDSIQKKIEELIKEHDWLQDKDLVEGIIG 955

>Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL091W
            (REAL)
          Length = 1244

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 66/334 (19%), Positives = 126/334 (37%), Gaps = 8/334 (2%)
 Frame = +1

Query: 286  GFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKH------ISISSISDLAQTFETLAVG 447
            G D + RF   DD   E +DA++  +   +   +H      +S  S  ++    E ++ G
Sbjct: 484  GIDEKNRFSQFDDEHSETHDALHLNHDSRHKQQEHHHHHHNVSTHSDDEVVSEEEYISDG 543

Query: 448  ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK 627
              H    +              YH Q    D +E  L+           +     +  ++
Sbjct: 544  DLHHDPHQD-------------YHHQDGIIDEDEDDLE-----------EGDEDEEHDEE 579

Query: 628  LEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ 807
             +E +   S + E + +E+ +  I     +LL+ +     +   Y++ Q    RL    +
Sbjct: 580  EDEEDAYDSGLDETDRLEEGRKLIQIAITKLLQSR-----IMASYHEKQADNNRL----K 630

Query: 808  DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS 987
             LQ+   +K K++E E +K K   K                 +KEK+  Q+         
Sbjct: 631  LLQELEEEKRKKREKEEKKQKKREK-----------------EKEKKRLQQLAK------ 667

Query: 988  HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
              ++E  KKE+E  RLK  +++   K    +R    +   +         +E Q+   ++
Sbjct: 668  --EEEKRKKEEEQERLKKELEEREMKRREAQRKKVEEAKRRKDEERKRRLEEQQRREEMQ 725

Query: 1168 DRYHKVKEFMEQKLQTSKN--NDPSCSEAEALDN 1263
            ++  K KE  ++K +  K    +    E E L N
Sbjct: 726  EKQRKQKEEQKRKREEEKKRIREEKRLEQEKLQN 759

>KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1301

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 70/312 (22%), Positives = 137/312 (43%), Gaps = 43/312 (13%)
 Frame = +1

Query: 496  AIDSLYYHEQLEKKDL--NEKSLQMAIDHLL------KVTKQNQRQVDGR--DKLEETEV 645
            AID+L    ++ KKD+  + K L+ +++HL       K TK++   ++ +  +  E+ + 
Sbjct: 187  AIDNL----KIIKKDMAVDIKLLKQSVEHLKVDRDRSKNTKRSLHNLEAKYAEYQEDVKA 242

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEE----KTANNILRRDYYKLQERGKRLC---HEF 804
            ++  + +I    D     N   Q++L +    KT  ++   +  +L      +     E 
Sbjct: 243  IEVKLNDITRRSDELFKSNQDFQEVLSKSENLKTLESLTSNEIERLSSSINAINLGKSEL 302

Query: 805  QDLQDDYSKKMKQKEYEVQKLKNEV--------KFLTNMNT------NLKAD-------K 921
            QDL D++S  + +KE EVQ+ + E+        +F  N N+       L+A+       K
Sbjct: 303  QDLLDNFSNTLHEKELEVQRFEEELFAMKDKSKEFQNNSNSLARRQGELEAELNKYALNK 362

Query: 922  TQFSQKEKQYSQKY---IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
            T+ +  + Q S +Y   + +E   + + Q  + KE  C+ L    +   +KI   E  L 
Sbjct: 363  TRLTDLQSQMSTRYGFEVSVEA-SNFIDQLKHYKEKFCSDLDRFEETESQKIKDQEEKLS 421

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEF--MEQKLQTSKNNDPSCSEAEALDNV 1266
                +       TVQ + + D +  D+   + E   ME ++ TS+ ++    + + +   
Sbjct: 422  KVIYSD------TVQAQ-KLDYYKADKNKLLDEISNMESEIITSEYSEDDLEKEKKI--- 471

Query: 1267 LGLIENTMKTLE 1302
              L E T+K  E
Sbjct: 472  --LAETTLKLEE 481

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 63/283 (22%), Positives = 114/283 (40%), Gaps = 17/283 (6%)
 Frame = +1

Query: 526  LEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI-KEIEEVEDNKISIN 702
            L K  L+ K LQ+      +   +N  Q+   +K    +   +F  K++E V D+ IS  
Sbjct: 748  LSKNLLDNKVLQLETSLSERELPKNT-QIKNEEKEPAKQQTYTFERKKLESVNDSDISYL 806

Query: 703  SLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
              E  L E +     LRR+  ++QE           L++ Y+K     +    KL +   
Sbjct: 807  YYEN-LEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYT 865

Query: 883  FLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNR----LKFVVD 1050
             L   N+ L    +Q   KEK+ ++    + +    ++   N+  ++ N     L+ +V+
Sbjct: 866  TLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTEKLQMAENENSEKINNAIVLLQTMVE 925

Query: 1051 KNMKKID---HLERSLQAQTNAQNSFSAVTVQDE-------DQKDAHLEDRYHKVKEFME 1200
            +N    D   H + SL     A NS    ++  E       D  +  LE+   K+  F  
Sbjct: 926  ENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDG 985

Query: 1201 QKLQTSKNNDPSCSEAEALDNVLGLI--ENTMKTLEGNSKYYS 1323
            +  +  ++ D       A+ +++  +  E  M  L  NS  YS
Sbjct: 986  KVTEILESYDGKILNTAAIGHLVRSLIHEKKMLALNLNSANYS 1028

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 62/312 (19%), Positives = 125/312 (40%), Gaps = 4/312 (1%)
 Frame = +1

Query: 415  LAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTK 594
            L Q+   L   +T  +  K +    +  +DS+   ++L   +   K LQ      +K+ +
Sbjct: 145  LEQSKLELQDSLTENSALKEQIGVFEGKLDSMT--QELWLANTENKKLQTG----MKLLR 198

Query: 595  QNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQ 774
            +N   ++   K +ET+  K      E+    +  +  +  ++L  K+    L+     L 
Sbjct: 199  ENNLYLE--IKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLS 256

Query: 775  ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYS 954
               +R     +DL D+ +   ++   E+   +   + L N   + K    + + K  +  
Sbjct: 257  TDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETP 316

Query: 955  QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
            +K I  E  +  +K++    E ECN LK  VDK +  ID  E+ L ++         +  
Sbjct: 317  EKKIIQE--LVDLKEKLVNSEKECNELKSTVDKYI-NID--EKKLISKFGNPKKLIEILR 371

Query: 1135 QDEDQKDAHLEDRYHKVKEF---MEQKL-QTSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
            +   ++  H +    +V+ F   +EQKL       + + S    L  +   +E T K  +
Sbjct: 372  RQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERD 431

Query: 1303 GNSKYYSTTTKK 1338
               +  +   KK
Sbjct: 432  IKDRELTNLQKK 443

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 52/213 (24%), Positives = 90/213 (42%), Gaps = 34/213 (15%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKS--LQMAIDHLLKVTKQNQRQVDGRDKLEETEVL 648
            ECE  K  I SL   +Q  + DLN+K+  LQ++   L   T++N+   +    LEET  L
Sbjct: 1669 ECESLKGKIVSLTKIKQELESDLNQKTDALQISNAALSSSTQKNKEITEKIKYLEETLQL 1728

Query: 649  K--SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRL---------- 792
            +     +  E V+  + S N  + +  +EK  N  L  +   LQ+    L          
Sbjct: 1729 QMEQNSRNGELVKTLQASCNGYKDKFDDEKQKNIDLYEENQTLQKLNTDLQLQLKNLHER 1788

Query: 793  -------------CHEFQ-------DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLK 912
                          HE +       DL+ +  KK K  E  V++L+ +    T++     
Sbjct: 1789 LSDTTEKNAWLSKIHELENMVSLETDLKYEEMKKNKSLERAVEELQTKNSQQTDVIELAN 1848

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
             ++++F +   +Y  +   +EKY+S  + E  K
Sbjct: 1849 KNRSEFEEATLKYEAQISDLEKYISQQELEMKK 1881

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 68/320 (21%), Positives = 127/320 (39%), Gaps = 64/320 (20%)
 Frame = +1

Query: 439  AVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG 618
            A+   H   RK + E S ++ D   Y  + E  +   KSL+   D L  +  +++  +  
Sbjct: 1344 AISALHSKFRKIQGESSLSSSD--IYKLKFEASEERVKSLE---DKLKTMPLRDRTNLPV 1398

Query: 619  RDKLEETEVLKSFIKEIE--EVEDNKIS---------INSLEQQLLEEKTANNILRRDYY 765
             D ++  + +  + +EI   ++E+ K+          ++ L   L + K+   +L     
Sbjct: 1399 GDIIKNRDSISKYEEEIRYYKLENYKLQEILNESNGKLSQLTLDLRQSKSKEALLSEQLD 1458

Query: 766  KLQ------ERGKRLC--------HEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNT 903
            +LQ      ER K L          +F++  DD      +    +  LK   + + NM +
Sbjct: 1459 RLQKDLESTERQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIHALKQAEEDVKNMAS 1518

Query: 904  NLKADKTQFSQKEK--------------QYSQKYIYIEKY----------MSHVKQEYNK 1011
             ++  KTQ  QKEK              Q  +  + +++           ++H+K+  + 
Sbjct: 1519 IIEKLKTQNKQKEKLIWEREMERNDSDMQLQETLLELKRVQDVKKILSDDLAHLKERLSA 1578

Query: 1012 KE------DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV------TVQDEDQKD 1155
             E      DE NRLK          + L  SL+A+TN +  F+ +      +  D + K 
Sbjct: 1579 VEDRSQYTDEINRLK----------EELNCSLKAETNLKKEFATLKYKLETSTNDSEAKI 1628

Query: 1156 AHL---EDRYHKVKEFMEQK 1206
            + L    D Y KV E +  +
Sbjct: 1629 SDLLKQLDHYTKVVEMLNNE 1648

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 48/213 (22%), Positives = 99/213 (46%), Gaps = 11/213 (5%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISIN 702
            QL +   N + ++    +  + TK+ +++   R+ L E+ +  S IKE+E     +IS+N
Sbjct: 1139 QLTEYKSNYQKIKEEYSNFQRETKEQEQKK--RNSLVES-LNDSKIKELEARLSQEISLN 1195

Query: 703  S-LEQQLLEEKTANNIL---RRDYYKLQERGKR-LCHEFQDLQDDYSKKMKQKEYEVQKL 867
              L +++       NI    R   Y      K  +  ++ DLQ  +++  +  E E+++ 
Sbjct: 1196 QYLNKRISGNSVETNISSTRRSTSYSDDPLDKEDIIKKYYDLQLAFTEITRNLENEIEEK 1255

Query: 868  KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQE--YNKKEDECNRLKF 1041
            KN +  L    T L +   +  + + Q  +    I+     +  +   N+  D C   + 
Sbjct: 1256 KNLISRLRFTETRLASSSFEDQKIKAQMKKLKKLIQDMDPSIPLDSILNEPLDNCPDKES 1315

Query: 1042 VVDKNMKKIDHLERSLQAQT----NAQNSFSAV 1128
             ++K M ++D+L+R L  +T    +A+N+ SA+
Sbjct: 1316 DINKLMLEVDYLKRQLDIETRAHYDAENAISAL 1348

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 74/362 (20%), Positives = 141/362 (38%), Gaps = 57/362 (15%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHE--------QLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRD 624
            K + ++ +N +D L  +E         L++ + + K++   I+ L    KQ ++ +  R+
Sbjct: 1479 KQQKQQFENCMDDLQGNELRLREHIHALKQAEEDVKNMASIIEKLKTQNKQKEKLIWERE 1538

Query: 625  --KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTAN----------NILRRDYYK 768
              + +    L+  + E++ V+D K  ++     L E  +A           N L+ +   
Sbjct: 1539 MERNDSDMQLQETLLELKRVQDVKKILSDDLAHLKERLSAVEDRSQYTDEINRLKEELNC 1598

Query: 769  LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
              +    L  EF  L+          E ++  L  ++   T +   L  +K   S  EK+
Sbjct: 1599 SLKAETNLKKEFATLKYKLETSTNDSEAKISDLLKQLDHYTKVVEMLNNEKDAISLAEKE 1658

Query: 949  YSQKY--------------IYIEKYMSHVKQEYNKKEDECN----RLKFVVDKN---MKK 1065
              QKY              + + K    ++ + N+K D        L     KN    +K
Sbjct: 1659 LYQKYEALNTECESLKGKIVSLTKIKQELESDLNQKTDALQISNAALSSSTQKNKEITEK 1718

Query: 1066 IDHLERSLQAQ--TNAQNSFSAVTVQ-----------DEDQKDAHLEDR---YHKVKEFM 1197
            I +LE +LQ Q   N++N     T+Q           DE QK+  L +      K+   +
Sbjct: 1719 IKYLEETLQLQMEQNSRNGELVKTLQASCNGYKDKFDDEKQKNIDLYEENQTLQKLNTDL 1778

Query: 1198 EQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKE 1377
            + +L+         +E  A  + +  +EN M +LE + KY      K L+      + K 
Sbjct: 1779 QLQLKNLHERLSDTTEKNAWLSKIHELEN-MVSLETDLKYEEMKKNKSLERAVEELQTKN 1837

Query: 1378 NE 1383
            ++
Sbjct: 1838 SQ 1839

>CAGL0H00638g Chr8 complement(61015..62769) [1755 bp, 584 aa] {ON}
            weakly similar to uniprot|Q12045 Saccharomyces cerevisiae
            YPL253c VIK1
          Length = 584

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 46/198 (23%), Positives = 90/198 (45%), Gaps = 6/198 (3%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            E+ K A+ S    E  E ++  ++ ++       ++ ++ Q     R+K+EE   +    
Sbjct: 95   EKEKTALSSKNLAELTEIENKYKEVIEQKAAEFSQIFEKQQNA--WREKIEELRNMPPED 152

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYK------LQERGKRLCHEFQDLQDD 822
            + I ++ + K +++S EQ  LE+K A N      YK        E  K+     ++LQ  
Sbjct: 153  ELINQINNLKHTLSSTEQN-LEDKIAKNDNDLILYKQKLQVSFSEYKKKNSTSLEELQSQ 211

Query: 823  YSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQE 1002
             SK ++    E+Q +K      T  N+ L+    + S+ E+    K + ++K  + ++  
Sbjct: 212  -SKNLESTMAELQNIK------TEKNSQLRTLAEEQSELERIVMDKQLQVDKLNAEIEPV 264

Query: 1003 YNKKEDECNRLKFVVDKN 1056
             NK ++  N   FV+ KN
Sbjct: 265  ENKIKEYQN--SFVLLKN 280

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 41/206 (19%), Positives = 91/206 (44%), Gaps = 10/206 (4%)
 Frame = +1

Query: 583  KVTKQNQRQVDGRDKLEET--EVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRR 756
            K+ K +   +  + KL+ +  E  K     +EE++    ++ S   +L   KT  N   R
Sbjct: 175  KIAKNDNDLILYKQKLQVSFSEYKKKNSTSLEELQSQSKNLESTMAELQNIKTEKNSQLR 234

Query: 757  DYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQ 936
               + Q   +R+  + Q   D  + +++  E ++++ +N    L N   +++  K +   
Sbjct: 235  TLAEEQSELERIVMDKQLQVDKLNAEIEPVENKIKEYQNSFVLLKN---DIEGMKIKAID 291

Query: 937  KEKQYSQKYIYIEKYMSHVKQEYNKKED--ECNRL--KFVVDKNMKK--IDHLERSLQAQ 1098
             E+QY++ Y  + + +S  ++  N   +   C RL    + D+  +K  +++ + S++  
Sbjct: 292  NEQQYNEVYDTLGEELSRRRRLLNSITELKGCARLFANIIEDEISEKLIVNYSDESIEDM 351

Query: 1099 TNAQNSFSAVTVQD--EDQKDAHLED 1170
             N +       +Q+     KD   ED
Sbjct: 352  KNHKTYKFTKLIQNFSHQNKDLFKED 377

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 57/258 (22%), Positives = 108/258 (41%), Gaps = 5/258 (1%)
 Frame = +1

Query: 298  ERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAE 477
            +R     +D FK++N  +          T     S   +L     +L   I   T +K +
Sbjct: 429  QRETNKLEDNFKQMNKKIVSIKEDMKNNT-----SKKRELQNKKASLEEKIKSYTRKKEK 483

Query: 478  CERSKNAIDSLY--YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV-L 648
              +S      L   Y  ++E  +++++  +  +  LL   K+       ++ LEE ++ L
Sbjct: 484  ASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKE------KNVLEEIKLSL 537

Query: 649  KSFIKEIE-EVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
            K    +I  E+  ++  +   ++QL E+K    +       LQE   +L  E + L++D 
Sbjct: 538  KDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDL 597

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
              + + K       KN+ + L ++     A  T+F + E + +     I K M HV Q  
Sbjct: 598  KCQFENK-------KNQEEKLIDLKVQFSAISTEFDRGESECANAKSKI-KDMQHVLQTQ 649

Query: 1006 NKK-EDECNRLKFVVDKN 1056
             +K  D  +RL  V +K+
Sbjct: 650  RQKVMDARSRLATVENKS 667

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 66/303 (21%), Positives = 130/303 (42%), Gaps = 43/303 (14%)
 Frame = +1

Query: 508  LYYHEQLEK--KDL--NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI----- 660
            +Y ++ +EK  K+L   E + + A D   ++ +  QR  D + +LE  E+ K  +     
Sbjct: 842  IYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELE-LEISKCLMDTDIS 900

Query: 661  -KEIEEVEDN-KISINSLEQ------QLLEEKTANNILRRDYYKLQERGKRLCHEFQ--- 807
             KE+E  +D  K  I   E+      +++E +   N+L+++Y  L +  K +  +     
Sbjct: 901  SKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDKLK 960

Query: 808  ---------DLQDDYSK-----------KMKQKE--YEVQKLKNEVKFLTNMNTNLKADK 921
                     DLQ   SK           K KQK     ++K++NE++      +  + D 
Sbjct: 961  KRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDF 1020

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
               S++   +SQ+   +E+ +  + + + K E+E + L+       +KI+  E     + 
Sbjct: 1021 KTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAE----IEG 1076

Query: 1102 NAQNSFSAVTVQDEDQKDAHLEDRYHKV-KEFMEQKLQTSKNNDPSCSEAEALDNVLGLI 1278
                S+  + V+D  +K  +L     +V KE+ EQ       N  +    E  +N +  +
Sbjct: 1077 TKFKSYE-IDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGV 1135

Query: 1279 ENT 1287
            + T
Sbjct: 1136 DRT 1138

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 43/225 (19%), Positives = 98/225 (43%), Gaps = 6/225 (2%)
 Frame = +1

Query: 568  IDH----LLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKT 735
            +DH    +L+   +N  Q+  + + E  + L  ++++I    D K   +S+E+  +E  T
Sbjct: 290  LDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYK---SSIEKNTIEVDT 346

Query: 736  ANNIL--RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNL 909
             N I   + + +++ ER K      ++   ++ KK ++      KL             L
Sbjct: 347  LNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKL-------------L 393

Query: 910  KADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 1089
            + +  +  +K     QK   +++   +   ++   + E N+L+    +  KKI  ++  +
Sbjct: 394  QYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDM 453

Query: 1090 QAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKN 1224
            +  T+ +        ++   K A LE+   K+K +  +K + SK+
Sbjct: 454  KNNTSKK--------RELQNKKASLEE---KIKSYTRKKEKASKS 487

>AEL015W Chr5 (608518..609885) [1368 bp, 455 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YOL069W (NUF2)
          Length = 455

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 71/319 (22%), Positives = 122/319 (38%), Gaps = 43/319 (13%)
 Frame = +1

Query: 502  DSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE 681
            D + Y EQ +K  L E  L+   ++LL    Q  ++    D LE  E             
Sbjct: 149  DGVRYLEQTDKL-LKELRLKFDANNLLHSRVQKYKEFQKSDDLEALE------------S 195

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKR-------LCHEFQDLQDDYSKKMK 840
            DNK    ++E +L         L  DY + +   +R       L +E  +L+ +  K  K
Sbjct: 196  DNK----NMESELRHLNQVQETLTVDYERYKAEKQRHLSELETLGYELIELESERDKLRK 251

Query: 841  QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK---------QYSQKYIY-IEKYMSH 990
              + + + L+  V+ L+ +    +    +  QK+K         Q S + +Y + + +S 
Sbjct: 252  YSQTDAEVLRKGVRELSLLLEQQQVQLEKLEQKQKNLQISFETFQASTQELYEVLQIVST 311

Query: 991  VKQEYNKKEDECNRLKFVVDKN------------MKKIDHLERSLQAQTNAQNSFSAVTV 1134
              Q+ + KE      K  + +N            M KI  L+  L +Q          T 
Sbjct: 312  DLQDSHLKESTLLDAKHKLMQNHKNLNNLLSAGIMAKITLLQEQLDSQKRKLAELELNTQ 371

Query: 1135 QDEDQKDA--------HLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEA------LDNVLG 1272
              E +  A        H +D   +V+  +EQ+ +T   +  +  E++        DN + 
Sbjct: 372  AKESENSATLKRLRKQHTDDVLPEVRN-IEQRYKTKVADTITNYESQMRNIKVDFDNEVA 430

Query: 1273 LIENTMKTLEGNSKYYSTT 1329
            LIEN    L  + K Y TT
Sbjct: 431  LIENECSLLFNHIKNYMTT 449

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 86/462 (18%), Positives = 175/462 (37%), Gaps = 99/462 (21%)
 Frame = +1

Query: 295  YERRFETRDDTFKEVNDAVNRCYALCNIPTKHI----------------SISSISDLAQT 426
            YE    T ++T KE+ND + +      + ++ +                 +  I  L   
Sbjct: 899  YEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPK 958

Query: 427  FETLAVGITHET----NRKAECERSKNAIDSL----YYHEQLE----------KKDLNEK 552
             +  A+ +  ++    N+    +     ID +      H+++E           KDL+  
Sbjct: 959  LKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSAL 1018

Query: 553  SLQMAIDHL-----LKVTKQN----QRQVDGRDKL---EETEVLKSFIKEIEEVEDNKIS 696
             L++  + L     LK TK +    Q  +D  ++    E+ +  +  I  IE+ E  ++ 
Sbjct: 1019 VLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVE 1078

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYS------KKMKQKEYEV 858
             NS   + +++ T  N   ++Y KL      L HE   L+   +         KQK   +
Sbjct: 1079 -NSALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANL 1137

Query: 859  QKLKNE-------------------------VKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
            +K  N+                         +K +  +N  LK + T   +  K+ ++K 
Sbjct: 1138 EKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNI-LKENNTILQKSLKKVTEKN 1196

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFS---AVTV 1134
              I K  + ++ E ++ + +  + K  V  N  K+   E  ++      ++ S     T 
Sbjct: 1197 EAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETH 1256

Query: 1135 QDEDQK------------------DAHLEDRYHKVKEFMEQKLQTSKNNDPS-CSEAEAL 1257
            +DE +K                  +A L D+++++K+   +KL  SK    +  +E + L
Sbjct: 1257 KDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDEL 1316

Query: 1258 DNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
             ++   +E ++ + E          KK L    G S+ +E +
Sbjct: 1317 KDMKNELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEED 1358

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 69/329 (20%), Positives = 134/329 (40%), Gaps = 24/329 (7%)
 Frame = +1

Query: 466  RKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV 645
            ++ E E S   +++    ++L K+ L  K  Q      L+     +     ++ L +T +
Sbjct: 619  KELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRI 678

Query: 646  --LKSFIKEIEEVEDNKI--SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL 813
              LK+ +++      + I  SI S E +L + K     L  +   L ++   L    + L
Sbjct: 679  DDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESL 738

Query: 814  QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
              D  +  K+K     KL       T   T+    K +   K+ QY+ K   +EK    +
Sbjct: 739  TRDLERCCKEKMQLQMKL-------TESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEEL 791

Query: 994  KQEYNKKEDECNRLKFVVDKNMK----KIDHLERSLQA-QTNAQNSFSAVTVQDEDQKDA 1158
                + K  E   L+   +  +K     ID  E+++++  T+     + +     + KD 
Sbjct: 792  NNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDL 851

Query: 1159 HLEDRYHK--------------VKEFMEQKLQTSK-NNDPSCSEAEALDNVLGLIENTMK 1293
             +E +  K              ++  ++++L+ S+ +   + S+ EA + ++   ENT+K
Sbjct: 852  EIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLK 911

Query: 1294 TLEGNSKYYSTTTKKCLKYVTGSSRLKEN 1380
             L        T TK+ LK V   S  +EN
Sbjct: 912  ELNDQ----LTKTKEELK-VKSQSLDEEN 935

 Score = 38.1 bits (87), Expect = 0.060
 Identities = 52/205 (25%), Positives = 92/205 (44%), Gaps = 32/205 (15%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR--DKLEETEVL---KSFIKEIEEVEDNKI 693
            E K L  K L+M  +++L+  K N   +  +    ++E E++   K +++E     D K 
Sbjct: 145  ENKLLRRKLLEM--ENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKT 202

Query: 694  SINSLEQ----QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQ 861
             ++ + +    Q LEE+   N  + DY  +    + L  + + L    S  M+QK  E++
Sbjct: 203  LVDDVTRTSHVQNLEEQL--NRTQNDYESVSTNNQFLLAQNKQL----SHSMEQKILEIK 256

Query: 862  KLKN-----------EVKFLTNMNTNLKADKTQF------SQKEK------QYSQKYIYI 972
             LK+           E+    NMN  L++  T F      S +EK      + SQ    +
Sbjct: 257  NLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVV 316

Query: 973  EKYMSHVKQEYNKKEDECNRLKFVV 1047
            +K +   K +  K +DEC RL+ +V
Sbjct: 317  DKLID-TKLQLEKSKDECQRLQNIV 340

>KLLA0C14586g Chr3 complement(1274520..1275944) [1425 bp, 474 aa] {ON}
            similar to uniprot|Q12153 Saccharomyces cerevisiae
            YDR312W SSF2 high copy suppressor of G beta subunit
            temperature sensitive mutation possibly involved in
            mating
          Length = 474

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 50/187 (26%), Positives = 79/187 (42%), Gaps = 10/187 (5%)
 Frame = +1

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY-SKKMKQKEYE 855
            ED +  +N  E+Q  EE+ +    ++   KL E G RL  +   +++   + K+   EY 
Sbjct: 306  EDEEEDLNVKEEQEEEEQHSTQQPKKKAIKLTEIGPRLTLKLVKIEEGICAGKVLHHEY- 364

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
            V+K  +E+K L                 EK+++QK            +E  KKE E N  
Sbjct: 365  VKKSDSEIKAL-----------------EKRHAQKMRL---------KEQRKKEQEENIA 398

Query: 1036 KFVVDKNMKKIDHLERSL---QAQTNAQNSFSAVTVQD------EDQKDAHLEDRYHKVK 1188
            K    K  KK   LER     +A  N ++   A + QD       D +++  ED Y  V 
Sbjct: 399  KKKAAKEAKKQRKLERRKAREEAAANGEDGEEAESGQDNSDSDSSDSEESSSEDNYSDVP 458

Query: 1189 EFMEQKL 1209
            E ++  L
Sbjct: 459  EDLDSDL 465

>NCAS0J01230 Chr10 (215105..216064) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 40.8 bits (94), Expect = 0.005
 Identities = 51/267 (19%), Positives = 109/267 (40%), Gaps = 32/267 (11%)
 Frame = +1

Query: 664  EIEEVEDNKISINSLEQQLLEEKTAN----NILRRDYYKLQERGKRLCHEFQDLQDDYSK 831
            ++E ++  +       + LLE K       ++LR +   L      L HE + L   Y++
Sbjct: 34   QLETLQTERKDFEERLKYLLESKKLMTGHLSLLREEVEDLDSNNSSLIHENEQLLQKYNR 93

Query: 832  KMKQKEYEVQKLKNEVKF--LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS------ 987
                KE + Q LK  V +  L  M   L  +K    +  ++   +   I++  +      
Sbjct: 94   LKWIKENKDQNLKLRVNYKELEIMLKRLSDEKILLRKVTEEMQLRITNIKRERNESESQE 153

Query: 988  -HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHL 1164
             ++ +E NK++ E NRL   + +  KK   LE   +++ + Q       ++  D K   L
Sbjct: 154  FYLLEEINKQKTEVNRLTNFIQEGQKKKSELEEVQRSENSRQEQL----IKKLDIKSTTL 209

Query: 1165 EDRY--------HKVKEFMEQKLQTSKNNDP----------SCSEAEALDNVLGLIENTM 1290
             ++         H  +E         K+ND             ++ + L+++L  I++ M
Sbjct: 210  NEKLKNLRKQNDHNNEELRTMACLVEKHNDRFRGWKEKETLLINQTKELESLLKKIDDQM 269

Query: 1291 KTLEGNSK-YYSTTTKKCLKYVTGSSR 1368
              +  ++K + S   +  + Y++ +++
Sbjct: 270  FEVNKSAKDHRSKINQTNITYISNATK 296

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
            Anc_3.479 YPR141C
          Length = 698

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 41/190 (21%), Positives = 87/190 (45%), Gaps = 8/190 (4%)
 Frame = +1

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            +D+ + +N L+++L ++K   + LR +  + Q +       +QDLQ ++ K  K+K  + 
Sbjct: 61   KDSMMELNQLQEELFQKKAKLDYLRDELNENQGK-------YQDLQMEWEKLYKEKNLKQ 113

Query: 859  QKLKNEVKFLTNMNTNLKADKTQFSQK--EKQYSQKYIYIEKYMSHVKQEYNKKEDECNR 1032
            Q+L+ +   L  +N  L  +K +F  +  E    Q         + +  +Y  K ++  +
Sbjct: 114  QQLQLKENELVKLNEKL-INKQKFLNEGHELHLQQLKAKNTAERNKISNDYRVKIEKLKQ 172

Query: 1033 LK---FVVDKN--MKKIDHLERSLQAQTNA-QNSFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
            +K   F   +N  + K++  +  +     A QN    V   +   K+  L+  + + KE 
Sbjct: 173  VKIKRFEDQRNELLNKVEDFKNKILTNDEALQNMLDEVEESNRKIKEEWLQKYHSEWKEN 232

Query: 1195 MEQKLQTSKN 1224
            +E   + SK+
Sbjct: 233  LELNEKISKD 242

>NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496 bp,
            831 aa] {ON} Anc_5.296 YDR285W
          Length = 831

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 62/325 (19%), Positives = 127/325 (39%), Gaps = 16/325 (4%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE 636
            E N  +  E + N I  L      + KD +E + Q+  +    +TK  +    G +    
Sbjct: 427  EKNWTSSNESNNNQILELLTKVITKVKDSDEGNHQLLTNIDENITKYKEALTKGEEYENR 486

Query: 637  TEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGK-------RLC 795
             + L++ +  +EE +   IS    +    EE     IL     ++ E GK       +L 
Sbjct: 487  IKHLENKLSALEEQKIANISALGTKDAQYEE--LEKILATKNIQISELGKVEKDLTTKLA 544

Query: 796  HEFQDLQDDYSKKMKQKEY---EVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYI 966
                DL++  S+    +E    +    +N++   T ++  L +D     ++  Q  +  I
Sbjct: 545  TLTCDLENSKSELENLRELTNTQKSNWENKIASQTEISNILTSDNAILKKRIIQLEESKI 604

Query: 967  YIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDED 1146
              E+   +   ++ K  ++  RL   V+    K   LE  L+    +          ++D
Sbjct: 605  KYEEEQFNRLDKFQKNNEQLQRLN--VELVQLKAHELE--LEEDNRSLKKQLEKNTNEQD 660

Query: 1147 QKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYST 1326
            +    ++    ++ + + ++  +  +N     + E L N++      M  LE   +   T
Sbjct: 661  ENACEVQSLKKQITQLISERQLSLSDNLDLKDKYEELQNIIKAKSQKMVVLEKRLEDRQT 720

Query: 1327 TTKKCLKYVT------GSSRLKENE 1383
            T +K  K V+        S+LK++E
Sbjct: 721  TDQKQKKKVSSPHFADNKSKLKQDE 745

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 47/235 (20%), Positives = 106/235 (45%), Gaps = 3/235 (1%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEK- 552
            + TK+I IS +  + +   T    +T       + E SK+ +++L      +K +   K 
Sbjct: 522  LATKNIQISELGKVEKDLTTKLATLT------CDLENSKSELENLRELTNTQKSNWENKI 575

Query: 553  SLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL--KSFIKEIEEVEDNKISINSLEQQLLE 726
            + Q  I ++L  T  N        +LEE+++   +     +++ + N   +  L  +L++
Sbjct: 576  ASQTEISNIL--TSDNAILKKRIIQLEESKIKYEEEQFNRLDKFQKNNEQLQRLNVELVQ 633

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN 906
             K     L  D   L+++ ++  +E    QD+ + +++  + ++ +L +E +   + N +
Sbjct: 634  LKAHELELEEDNRSLKKQLEKNTNE----QDENACEVQSLKKQITQLISERQLSLSDNLD 689

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID 1071
            LK    +     K  SQK + +EK +   +    K++ + +   F  +K+  K D
Sbjct: 690  LKDKYEELQNIIKAKSQKMVVLEKRLEDRQTTDQKQKKKVSSPHFADNKSKLKQD 744

 Score = 38.5 bits (88), Expect = 0.042
 Identities = 70/337 (20%), Positives = 135/337 (40%), Gaps = 68/337 (20%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEET- 639
            N+K + +     +DS   H ++EK     K+LQ  +  LL    +N +      K  ET 
Sbjct: 193  NKKLKVQIRNFEVDSGKIHTKVEKYHQLLKALQEKLKILLSERDKNSQDCAELKKTYETF 252

Query: 640  ------------------EVLKSFIKEIE--------EVEDNKISINSLEQQLLEEKTAN 741
                                LKS  K+ E        E+E  K  ++    QL EEK  N
Sbjct: 253  QEKITCYRNAISDMKGSISNLKSLKKDTELELMKKEKEIEYLKREVDDTSGQLSEEKIKN 312

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKK---------------MKQKEYEVQKLKNE 876
              L +++ K +E    L   F+  ++D  +K               M ++  E++K+ N+
Sbjct: 313  CSLLQEFTKTRE---TLKENFESQKEDLKEKTTSMENCLRTLFKDEMTKQLTEIEKISNQ 369

Query: 877  VKFLTNMNTNLKADKTQF-------------------SQKEKQYSQKYIYIEKYMSHVKQ 999
              F   +  N K+  T+F                    ++ +Q+ ++ I + + ++  ++
Sbjct: 370  -NFEAYLEENSKSLTTEFKNMFETHEGEEFSKMAKHHEEELEQFLEQKINVSQILNAFEK 428

Query: 1000 EY-NKKEDECNRLKFVVDKNMKKI-DHLERSLQAQTNAQNSFS----AVTVQDE-DQKDA 1158
             + +  E   N++  ++ K + K+ D  E + Q  TN   + +    A+T  +E + +  
Sbjct: 429  NWTSSNESNNNQILELLTKVITKVKDSDEGNHQLLTNIDENITKYKEALTKGEEYENRIK 488

Query: 1159 HLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVL 1269
            HLE   +K+    EQK+          ++ E L+ +L
Sbjct: 489  HLE---NKLSALEEQKIANISALGTKDAQYEELEKIL 522

>NCAS0G02950 Chr7 complement(541260..541910) [651 bp, 216 aa] {ON}
            Anc_2.234 YIL127C
          Length = 216

 Score = 40.0 bits (92), Expect = 0.006
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 2/169 (1%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISI 699
            +QL  +   +KS    ID  LK           R +L+E +V K   KE ++ + NKI  
Sbjct: 36   DQLTSRKKQKKSKAQLIDQNLKK----------RVELQERDVFKIKKKEKKQ-QKNKIKS 84

Query: 700  NSLEQQLLEEKTANNILRRDYYK--LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
              +E Q L++     +L++   +  L  R +   ++   L    +K  +  + E ++LK 
Sbjct: 85   RKVEHQQLDQLAKLEVLKKHKKEGTLTPREQEYLNKVIKLNTASAKSWELDDEEKEELKE 144

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKED 1020
              KF+         DKT  S+  K+ S++   ++++   +KQ  N   D
Sbjct: 145  IQKFIL--------DKTTSSRDLKRKSKRRNKVKQFKEDIKQSTNNVSD 185

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 57/287 (19%), Positives = 119/287 (41%), Gaps = 5/287 (1%)
 Frame = +1

Query: 493  NAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQN-----QRQVDGRDKLEETEVLKSF 657
            N  D L     L +  L EK+ Q+++     +  +N     + +++   K E  + L+  
Sbjct: 301  NDSDHLGSEFLLLQNKLKEKNSQISVLENNLIDSKNTATELKTRLENLQK-EYDDKLREK 359

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
            I +I +++DN   + S           N+ +R+D+ +++E    L             K+
Sbjct: 360  INQIHKLDDNIKQLKSERDSKYVSLDTNDKVRKDFERMRENNANL-----------DSKL 408

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
             Q   E +  ++++  L+N   + K       +++ Q       I++ +++  +E +   
Sbjct: 409  SQISNENKLFRDKISKLSNQLDDTK------RERDNQVELMKRRIDEIITNNNRENSIAA 462

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
            D+   ++   +K    I+ L+R L      Q + S  TV+D+       +    K K+ +
Sbjct: 463  DKSEEIR---EKQEAHINELQRKLNDTLKVQ-TLSISTVEDK------FKAEILKTKKEL 512

Query: 1198 EQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKK 1338
            E+  Q  + ++    E +       +IENT    E NSK   T  K+
Sbjct: 513  EENAQKLQKSEELVKELKR-----QVIENTTNASERNSKRLETKDKE 554

 Score = 37.4 bits (85), Expect = 0.097
 Identities = 66/352 (18%), Positives = 135/352 (38%), Gaps = 42/352 (11%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLY-YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL 630
            ++ N   E + + NA + L    EQL K      +L++  + LLKV      Q + R  L
Sbjct: 99   NKKNLIKELKENSNASNPLKEQQEQLSKLTTENYNLKLKCNSLLKVLNNVTDQGELRKSL 158

Query: 631  EETEVLKSFIKEIEE------------------VEDNKISINSLEQQLLEEKT-----AN 741
            E       F+ EIEE                   +D  I   +LE ++ E+++       
Sbjct: 159  E-------FLDEIEEWKSKYSTANSEFNLLKIKYDDLVIKFRNLESKVDEQESEVEDHTR 211

Query: 742  NILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADK 921
             I+ RD   LQ +  +L  E   L D      K+   + + + +  + +  +N+++   K
Sbjct: 212  CIIERD--NLQNKIDKLSEELGTLNDKLDTITKELIAKDELIASNEEDIKQLNSHIDTLK 269

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDE----------CNRLK------FVVDK 1053
                  E+   +K   ++K    +K   N   D            N+LK       V++ 
Sbjct: 270  NTIRGLEETIIEKDDNLKKQKDEIKTLNNNLNDSDHLGSEFLLLQNKLKEKNSQISVLEN 329

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAV--TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
            N+  ID    + + +T  +N        ++++  +   L+D   ++K   + K  +   N
Sbjct: 330  NL--IDSKNTATELKTRLENLQKEYDDKLREKINQIHKLDDNIKQLKSERDSKYVSLDTN 387

Query: 1228 DPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENE 1383
            D    + E +      +++ +  +   +K +     K    +  + R ++N+
Sbjct: 388  DKVRKDFERMRENNANLDSKLSQISNENKLFRDKISKLSNQLDDTKRERDNQ 439

>KLLA0D13948g Chr4 (1198201..1199046) [846 bp, 281 aa] {ON} weakly
            similar to uniprot|P40003 Saccharomyces cerevisiae
            YEL005C VAB2 Protein with a potential role in vacuolar
            function
          Length = 281

 Score = 40.4 bits (93), Expect = 0.006
 Identities = 42/194 (21%), Positives = 74/194 (38%), Gaps = 16/194 (8%)
 Frame = +1

Query: 628  LEETEVLKSFIKEIEEVEDNKISINSLEQQLLEE-----KTANNILRRDYYKLQERGKRL 792
            L +  +  +  KE+ ++ D+   I S  Q+ ++      K  NN +     KL+    +L
Sbjct: 44   LRQDHIFSNVAKEVNQISDDVAIIYSRLQEEIDTEQSQTKEVNNKINHSVKKLESSFSKL 103

Query: 793  CHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNL----------KADKTQFSQKE 942
                     D  K++KQ E +   +  +V+ + ++N  L          K D TQFS+  
Sbjct: 104  VKLRSKFTKDSDKQLKQFESKYSDIDKKVRIIRDVNEELLDYVTRNGSIKVDATQFSKIS 163

Query: 943  KQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQ-TNAQNSF 1119
            K   +++           +  N  E E N+      +N    + L  S   Q TN     
Sbjct: 164  KLLQERF----------PESSNTTETEANKDNSGQSQNEANSESLNSSYSRQSTNGS--- 210

Query: 1120 SAVTVQDEDQKDAH 1161
                 Q+  +KD H
Sbjct: 211  -----QNNAKKDYH 219

>TDEL0F01580 Chr6 complement(288032..291721) [3690 bp, 1229 aa] {ON}
           Anc_4.39 YLR313C
          Length = 1229

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 6/130 (4%)
 Frame = +1

Query: 451 THETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK- 627
           T E    +  + + N I +L  + +    D + K LQ  +++L K     Q Q+DG+D+ 
Sbjct: 247 TREIRNDSSSDINHNGIPTLAKNVEQRISDKDTKELQKELENLKKANDTLQSQLDGKDRE 306

Query: 628 LEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGK-----RL 792
           L+E    K+  K  E   + +  + SL  Q+      N  L++   +L+ + K     +L
Sbjct: 307 LDELRKQKTLSKHRESHTNFQKELTSLSSQVSTLSIENETLKQQISELELKAKTVGPAKL 366

Query: 793 CHEFQDLQDD 822
             +  +L DD
Sbjct: 367 SDDKHNLLDD 376

>KNAG0B03100 Chr2 complement(597560..598429) [870 bp, 289 aa] {ON}
            Anc_5.630 YOR036W
          Length = 289

 Score = 40.4 bits (93), Expect = 0.007
 Identities = 57/256 (22%), Positives = 102/256 (39%), Gaps = 3/256 (1%)
 Frame = +1

Query: 610  VDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKR 789
            VD  DK +  E +K     IE+V D  + ++++E+  L++     I+ R+  KL    K 
Sbjct: 67   VDKIDK-KSVENIKKVRTLIEKVNDLVVKVDNIEETSLDK---TQIISRE--KLNRDVKN 120

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNM---NTNLKADKTQFSQKEKQYSQK 960
               +FQ+ Q +Y+K MK    + Q   +E +        N     D  Q++  E  +SQ 
Sbjct: 121  SLQQFQNTQLEYTKVMKLINEKAQAKLDETQAAFRQEVENDTQSLDAQQYNNVENTFSQM 180

Query: 961  YIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD 1140
             I               + D  N  +FV  +N+ +    ER L+             + +
Sbjct: 181  VI---------------EMDPINNEEFVYQQNLIR----ERELE-------------ISN 208

Query: 1141 EDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYY 1320
             +Q    L + +H +   ++Q             +   +DN    IE  + T   ++K  
Sbjct: 209  IEQGIVDLNELFHDLGNVVQQ-------------QGSMVDN----IEANIFTAASHTKNA 251

Query: 1321 STTTKKCLKYVTGSSR 1368
            S   +K L+Y   SS+
Sbjct: 252  SQELQKALRYQRNSSK 267

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 73/321 (22%), Positives = 145/321 (45%), Gaps = 14/321 (4%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQ-----LEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGR 621
            E +  +  E  +N I++L    +     ++ K  + + LQ  +  L K  ++++ ++   
Sbjct: 834  EEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTY 893

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEK----TANNILRRDYYKLQERGKR 789
            + ++ET    S  KE+E+   +KI++     Q+ E K    T +  L++   KL E  K 
Sbjct: 894  NVMDETINDDSLRKELEK---SKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKD 950

Query: 790  LCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY 969
              ++ ++L D+ +      E ++  LK +   + N+N  L   K +  +KEK   +K I 
Sbjct: 951  FTNQIKNLTDEKTSL----EDKISLLKEQ---MFNLNNELDLQK-KGMEKEKADFKKRIS 1002

Query: 970  I----EKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQ 1137
            I     K +  VK EY  K          + K    +D  ++++ A T AQN++     +
Sbjct: 1003 ILQNNNKEVEAVKSEYESK----------LSKIQNDLD--QQTIYANT-AQNNY-----E 1044

Query: 1138 DEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKY 1317
             E QK A +     +++E    +L T K       + + L+     +EN +K    N K 
Sbjct: 1045 QELQKHADVSKTISELRE----QLHTYK------GQVKTLNLSRDQLENALKE---NEKS 1091

Query: 1318 YSTTTKKCLKYV-TGSSRLKE 1377
            +S+  +  L+ +   +SR+++
Sbjct: 1092 WSSQKESLLEQLDLSNSRIED 1112

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 62/329 (18%), Positives = 135/329 (41%), Gaps = 22/329 (6%)
 Frame = +1

Query: 415  LAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMA--IDHLLKV 588
            L       A+ + H +N K    +  NA +      + + + L ++ L +   I +LL  
Sbjct: 431  LENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLIT 490

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYK 768
               N    D +  L + E+   FI+ I + +D+ I+  S  Q+++ E+       ++  +
Sbjct: 491  ---NSVSNDSKGPLRKEEI--QFIQNIMQEDDSTIT-ESDSQKVVTERLVEF---KNIIQ 541

Query: 769  LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV-------------------KFLT 891
            LQE+   L    ++L D    K K+ +  +QK+++E                      + 
Sbjct: 542  LQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIE 601

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK-EDECNRLKFVVDKNMKKI 1068
             +   L+  KT    ++  YS   I   K ++  K++   + +D   R+  +  ++ + +
Sbjct: 602  ELQKELEELKTSVPNEDASYSNVTI---KQLTETKRDLESQVQDLQTRISQITRESTENM 658

Query: 1069 DHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA 1248
              L + +Q   ++++  S + +  E       E+R+  +   ++    T   ND      
Sbjct: 659  SLLNKEIQDLYDSKSDIS-IKLGKEKSSRILAEERFKLLSNTLD---LTKAENDQLRKRF 714

Query: 1249 EALDNVLGLIENTMKTLEGNSKYYSTTTK 1335
            + L N   +++   KT E  ++Y S  +K
Sbjct: 715  DYLQNT--ILKQDSKTHETLNEYVSCKSK 741

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 60/291 (20%), Positives = 112/291 (38%), Gaps = 42/291 (14%)
 Frame = +1

Query: 475  ECERSKNAI---DSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV 645
            E E  K ++   D+ Y +  +++    ++ L+  +  L     Q  R        E TE 
Sbjct: 606  ELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITR--------ESTEN 657

Query: 646  LKSFIKEIEEVEDNKISIN------SLEQQLLEE------------KTANNILRRDYYKL 771
            +    KEI+++ D+K  I+         + L EE            K  N+ LR+ +  L
Sbjct: 658  MSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYL 717

Query: 772  QERGKRLCHEFQDLQDDY---SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKE 942
            Q    +   +  +  ++Y     K+   E E+  LK E K   ++  NLK +  + S ++
Sbjct: 718  QNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEK 777

Query: 943  KQYSQKYIYI-------EKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
                     +       E  +   ++   KK DE       + K   + DH  + L+   
Sbjct: 778  DSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDN 837

Query: 1102 NA-----QNSFSAV------TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSK 1221
            N+     QN   A+       +   D K   +E   +KVK  +E++++  K
Sbjct: 838  NSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKS-LEKEIEEDK 887

 Score = 39.3 bits (90), Expect = 0.027
 Identities = 49/233 (21%), Positives = 102/233 (43%), Gaps = 26/233 (11%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLK 651
            +E E  K  +D L   E+ E +   +++L++  + L ++      +V+      E + L+
Sbjct: 118  SELEFVKRKLDDLT-EEKKETQSNQQRTLKILDERLKEIELV---RVENNRSNSECKKLR 173

Query: 652  SFIKEIEEVEDNKISINSLEQQLLEEKTANNIL---RRDYYKLQERGKR----------- 789
            S I ++E  +   I+ +   +  LE KT    L     D+ + + R K            
Sbjct: 174  STIMDLETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTD 233

Query: 790  -----LCHEFQDLQDDYSKK------MKQKEYEVQK-LKNEVKFLTNMNTNLKADKTQFS 933
                 + +E   L++D+  +      +KQK  E+ K L+ ++  +  ++ +L ++K +FS
Sbjct: 234  KVILDIRNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFS 293

Query: 934  QKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQ 1092
             +     +    +E  ++ VK+E N    E N  K + D + K+    E  L+
Sbjct: 294  AEMSLKQRLVDLLESQLNAVKEELNSIR-ELNTAKVIADDSKKQTPENEDLLK 345

>TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.69
           YOR177C
          Length = 324

 Score = 40.4 bits (93), Expect = 0.007
 Identities = 55/234 (23%), Positives = 106/234 (45%), Gaps = 17/234 (7%)
 Frame = +1

Query: 334 EVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLY 513
           EV + +  C++LC++  +  +  SIS   +    L + I            S   +  L+
Sbjct: 104 EVKECLAACFSLCSVDEEKFTDLSIS---KKLRRLYISI-----------GSAFKVKELF 149

Query: 514 YH------EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVL------KSF 657
           ++      E   +K ++++ LQ      +K+ KQN   +   +K    E+L         
Sbjct: 150 FYWVRMRIENELQKQISDQELQ------IKLLKQNLTDITDSEKTRTLELLNFQNKYNKT 203

Query: 658 IKEIEEVEDN----KISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
           I E  E+ED      +S+++L+++LL   T + I   + +K Q   K+L  E  +L D  
Sbjct: 204 ILEKTELEDKVKMLDVSVDTLKKELL--GTEDTISDLENFKEQCIIKKL--EVAEL-DTE 258

Query: 826 SKKMKQKEYEVQKLKNEVKF-LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYM 984
            K++  K  E +K  NE K  L+  +  +K    +   K+++   K+ +++KYM
Sbjct: 259 VKRLNNKNMEWRKKSNEYKLDLSRRDAEVK----EAQMKQQELLIKFEHLKKYM 308

>NCAS0G01040 Chr7 complement(179805..181631) [1827 bp, 608 aa] {ON}
            Anc_6.289 YMR198W
          Length = 608

 Score = 40.8 bits (94), Expect = 0.007
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 4/200 (2%)
 Frame = +1

Query: 451  THETNRKAECERSKNAIDSLYYHEQLEK--KDLNEKSLQMAIDHLLKVTKQNQRQVDGRD 624
            T   N+KA+ E     ++++   +++ K  KDL E  L    + L ++  QN ++  G D
Sbjct: 149  TDLANQKAKWESEILELENMKPKDEVLKEIKDL-ETQLTSLQEKLTQLETQNNKKALGHD 207

Query: 625  KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEF 804
                TE+ K F +   EVED+KI I   +  LL +K    I  RD   L+   +      
Sbjct: 208  ----TELKKRFSEFKLEVEDSKIDIEEKQNTLLRKKEELAIRTRD---LETLVRTYDTHI 260

Query: 805  QDLQDDYSKKMKQ--KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
            ++L+ D +    Q  +  E+   K      +    + + +KT   Q+E      Y+   K
Sbjct: 261  ENLEKDVAIVNNQLTELDEITLPKRNALSRSTEELSHETEKTTIFQQE-----AYLQERK 315

Query: 979  YMSHVKQEYNKKEDECNRLK 1038
            Y     + ++K E EC R K
Sbjct: 316  Y----NENFDKMEFECIRRK 331

>TPHA0L00610 Chr12 (106262..108382) [2121 bp, 706 aa] {ON} Anc_7.102
            YAL011W
          Length = 706

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 59/305 (19%), Positives = 135/305 (44%), Gaps = 29/305 (9%)
 Frame = +1

Query: 508  LYYHEQLEKKDLNEKSLQMAIDHLLK----------VTKQNQRQVDGRDKLEETEVLKSF 657
            ++ +E++EKK   E+ L+      LK          + ++ Q+Q   +++ E  + +K  
Sbjct: 165  IFKNERIEKKWEEEQELEKNKREKLKKSFMEEKKHRLLEKKQKQQQKKEQREREQQMKK- 223

Query: 658  IKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
                E+ E +K+ +  L+ +  EE+           +L+E  ++L  E +  +++  KK+
Sbjct: 224  ----EQREKHKLELQKLKAEKKEEQK----------RLKEEQRKLKEEQRKAKEEELKKL 269

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
            K+++ ++++ + + + + + N  ++AD     + +   + K I     M+       +K+
Sbjct: 270  KEEQRKLKQGQFQSRQIPSKNKVVQADS---KKNDDVSNSKMIANLNIMA-------QKD 319

Query: 1018 DECNRLKFVVDK---NMKKIDHLERSLQ-AQTNAQNSFSAVTVQDEDQKDAH-------- 1161
             + N L  +V K     +++   +R ++ A+     S +A+  + ED KD H        
Sbjct: 320  PKVNNLMMIVSKGEATKEQVAKFKRYMEIAKAMPSASNNALNSRKEDVKDDHKPDNSTPK 379

Query: 1162 -----LEDRYHKVKEFMEQKLQTSKN--NDPSCSEAEALDNVLGLIENTMKTLEGNSKYY 1320
                 ++D + +V + +  K    +N   D   + A  +D      E T K +E  ++  
Sbjct: 380  QSSTTIKDSFVEVSKELSDKSTNDQNELTDNPNAGAVHIDKETDSNEET-KNVESKNQNE 438

Query: 1321 STTTK 1335
              TTK
Sbjct: 439  EDTTK 443

>ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} similar to
            uniprot|P34237 Saccharomyces cerevisiae YKL179C
          Length = 711

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 47/211 (22%), Positives = 93/211 (44%), Gaps = 19/211 (9%)
 Frame = +1

Query: 670  EEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKE 849
            E V   +  +N LE+++ E +  NN L  D  K++E      ++   +    ++++K + 
Sbjct: 406  ENVTSLETKVNHLEKKVTELEQLNNKLELDLQKIEEVDAGF-NDTNSMISGITRQVKSRT 464

Query: 850  YEVQ----KL-----------KNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYM 984
                    KL           + EV   TN NT L       +++  ++  K + +EK +
Sbjct: 465  VPQNGGSGKLSPTTSIVGIPEETEVNASTNNNTILPI----VTKQRDRFRSKNVELEKQL 520

Query: 985  SHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQ---NSFSAVTVQDEDQKD 1155
                 E NK + E  +LK    K  ++I +L    Q  TN     +S +A+++ D + + 
Sbjct: 521  RQNGVERNKLKTEIAKLKTDNGKLYERIRYLTSYTQTSTNDMTNTSSSAALSLVDTEAQY 580

Query: 1156 AH-LEDRYHKVKEFMEQKLQTSKNNDPSCSE 1245
            +H  ED  + +  F +++++  + N  S  E
Sbjct: 581  SHTYEDSLNPLNSFKKKEMEYYRKNKLSIWE 611

>NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {ON}
            Anc_4.268 YDL074C
          Length = 712

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 69/314 (21%), Positives = 131/314 (41%), Gaps = 23/314 (7%)
 Frame = +1

Query: 430  ETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQ 609
            +TL   I + T    E   +  A  + +     E++  N K     +    K T +N   
Sbjct: 323  DTLLNKIQYLTQENRELAETNEAFLNKFQKLSSEQEIFNNK-----VKSQFKETHENL-- 375

Query: 610  VDGRDKLEETEVLKSFIKEIEEVEDNKIS-INSLEQQLLEEK------TANNILRRDYYK 768
                  L+  ++L+  +  I    D+ +S I  LE++  + K      TAN IL   + +
Sbjct: 376  ------LKNNQILEKDLVRIRTARDDLLSKIAILEKETTKSKMIKDLQTANEILTEQWNR 429

Query: 769  LQERGK---------RLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADK 921
            ++ER K          L  E QD++    K  K+    V K  +E     ++ + L  +K
Sbjct: 430  VEERSKSITTATSSESLLKEIQDME----KGFKELSSLVNKKYSEYLNHESVISKLSVEK 485

Query: 922  TQFSQK--EKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL-Q 1092
            T+  QK      S+  I IE    ++ +++NK  +   + K      ++K++++   L  
Sbjct: 486  TKADQKYFAAMRSKDSILIEN--KNLLKKFNKTNELILQYKDTEKLLLQKLENINTQLIF 543

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE----FMEQKLQTSKNNDPSCSEAEALD 1260
            +Q N +   S  + +    K  +L    + VK+      E+KLQ +       +EA  ++
Sbjct: 544  SQNNEKRLIS--SNKSTSSKIINLNSELNNVKKSNYRLQEEKLQQT-------NEATKVN 594

Query: 1261 NVLGLIENTMKTLE 1302
            ++L  +E   K L+
Sbjct: 595  SILNNLEIEKKNLQ 608

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 40/227 (17%), Positives = 83/227 (36%), Gaps = 22/227 (9%)
 Frame = +1

Query: 775  ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN----------------EVKFLTNMNTN 906
            E  K+LC E    +DD +  +K K   +  +                   V+ L N  + 
Sbjct: 88   EEDKKLCKEMLIDEDDINVFVKYKTQFINLISKAVSGNNGSTSNADLGVNVERLLNKLSE 147

Query: 907  LKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS 1086
            ++A KT+   K K    +   ++KY   + ++Y+ +ED     +      +K  +  E S
Sbjct: 148  MEASKTELFLKNKTLQSELTSLKKYYEILIKKYD-REDSATVSRVFNKDTLKLEEEKENS 206

Query: 1087 LQAQTNAQNSFSAVTVQDED------QKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEA 1248
               +    N    + VQ+++      +KD    D  ++ +  +E   +       +    
Sbjct: 207  DSNEFLNDNRKDKIKVQEDEPSTNALKKDDSAVDLKNEKESPLESNQEEEDKEKQNLKYE 266

Query: 1249 EALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHI 1389
              + ++   I+    T+    K+ +   +K L      S +  N  I
Sbjct: 267  LKISDLEAQIQKLQSTITELEKFKNANEEKLLNLNAQLSNITSNNTI 313

>Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa] {ON}
            complement(374392..376686) [2295 nt, 765 aa]
          Length = 764

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 44/197 (22%), Positives = 86/197 (43%), Gaps = 12/197 (6%)
 Frame = +1

Query: 655  FIKEIEEVEDNKIS---INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
            FI  + + +D+ IS   + +   ++  E   NNI         E  + +   F      Y
Sbjct: 481  FINRLNQTDDHLISDIVVRTRSLKIPHEDFDNNIPESSSINENESLENIDFSFPSY---Y 537

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
             +K       +  LK+ V      NTNL  ++ +  + +K+ ++K   + + + H+K + 
Sbjct: 538  HRKFLSP---LLTLKHSV---LTTNTNLSEERIKLKKTKKEINKKLNTLRQEIDHIKSKM 591

Query: 1006 N-------KKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHL 1164
            N       K   + + LK  + +N      LE  L+A T+ +    +  ++   QKD HL
Sbjct: 592  NQNALNDEKSTSKIDGLKTTLQQNEALTIKLETQLKALTDKELQLESDHLK---QKDQHL 648

Query: 1165 ED--RYHKVKEFMEQKL 1209
            +    Y K++E +++KL
Sbjct: 649  KRSLEYSKLEESLKEKL 665

 Score = 37.7 bits (86), Expect = 0.071
 Identities = 70/311 (22%), Positives = 123/311 (39%), Gaps = 21/311 (6%)
 Frame = +1

Query: 283  CGFDYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHET 462
            C   +ER FE     F  VN  V  C            I  I+ L QT + L   I   T
Sbjct: 454  CALIFEREFEQ----FVVVNGLVPSC---------SYDIQFINRLNQTDDHLISDIVVRT 500

Query: 463  NR-KAECERSKNAI---DSLYYHEQLEKKDLNEKSLQ--------MAIDHLLKVTKQNQR 606
               K   E   N I    S+  +E LE  D +  S          + + H +  T  N  
Sbjct: 501  RSLKIPHEDFDNNIPESSSINENESLENIDFSFPSYYHRKFLSPLLTLKHSVLTTNTNLS 560

Query: 607  QVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI------LRRDY-- 762
            +   + K  + E+ K      +E++  K  +N  +  L +EK+ + I      L+++   
Sbjct: 561  EERIKLKKTKKEINKKLNTLRQEIDHIKSKMN--QNALNDEKSTSKIDGLKTTLQQNEAL 618

Query: 763  -YKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK 939
              KL+ + K L  +   L+ D+   +KQK+   Q LK  +               ++S+ 
Sbjct: 619  TIKLETQLKALTDKELQLESDH---LKQKD---QHLKRSL---------------EYSKL 657

Query: 940  EKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSF 1119
            E+   +K     K ++ ++ EYN+      RL  + DK MK++    ++ +   + +N F
Sbjct: 658  EESLKEKLAVENKQLTKLQTEYNQLASRNERLTAMHDKLMKEV---SKTSEESESLKNQF 714

Query: 1120 SAVTVQDEDQK 1152
              +   D  ++
Sbjct: 715  IQLRESDRQRR 725

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] {ON}
            Anc_3.479 YPR141C
          Length = 764

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 45/195 (23%), Positives = 90/195 (46%), Gaps = 19/195 (9%)
 Frame = +1

Query: 589  TKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYK 768
            TK+N+  ++ RDKLE  + +K     I+++ED K  + + E  +L EK ANN        
Sbjct: 227  TKKNKLAIEYRDKLEAVKRVK-----IKKMEDEKDQL-AKEVDVLREKIANN-----DST 275

Query: 769  LQERGKRLCHEFQDLQDDYSK--KMKQKE---------YEVQKLKNEV--------KFLT 891
            L +  + +  +++++++ + K  ++K KE          E+ +L+ E+        + L 
Sbjct: 276  LDDMLRDVTQKYENMKEPWLKSFEVKWKENVEINEKCIQEITELRKELEENLQPKAEKLK 335

Query: 892  NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKID 1071
            +   +LK  + +   K KQ  +++  IE+ +S  K    + E+    LK  + K    + 
Sbjct: 336  SKFDSLKEQRDELIAKLKQQQKEHRKIEEEISQKKTTLRETEEREASLKEEISKTESDLK 395

Query: 1072 HLERSLQAQTNAQNS 1116
             L   L  +   + S
Sbjct: 396  ELNEILIKEETLRRS 410

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 50/235 (21%), Positives = 102/235 (43%), Gaps = 14/235 (5%)
 Frame = +1

Query: 484  RSKNAIDSLYYHEQLEKKDLNE-KSLQMAIDHLLKVTKQNQR--QVDGRDKLEETEVLKS 654
            ++K++ D   Y + L  ++ +E +  ++  D L    +   R  + D      E++ L  
Sbjct: 686  KTKSSDDGTKYLKDLINEERHELERTKVHYDQLFNELRTEMRLLKADIDRSRSESQRLTK 745

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK- 831
                +    D ++    LEQ  +E+K   N +      LQE   +L    QD Q   +K 
Sbjct: 746  ASNHLSLKIDKEVDTGKLEQSKVEKKNQENAVISYQGALQEIEAKLEQIGQDAQPYKNKF 805

Query: 832  ---KMKQ--KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQK----YIYIEKYM 984
               K++Q   E E+ +LKN +    +    L+ D   +S+K+K   +K       +E++ 
Sbjct: 806  DLTKVEQTTAEQELVELKNTISTRDSRVQKLEDDIEYYSEKKKDLERKRESILSQMEEFE 865

Query: 985  SHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTN-AQNSFSAVTVQDED 1146
              ++ +    E  C+R +       +  + ++R ++  TN  +N+ + V +  ED
Sbjct: 866  QGIQSQIRNAEVYCSRDQAFSSGIPETYEEVKREIERVTNQIRNAENRVGMTQED 920

>Skud_14.240 Chr14 (442718..446449) [3732 bp, 1243 aa] {ON} YNL091W
            (REAL)
          Length = 1243

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 61/273 (22%), Positives = 108/273 (39%), Gaps = 25/273 (9%)
 Frame = +1

Query: 487  SKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETE-------V 645
            S ++ D +   E +   DL   SLQ   D    +  +++  ++GRD+ EE +        
Sbjct: 526  STHSEDEVSEEEYISDVDLPRDSLQHYRDDD-GILDEDEDDLEGRDENEEQDEEDEEEDA 584

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
              S + E + +E+ +  I     +LL+ +     +   Y++ Q    RL    + LQ+  
Sbjct: 585  YDSGLDETDRLEEGRKLIQIAITKLLQSR-----IMASYHEKQADNNRL----KLLQELE 635

Query: 826  SKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEY 1005
             +K K++E E +K K   K                 +KEK+  Q+           ++E 
Sbjct: 636  EEKRKKREKEEKKQKKREK-----------------EKEKKKLQQLAK--------EEEK 670

Query: 1006 NKKEDECNRL----------------KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQ 1137
             K+E+E  RL                K V +   KK +  +R L+ Q   +        Q
Sbjct: 671  RKREEEKERLKKELEEREMKRREAQRKKVEEAKRKKDEERKRRLEEQQRREEMQEKQRKQ 730

Query: 1138 DEDQKDAHLED--RYHKVKEFMEQKLQTSKNND 1230
             E+QK    E+  R  + K   ++KLQ  K  +
Sbjct: 731  REEQKRKREEEKKRIREQKRLQQEKLQREKEEE 763

>Kwal_26.8634 s26 complement(875659..877002) [1344 bp, 447 aa] {ON}
            YOR216C (RUD3) - involved in secretion [contig 67] FULL
          Length = 447

 Score = 40.4 bits (93), Expect = 0.009
 Identities = 52/230 (22%), Positives = 96/230 (41%), Gaps = 16/230 (6%)
 Frame = +1

Query: 631  EETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
            E  E L+S  +++ E E   +S   L  +L   K  N  L+     L +    L  E + 
Sbjct: 127  ESQEELESCQEQLREYESQNLS---LRNKLDSTKRDNEELQTTVMTLNQEISALTDECET 183

Query: 811  LQDDYSKKMKQK---EYEVQK-----------LKNEVKFLTNMNTNLKADKTQFSQKEKQ 948
            L  ++S+  +     E E+QK           L  ++K L  + +N+K D     ++ + 
Sbjct: 184  LSTEFSQATETSARLEKELQKQALDHLVEKNNLDTKIKELELLLSNIKQDTVAIREERED 243

Query: 949  YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAV 1128
            Y+Q+                   D   RLK   + N   +  LER L+ +    NS S+ 
Sbjct: 244  YAQQL------------------DRSQRLKKEAETN---VAELERQLENEIQKANSVSS- 281

Query: 1129 TVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPS--CSEAEALDNVLG 1272
               ++ ++   LE + H++     Q L  +K+N+ S   SE +++ + +G
Sbjct: 282  ---EKTKRIESLESQLHEL-----QNLDKTKDNELSRLRSEVDSMMDAVG 323

>Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON}
            (64396..65769) [1374 nt, 458 aa]
          Length = 457

 Score = 40.4 bits (93), Expect = 0.009
 Identities = 57/320 (17%), Positives = 129/320 (40%), Gaps = 32/320 (10%)
 Frame = +1

Query: 406  ISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLK 585
            I +L +  E L V +  E N         +   S        ++D  EK     ++ +  
Sbjct: 73   IKELQEMIENLKVKL--EDNSTNGSSNGNDGDSSSELESLRNERDHFEKQYNSLLERISS 130

Query: 586  VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDN----KISINSLEQQLLEEKTANNILR 753
            +     +  + + +LE T+      +++ E E      K  ++SL ++ +E ++    L 
Sbjct: 131  MKSLFSKMKENQKELESTQ------EQLNEYESQNLKLKTKVDSLNKEKVELESTIVTLN 184

Query: 754  RDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTN-------LK 912
            ++Y  L++  +      Q+   ++S++++  + E  KL  +++ L+ +  N       LK
Sbjct: 185  QEYSSLEKELEEYERNAQNSSSNHSRELQLLKNEKNKLNTQLQDLSAILENNKEDIRNLK 244

Query: 913  ADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNK-----------KEDECNRLKFVVDKN- 1056
             + T   Q      +    +EK    ++ E NK           K  E N L+  +D + 
Sbjct: 245  LENTDLKQTLDTVQRDKSELEKNFGSLESELNKLEAKNEDDLRTKTMEINSLRTQLDSSN 304

Query: 1057 ------MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQ--KDAHLEDRYHKVKEFMEQKLQ 1212
                  +K I+ L+  + +  ++  S   + ++ ++Q  +   L      V E + + + 
Sbjct: 305  DTTKEYLKSIEDLKNEILSMKDSLKSKDELELKHKEQIAQIGKLRHENVVVNEHLTKAMA 364

Query: 1213 TSK-NNDPSCSEAEALDNVL 1269
              K ++D    + E + N+L
Sbjct: 365  MIKQSSDSETVDKELISNLL 384

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 68/280 (24%), Positives = 117/280 (41%), Gaps = 10/280 (3%)
 Frame = +1

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSL 708
            + K  +  SL   +   LK    N + ++  +   +T + +   K + EV D    I SL
Sbjct: 921  KSKFQSHDSLVPKLTEKLKSLANNYKDLEIENTNIKTRLNEEQSKHLSEVSDLNEKIESL 980

Query: 709  EQ---QLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEV 879
            E+    L EEK            L+ +   L HE    + D+  K++Q   E   L+ ++
Sbjct: 981  ERTEISLTEEKK----------DLETKLSSLEHEINSFKGDHDTKIEQLCTEKDGLEQQI 1030

Query: 880  KFLTNMNTNLKADKTQFSQKEKQYSQKYIY-IEKYMSHVKQEYNKKEDECNRLKFVVDKN 1056
            + LTN   +LK      S +EK+ ++  +  +   +  +K+EY ++E     L    +KN
Sbjct: 1031 EQLTN---SLKK-----SDEEKENARLAVTDLTTRLDGMKKEYEEREVTFEEL----EKN 1078

Query: 1057 MKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS---KNN 1227
                        AQT A      +   +ED   A LE+   K K F E KLQ +   K+ 
Sbjct: 1079 ------------AQTEAAQISEKLKKAEEDV--AALENT--KAKLFSEIKLQENAIEKSK 1122

Query: 1228 DPSCSEAEALDNVLGLI---ENTMKTLEGNSKYYSTTTKK 1338
            +        ++ + G I   E T++ L G  K +  T ++
Sbjct: 1123 ETITGHEGTIEQLNGRIADYEGTIEELNGIIKSHEETIQE 1162

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 50/267 (18%), Positives = 106/267 (39%), Gaps = 21/267 (7%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE 633
            H+   K + E SK           +EK    ++S +  ++ LLK             ++E
Sbjct: 1304 HKLQEKCQAELSKKKSKVEGLRGSIEKLSTEKESSEKKVEQLLK-------------QIE 1350

Query: 634  ETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL 813
            E +     + + ++  +  + I++ + Q L +  A++    +  +LQE   +L       
Sbjct: 1351 EKDSNIISLTDEKQALNKNLLISNQKIQKLNKNVADS--TSEQVRLQEELSQLKETINVN 1408

Query: 814  QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKAD----KTQFSQKEKQYSQKYIYIEKY 981
            +  Y +     + E++K + E      + T L+A     + Q S+ E++  QK   + + 
Sbjct: 1409 EKTYEQNTALLKTEIEKFQKERTEKDVLVTELRAKASKLEKQVSETEQENVQKVQTLNEQ 1468

Query: 982  MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERS-----------------LQAQTNAQ 1110
            +  +K+E NK   E   L+   + N  + + L +                    A+ +A 
Sbjct: 1469 IKSLKEEKNKACSEAGNLQSKFETNNVEFESLRKEHDLACERLESIANDLKIASAKADAS 1528

Query: 1111 NSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
            N+ +    Q  D   A L ++  K++E
Sbjct: 1529 NTENVAAQQRIDILKADLGEQDKKIRE 1555

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 64/281 (22%), Positives = 117/281 (41%), Gaps = 20/281 (7%)
 Frame = +1

Query: 481  ERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI 660
            +++K+++  L     L KKD+  K+ + +     K+   N+       +LE +++L    
Sbjct: 1757 KKAKDSVSGLETQLNLVKKDVESKNNENS-----KLVADNKTL-----QLENSKLLAIKE 1806

Query: 661  KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK 840
            K IEE        N +   L E +T  +       KL++       E Q ++    ++ K
Sbjct: 1807 KIIEEK-------NGIVDDLAEARTVAD-------KLKDECAATSKELQLIKSS-EEETK 1851

Query: 841  QKEYEVQKLKNEVKFLT-NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS---------- 987
             +   ++K KN+++ L  +    +   +   SQK+    +  + +EKY S          
Sbjct: 1852 TEISAMEKSKNQLELLLESFKAKVSGLEKDLSQKDSILEETRLALEKYTSENESKQKDLE 1911

Query: 988  -HVKQEYNKKEDECNRL----KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE-DQ 1149
             HVKQ  ++K+   + +    K   +K+ +KI  LE  L +    Q       VQ + + 
Sbjct: 1912 AHVKQLESEKDRLASEIEEERKLATEKSNQKIIELESQL-STLKLQYEKDVNEVQTKLET 1970

Query: 1150 KDAHLEDRYHKV-KEFME--QKLQTSKNNDPSCSEAEALDN 1263
            K + L D    + KE ME   KL +    + S  EA    N
Sbjct: 1971 KISQLSDELDSITKEKMEVQNKLHSLTEENESIKEASTTAN 2011

 Score = 36.2 bits (82), Expect = 0.24
 Identities = 52/279 (18%), Positives = 109/279 (39%), Gaps = 29/279 (10%)
 Frame = +1

Query: 475  ECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKS 654
            E E ++ A+  L       KK+  E+  ++  + L K  +    Q+  + K  E +V   
Sbjct: 1043 EKENARLAVTDLTTRLDGMKKEYEER--EVTFEELEKNAQTEAAQISEKLKKAEEDVAAL 1100

Query: 655  FIKEIEEVEDNKISINSLEQQLL----EEKTANNILRR--DYYKLQERGKRLCHEFQDLQ 816
               + +   + K+  N++E+        E T   +  R  DY    E    +    ++  
Sbjct: 1101 ENTKAKLFSEIKLQENAIEKSKETITGHEGTIEQLNGRIADYEGTIEELNGIIKSHEETI 1160

Query: 817  DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF----SQKEKQYSQKYIYIEK-- 978
             + S  +  +E  +QKL   +  L +    LK    +     S+ EK  ++    IEK  
Sbjct: 1161 QELSSSIDDREKNIQKLNTSINELNSEIVELKETNQELEECVSRHEKTVTELNEKIEKSD 1220

Query: 979  --------YMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
                     +  +KQ+ +  ED+    +    +  +K+  LE+ ++     +  F    +
Sbjct: 1221 PIISSYEAEIKDLKQKISSSEDKITSQELKYKELQEKVTLLEKEIETFKTKREDFEKTIL 1280

Query: 1135 QDED------QKDAHLEDR---YHKVKEFMEQKLQTSKN 1224
            Q ++      +K+  L +     HK++E  + +L   K+
Sbjct: 1281 QSKELGVSLNEKNKSLSEELVSVHKLQEKCQAELSKKKS 1319

>NDAI0F00790 Chr6 complement(189781..190728) [948 bp, 315 aa] {ON}
            Anc_5.630
          Length = 315

 Score = 40.0 bits (92), Expect = 0.009
 Identities = 41/219 (18%), Positives = 98/219 (44%), Gaps = 6/219 (2%)
 Frame = +1

Query: 499  IDSLYYHEQLEKKDLNEKSLQMAI-DHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEE 675
            I +L    Q  +K L++  ++  I ++++K    N  ++         E++K+  +++ +
Sbjct: 64   ISTLQQFSQSLQKSLDDNKVRTKIVENVIKKANLNIHKIG--------ELVKACNEDVTK 115

Query: 676  VEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYE 855
            ++  +++  +  Q +  EK     L RD+       K    EFQ +Q +Y+K +KQ    
Sbjct: 116  IDSLEVTTLNKLQLISREK-----LLRDF-------KSSLQEFQSIQSNYTKLIKQ---- 159

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
               +  + K     N +  A++T   Q++++++Q  I+ ++ +   K     + +  N  
Sbjct: 160  ---INEKTKLQLYGNLHSDANETALLQEQEEHTQPQIHEQQLLPKQKNRIVIEREPINNE 216

Query: 1036 KFVVDKNM-----KKIDHLERSLQAQTNAQNSFSAVTVQ 1137
            +F   +N+     ++I ++E+ +          S V  Q
Sbjct: 217  EFTYQQNLIEQRNREITNIEQDITELNEIFKDLSNVVQQ 255

>AFL170C Chr6 complement(116228..118129) [1902 bp, 633 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL253C
            (VIK1) and YMR198W (CIK1)
          Length = 633

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 54/240 (22%), Positives = 106/240 (44%), Gaps = 17/240 (7%)
 Frame = +1

Query: 682  DNKISINSLEQQL------LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQ 843
            + ++ + +LE +L      L E+    +L  + +K  +    L  E + L+ + +K+  Q
Sbjct: 170  EQQVEVQNLENELDRRINALREEWELKLLSLEKFKPNDD---LVKEIEGLKQELNKE--Q 224

Query: 844  KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDE 1023
            K ++  + +NE K        L+ D  +F  KE++ S      EK   H+ QE NKK+ E
Sbjct: 225  KTWDRLQRENEEK-RKEFELILEQDFLRF--KEEKLSLYEDLTEK-REHLFQEKNKKQLE 280

Query: 1024 CNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQ 1203
              +L  +V+++ ++   L   +QA T          +   +Q+    + R  ++KE +  
Sbjct: 281  LKQLHSIVEQHRREKAELAIDIQAITEE--------IVHYEQQLKPSQARLQQLKEQLNT 332

Query: 1204 KLQTSKNNDPSCSEAEALDNVL-----------GLIENTMKTLEGNSKYYSTTTKKCLKY 1350
            ++  ++      S AE   N L             IENT++ L GN + ++  +   + Y
Sbjct: 333  EVHETEEIRKKASAAEQEYNTLYDKMEDEQLSRRRIENTIEELRGNIRVFAYVSDASVPY 392

>YDR295C Chr4 complement(1052623..1054647) [2025 bp, 674 aa] {ON}
            HDA2Subunit of a possibly tetrameric trichostatin
            A-sensitive class II histone deacetylase complex
            containing an Hda1p homodimer and an Hda2p-Hda3p
            heterodimer; involved in telomere maintenance
          Length = 674

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 51/211 (24%), Positives = 86/211 (40%), Gaps = 36/211 (17%)
 Frame = +1

Query: 454  HETNRKAECERSKNAIDSLYYHEQLEKKDLNEK------------SLQMAIDHLLK---- 585
            +ET R+ + +  KN++   +  +Q  +K +N+              LQ  I+HLLK    
Sbjct: 449  NETQRQNQLDEIKNSVGLTFKKKQEVEKSINDSEKRLKHAMTESTKLQNKINHLLKNRQE 508

Query: 586  ---VTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLE--QQLLEEKTANNIL 750
                 K     +   + LEE   L   +KE   ++ N    N L+  QQ   EK+  N  
Sbjct: 509  LENFNKLPSNTISSENHLEEGSALADKLKEY--IDKNATLFNKLKELQQANAEKSKLNDE 566

Query: 751  RRDYYK---------------LQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKF 885
             R  Y+               LQE  K L +E       +S +  +KE E  +L+N+ + 
Sbjct: 567  LRSKYQIESSKAAESAQTLKILQESMKSLENEVNGPLTKFSTESLKKELE--RLQNDFQS 624

Query: 886  LTNMNTNLKADKTQFSQKEKQYSQKYIYIEK 978
            L   N  LK   T  +++    ++  + +EK
Sbjct: 625  LKARNKFLKNYITLMNRQYDLKNKNNVQVEK 655

>Kpol_543.60 s543 (140661..141194) [534 bp, 177 aa] {ON}
            (140661..141194) [534 nt, 178 aa]
          Length = 177

 Score = 38.9 bits (89), Expect = 0.011
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 7/130 (5%)
 Frame = +1

Query: 853  EVQKLKNEVKFLTNMNTNLKADKTQ-------FSQKEKQYSQKYIYIEKYMSHVKQEYNK 1011
            E+Q L+ ++K L     NL+ DKTQ       F Q E +YS K+    K    +  +Y+ 
Sbjct: 58   EIQGLEVKLKELEQKFENLEKDKTQVIEMFDNFKQLEAEYSYKW---RKLHDDIDIKYSP 114

Query: 1012 KEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
                 N LK  ++  +K++DH  R ++   +  N   +   Q  D     +  +YH  +E
Sbjct: 115  -----NVLKNKLEAELKELDHASRIIEENASNSNELDSFINQYLD-----IRTQYHSKRE 164

Query: 1192 FMEQKLQTSK 1221
                KL T K
Sbjct: 165  ----KLSTWK 170

>Kpol_269.2 s269 (2702..5299) [2598 bp, 865 aa] {ON} (2702..5299)
            [2598 nt, 866 aa]
          Length = 865

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 60/256 (23%), Positives = 111/256 (43%), Gaps = 51/256 (19%)
 Frame = +1

Query: 544  NEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI-----EEVEDNKISINSL 708
            N  SL+ A    L++ K N+R  +   +L+E +   SF K+      +EV   ++ ++ L
Sbjct: 181  NSSSLEDASVSDLEI-KLNERIKELESQLDEEKKSSSFFKKTLMELSDEVFKYEVQVSGL 239

Query: 709  EQQLLEEKTANNILRRDYY-----KLQERGKRLCHEFQDLQDDYSK---------KMKQK 846
              ++    T  N+    YY     +LQ     L  +   ++D Y+           + QK
Sbjct: 240  NAKV-SSLTEKNMSAVKYYNQISNELQLVSSELNSKSYFMKDSYNNVENKSQNEDNINQK 298

Query: 847  EY----EVQKLKNEVKF-LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKY---------- 981
            E     ++ K K   K+ L ++ T  +A + +  ++ ++  +K   IEKY          
Sbjct: 299  ETTSTDDLNKDKMLEKYSLEHIKTMYEASENKLLKRLQRIEKKQKEIEKYFSDEHGGTNF 358

Query: 982  ---------MSHVKQEYNKKEDECNRLKFVVD---KNMKKIDHLER-----SLQAQTNAQ 1110
                     +S +KQ   KK +EC RLK  ++    N+KK  H+E+       +A +N  
Sbjct: 359  NDLTVESDIISELKQNLIKKNEECRRLKDQLEVRCNNLKKAVHIEKLKSYSKNKAYSNYV 418

Query: 1111 NSFSAVTVQDEDQKDA 1158
            +S     V++E  ++A
Sbjct: 419  DSSKKSLVENEKLREA 434

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 69/334 (20%), Positives = 141/334 (42%), Gaps = 7/334 (2%)
 Frame = +1

Query: 322  DTFKEVNDAVNRCYALCNIPTKHISISS-ISDLAQTFETLAVGITHETNRKAECERSKNA 498
            + FK + D  N      ++  K +SI + + +  Q FE+    +  E +        K+A
Sbjct: 237  EDFKNLRDRYN------DLEIKFLSIQNELDEKKQEFESSTARLNEEIHTLKSTIDDKDA 290

Query: 499  IDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEV 678
              S +           ++ L  A D L  +  QN  Q             +  + +++E 
Sbjct: 291  TISEF-----------KRKLGNAEDQLASIDDQNGNQN------------QKLLHDLKER 327

Query: 679  EDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEV 858
            ED   +I+ L++ ++E++ A       +YK          E QD Q+   K+ + K  EV
Sbjct: 328  ED---AIDGLKEDIIEKENAIV-----HYK---------EEIQDKQNQL-KESESKYAEV 369

Query: 859  QKLKNEVKF-LTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
            QK   + K  L       +  K   S++ ++ S + I +EK + +++ +  K E +    
Sbjct: 370  QKEFEDFKRELKKQTFEFEDGKKSTSRQLQELSVEKIQLEKQVCNLRGQIEKLEQQHRLT 429

Query: 1036 KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD--EDQKDA--HLEDRYHKVKEFMEQ 1203
            +   D    K+ H+E  L+     + S + V ++D   D +DA  +L +  + +KE   +
Sbjct: 430  QSENDGLRTKLKHIESDLK----NEKSRTEVKIKDLTSDLEDARKNLGEANNTIKELHHE 485

Query: 1204 KLQ-TSKNNDPSCSEAEALDNVLGLIENTMKTLE 1302
             ++  +K+ D    E    D  +  +++ ++ L+
Sbjct: 486  IIKNATKSKDQLSEEVVEKDKEIDQLKHRVQRLD 519

 Score = 38.9 bits (89), Expect = 0.032
 Identities = 60/307 (19%), Positives = 140/307 (45%), Gaps = 19/307 (6%)
 Frame = +1

Query: 457  ETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDH--LLKVTKQNQRQVDGR--D 624
            E++ K E  R++  I  L    +  +K+L E +  +   H  ++K   +++ Q+     +
Sbjct: 444  ESDLKNEKSRTEVKIKDLTSDLEDARKNLGEANNTIKELHHEIIKNATKSKDQLSEEVVE 503

Query: 625  KLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI-LRRDYYKLQERGKRLCHE 801
            K +E + LK  ++ ++E  + + S   L++     +  + + +RR   K +   + L  E
Sbjct: 504  KDKEIDQLKHRVQRLDE--ELRTSQAELDKATKNREVDHELEIRRLQNKHEIEQESLKRE 561

Query: 802  FQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQK-EKQYSQKYIYIEK 978
               + D+  + +     +++  + +++ L   N NL + + + S   E     K I I +
Sbjct: 562  LAHMTDEKERLVDLHRLDIETWERQIEALRKENENLISREHKESNNIEITLQDKNIQIRR 621

Query: 979  YMSHVKQEYNKKEDECNRLKFVV---DKNMKKI-DHLERSLQAQTNAQNSFSAVTVQDED 1146
              + + Q   ++ D  N+L+ +    D+   ++ D LE   + + + +N+ S      +D
Sbjct: 622  LEADIVQLNEERNDILNKLRSLEQAKDRYKSEMKDALETISRLRVDLENNKSL-----KD 676

Query: 1147 QKDAHLEDRYHKVKE--------FMEQKLQ-TSKNNDPSCSEAEALDNVLGLIENTMKTL 1299
             KD+ +E +Y K+K+        ++++ ++  S+N + +    + +D  +    NT  TL
Sbjct: 677  SKDSLIERKYEKLKDEFKLMKKGYLDEMIKLQSRNRELNSDLQKRMDPSISTSANT--TL 734

Query: 1300 EGNSKYY 1320
                 YY
Sbjct: 735  ADKLDYY 741

>NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {ON}
            Anc_3.425 YGR089W
          Length = 947

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 60/264 (22%), Positives = 103/264 (39%), Gaps = 21/264 (7%)
 Frame = +1

Query: 655  FIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKK 834
            F+  +++ +D  IS    +  +      NN    D  ++ E  + L   F      Y +K
Sbjct: 671  FVNRLDQTDDYLIS----DLMIRTSSILNNDSSNDKTEVSENFENLDFSFPSY---YHRK 723

Query: 835  MKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ--EYN 1008
                   +  LK+ V      N NL  ++ +  + +K+ ++K   + + + H K   E N
Sbjct: 724  FLSP---LLTLKHSV---LTTNANLADERNKIKKTKKEINKKLNSLRQEIDHFKGKIEQN 777

Query: 1009 KKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED------ 1170
               DE         KN  K+D+L+ +LQ    A        ++   +K+  LE+      
Sbjct: 778  ATNDE---------KNTSKVDNLKIALQQNEKALKQLEE-DLKRASEKELALEEDYLTKK 827

Query: 1171 RYHKVKEFMEQKLQTSKNNDPSCSEAE--ALDNVLGLI-----------ENTMKTLEGNS 1311
             YH  KE    KL+ S N D S  +A+   L N    +           E   K L+ N+
Sbjct: 828  DYHLQKELEFSKLEESLNKDLSLVKAKETKLQNEYNQLSSKKDKLSLRHEKLQKELDENN 887

Query: 1312 KYYSTTTKKCLKYVTGSSRLKENE 1383
            + + T  K+       + RLK  E
Sbjct: 888  ELF-TVVKEQFVVKRENERLKRQE 910

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 38/176 (21%), Positives = 78/176 (44%), Gaps = 3/176 (1%)
 Frame = +1

Query: 532  KKDLNEK--SLQMAIDHLLKVTKQNQRQVD-GRDKLEETEVLKSFIKEIEEVEDNKISIN 702
            KK++N+K  SL+  IDH     +QN    +    K++  ++          ++ N+ ++ 
Sbjct: 753  KKEINKKLNSLRQEIDHFKGKIEQNATNDEKNTSKVDNLKIA---------LQQNEKALK 803

Query: 703  SLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVK 882
             LE+ L         L  DY   ++   +   EF  L++  +K +   + +  KL+NE  
Sbjct: 804  QLEEDLKRASEKELALEEDYLTKKDYHLQKELEFSKLEESLNKDLSLVKAKETKLQNEYN 863

Query: 883  FLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
             L++    L   + +  QKE   + +   + K    VK+E  + + +  R++ + D
Sbjct: 864  QLSSKKDKLSL-RHEKLQKELDENNELFTVVKEQFVVKRENERLKRQEARIREISD 918

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
            similarities with uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 950

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 71/323 (21%), Positives = 137/323 (42%), Gaps = 48/323 (14%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEV- 645
            K +  +  N   S   H+++E  +LNE + +  ID L K     +  +  R K  ++E+ 
Sbjct: 344  KVDLMKKHNDDLSQTVHDKIE--ELNECNTR--IDELYKENIAQENSLRSRVKEYDSELS 399

Query: 646  -LKSFIKEIE---EVEDNKI--SINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQ 807
             L++  +E++   E++D++     +S E ++   K+AN  L +     + +  +  H   
Sbjct: 400  SLRNRNEELQKKLELQDHEFISKSSSYEARISSLKSANEDLEKGIELERTKSSKEAHVLG 459

Query: 808  DLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIY--IEKY 981
            D      +++   E E +K+   V+F      +L+A+  +   +E     K +   +EK 
Sbjct: 460  DTVVTLRQQLADAEKENEKIL--VRFNMLEKQHLEAENLRDGLEETNQELKSVVTRLEKI 517

Query: 982  MSHVKQEYNKKEDECNRLK-------FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD 1140
             S   Q   + E+E  R           V K+ K+++   R LQ    A+NS   +  Q+
Sbjct: 518  SSDQLQTIGRLEEEVERKSKKEANSLSSVRKHSKQLEEKVRHLQDVIVAKNSELEMQKQE 577

Query: 1141 EDQKDAHLE--------------DRYHKVKE------------------FMEQKLQTSKN 1224
             +Q +++L+              ++Y   K                   F + +LQT++N
Sbjct: 578  LNQFESYLKSVSLFQIQAGDLIVEQYRLNKYATQMDAAFKERNPDILGFFTQDQLQTTEN 637

Query: 1225 NDPSCSEAEALDNVLGLIENTMK 1293
               S    EALDN L  +E ++K
Sbjct: 638  ---SAVRLEALDNELHKLEESIK 657

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 76/299 (25%), Positives = 116/299 (38%), Gaps = 49/299 (16%)
 Frame = +1

Query: 292  DYE---RRFETRDDTFKEVNDAVNRCYALCN-------IPTKHIS--ISSISDLAQTFET 435
            DYE   + FE +    +E ND  +R     N          K +S  + S+ D    F+ 
Sbjct: 649  DYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKE 708

Query: 436  ----LAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEK--SLQMAIDHLLKVTKQ 597
                L V I +  N   E E+  +  +  Y  E+     L  K   LQ+  D+L +  K 
Sbjct: 709  HISKLEVDINNLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKN 768

Query: 598  NQRQVDGRDKLEETE-VLKSFIKEIEEVEDN---KISINSLEQQLLEEK-------TANN 744
                      LEE E  LK  IK IE  ED+   KIS+    + LL++K       ++NN
Sbjct: 769  ----------LEENESTLKDKIKMIEGNEDDLMGKISVLQSNEILLKDKLNDLNSKSSNN 818

Query: 745  I-------LRRDY-------------YKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQK 864
                    L++D+             Y   +  KRL  E +   DD  K ++ K +E  K
Sbjct: 819  SELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFESGK 878

Query: 865  LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF 1041
              +E          L   + + S  EKQ ++K     K  + ++ E N K  + N   F
Sbjct: 879  ASSE--------KTLNLLEHKLSLLEKQNNEK---SNKINTLIESENNNKTQKINPFTF 926

 Score = 35.0 bits (79), Expect = 0.51
 Identities = 77/364 (21%), Positives = 153/364 (42%), Gaps = 36/364 (9%)
 Frame = +1

Query: 400  SSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEK-----KDLNEKS--- 555
            S++S L     T    I++E +     E  +   +     EQLE+     K+ NEK    
Sbjct: 563  SNLSSLLNKINTDKNSISNELSDLHSKEILELETEKTKLLEQLEEGERKLKETNEKHNEQ 622

Query: 556  ---LQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLE 726
                Q  ID+  + T +NQ   +   K +   + KSF ++ +EVE+     + L++Q  E
Sbjct: 623  IKWFQNKIDNFNEETTKNQ--FNNALKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANE 680

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK------------KMKQKEYEVQKLK 870
               A+   +++   L +  K L  E  + ++  SK               +K+   + LK
Sbjct: 681  RLNASKTTQKE---LSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEKKLSEENLK 737

Query: 871  NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVD 1050
             E +  T     LK D  Q ++           +++ + ++++  +  +D+   ++   D
Sbjct: 738  YETERQTGSTLRLKIDDLQLNEDN---------LKEKVKNLEENESTLKDKIKMIEGNED 788

Query: 1051 KNMKKIDHLERS---LQAQTNAQNSFSA-----VTVQ----DEDQKDAH-LEDRYHKVKE 1191
              M KI  L+ +   L+ + N  NS S+     V V+    D +++ +H +E R    + 
Sbjct: 789  DLMGKISVLQSNEILLKDKLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEM 848

Query: 1192 FMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRL 1371
             +E++L++    +        +D+ + ++E  MK  E + K  S  T   L++       
Sbjct: 849  QLEKRLKSEMERE--------MDDKMKVVE--MKGFE-SGKASSEKTLNLLEHKLSLLEK 897

Query: 1372 KENE 1383
            + NE
Sbjct: 898  QNNE 901

>Skud_13.171 Chr13 (293952..295166) [1215 bp, 404 aa] {ON} YMR017W
            (REAL)
          Length = 404

 Score = 40.0 bits (92), Expect = 0.011
 Identities = 46/225 (20%), Positives = 102/225 (45%), Gaps = 5/225 (2%)
 Frame = +1

Query: 568  IDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNI 747
            ID +  VT +N+    G  K E    +      +EE+          EQ    E+  N++
Sbjct: 90   IDDMATVTSENEYGSYGESKKENLSAIS-----LEELFPKSNRCPIPEQN---EEETNSV 141

Query: 748  LRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYE--VQKLKNEVKFLTNMNTNLKADK 921
            + RD  ++         ++ + ++ Y+ +  Q + +  V ++K++++  T +N+    ++
Sbjct: 142  IHRDLGRIGNENDS--PQWGNARNRYNFEYDQYDEDEIVARIKSDIRH-TKLNSVKTTNR 198

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKF---VVDKNMKKIDHLERSLQ 1092
            T     E Q + K +   + +S    +  K ED C+ LK    V D+ + ++ H  RSL 
Sbjct: 199  TVERALEAQMTGKRVL--QQLSCQSNQLTKIEDNCDILKIQSNVADRKIDELAHENRSLF 256

Query: 1093 AQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNN 1227
            A   + N F     +++  +   L+ + +++++   ++ Q S+ N
Sbjct: 257  A-LKSPNPFRKKREREKQNQINRLKTKQYQLQQETMKRAQESRAN 300

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 46/196 (23%), Positives = 86/196 (43%), Gaps = 5/196 (2%)
 Frame = +1

Query: 448  ITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDK 627
            +T E   K E  R++     ++   Q  + DL EK+ ++ + +     K     +  R+ 
Sbjct: 199  LTEEIEPKLEKLRNEKR---MFLEFQSTQTDL-EKTERIVVSYDYYNLKHKHTSI--RET 252

Query: 628  LEETEV----LKSFI-KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRL 792
            LE  E     L  FI K I+E+      +  ++ Q  +EK  N        KL+++   L
Sbjct: 253  LENGEAHMKNLNEFIEKTIQEINSLNEDVEEIKHQ--KEKELNK--EGKISKLEKKENSL 308

Query: 793  CHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYI 972
             +E   L+   S K++      +KLK+    +T  +T L   K  +++ EK Y      +
Sbjct: 309  LNEISRLKTSLSIKVENLNDTNEKLKSVEADITTSSTKLNDKKIAYTKTEKDYK----IV 364

Query: 973  EKYMSHVKQEYNKKED 1020
            ++ +S  +  Y +KE+
Sbjct: 365  QQQLSEKRDLYKRKEE 380

>Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON}
            (82489..86103) [3615 nt, 1205 aa]
          Length = 1204

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 45/202 (22%), Positives = 92/202 (45%), Gaps = 10/202 (4%)
 Frame = +1

Query: 463  NRKAECERSKNAIDSLYY---HEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQV------D 615
            ++K++ E   N +D        EQ E+++  ++  Q       +  +Q Q QV      +
Sbjct: 778  DQKSDIEDDDNRLDKSIEGEGEEQEEEQEQEQEQEQEQKQEQKQEQEQEQEQVPIETAEE 837

Query: 616  GRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLC 795
               +L E E     +KE EE +  K+     E+Q + ++      R +  + +ER KRL 
Sbjct: 838  KEKRLREEEERARRLKEEEEEKLRKLQEREEERQRILKQEEEERQRIEKEEEEERQKRLK 897

Query: 796  HEFQDLQDDYSKKMKQKEYEV-QKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYI 972
             E ++ Q    ++ + +E  + QK K E + L  +  +   ++ + +++EKQ  ++    
Sbjct: 898  EEDEERQKRLKEEEEYREKRLQQKKKREQELLQKLADD---EQKKVAEREKQKLEESKRQ 954

Query: 973  EKYMSHVKQEYNKKEDECNRLK 1038
            E+     +QE  K+++E    K
Sbjct: 955  EEERLRREQELVKQKEEVELAK 976

>TPHA0P00930 Chr16 complement(187009..190944) [3936 bp, 1311 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1311

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 55/270 (20%), Positives = 112/270 (41%), Gaps = 3/270 (1%)
 Frame = +1

Query: 460  TNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEE- 636
            T+ + + ++   A  S Y H   +  D++E+   +  +       +N+R  +GR  L+  
Sbjct: 587  TDNEFQLQQRNAANFSRYKHLDEQTSDVHEEEELIDDEEYESGIDENERLEEGRKLLQIV 646

Query: 637  -TEVLKSFI-KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD 810
             T++L+  I K   E +  K  +  LE+  +EE       +    K Q++ ++   + + 
Sbjct: 647  LTKILQGRIMKSFHEKQAEKNRMKLLEELEVEESKK----KEKKEKKQKKREKEKEKKKL 702

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            LQ    ++ ++KE E  +LK E            A++ +  ++E Q  Q           
Sbjct: 703  LQQAKEEEKRKKEEEEVRLKKE------------AEERELKRREAQRKQV---------- 740

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
              +E  +K+DE  ++K    +  ++    +R L+                E+QK    E+
Sbjct: 741  --EEAKRKKDEERKIKLEEIRRREEEQDRQRKLK----------------EEQKRKREEE 782

Query: 1171 RYHKVKEFMEQKLQTSKNNDPSCSEAEALD 1260
            R  K ++  +Q+LQ  K  +    E   L+
Sbjct: 783  RREKEEQKKQQQLQQQKLKEEKLKEQMRLE 812

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 46/242 (19%), Positives = 96/242 (39%), Gaps = 2/242 (0%)
 Frame = +1

Query: 502  DSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVE 681
            DS + H  L+  +      Q    HL  +   N    D   +L++           + ++
Sbjct: 557  DSDHIHRHLDDDE------QFHCVHLDHIHDDNGIVTDNEFQLQQRNAAN--FSRYKHLD 608

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEF--QDLQDDYSKKMKQKEYE 855
            +    ++  E+ + +E+  + I   D  +  E G++L      + LQ    K   +K+ E
Sbjct: 609  EQTSDVHEEEELIDDEEYESGI---DENERLEEGRKLLQIVLTKILQGRIMKSFHEKQAE 665

Query: 856  VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRL 1035
                KN +K L  +       K +  +K+K+  ++    +      ++E  KKE+E  RL
Sbjct: 666  ----KNRMKLLEELEVEESKKKEKKEKKQKKREKEKEKKKLLQQAKEEEKRKKEEEEVRL 721

Query: 1036 KFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQT 1215
            K   ++   K    +R    +   +         +E ++    +DR  K+KE  ++K + 
Sbjct: 722  KKEAEERELKRREAQRKQVEEAKRKKDEERKIKLEEIRRREEEQDRQRKLKEEQKRKREE 781

Query: 1216 SK 1221
             +
Sbjct: 782  ER 783

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 48/250 (19%), Positives = 111/250 (44%), Gaps = 14/250 (5%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL--EETEVLKSFIKEIEEVEDNKI 693
            +QL+K       +Q+ +  L+  T+    ++  ++KL  E  E  K    + EE +  + 
Sbjct: 857  DQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEA 916

Query: 694  SINSL--EQQLLEEKTA----------NNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
             + +L  EQ+ L ++T           + I+     +LQ +  ++    Q ++   SK+ 
Sbjct: 917  RVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQK 976

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
            K K   ++K +NE+K    +  N + D   +SQ+     +    +++ +  V++  ++++
Sbjct: 977  KGKA-SIKKAENELKKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQ 1035

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFM 1197
            D  + +        +K+D L++ L         F ++ ++  D+ +       H  KE  
Sbjct: 1036 DLSHEMN-------EKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEV- 1087

Query: 1198 EQKLQTSKNN 1227
             ++L++  NN
Sbjct: 1088 -RQLESDLNN 1096

>ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {ON}
            similar to Q12234 YOR216C uniprot|Q12234 Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 452

 Score = 40.0 bits (92), Expect = 0.012
 Identities = 51/258 (19%), Positives = 113/258 (43%), Gaps = 9/258 (3%)
 Frame = +1

Query: 646  LKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 825
            +K    E+E V++    + + E Q ++ K   + + ++  +LQ+    L  E   ++++ 
Sbjct: 123  MKESQNELESVQEQ---LTAYESQNMKLKQKLDSVTKEKSELQQTVVTLNKELSSIEEER 179

Query: 826  SKKMKQ-KEYE--VQKLKNEVK-FLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHV 993
                ++ +EY+  +  L+ +++ F T+ +  L+  KTQ SQ   Q  +  + ++     +
Sbjct: 180  ETVHEESQEYKKTIDDLQRQLETFNTSHSHELEFQKTQNSQLNTQLQELLLILDNNKQDI 239

Query: 994  KQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDR 1173
               + ++ED    L+F ++   K+   L+ SL+          A   + E + +  L  R
Sbjct: 240  SALHQERED----LQFNLENLTKENSILKDSLK-------EMEAELERTEQRFNDQLTQR 288

Query: 1174 YHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYV 1353
              +V      K +  ++ + + S  + +D + G +E     +E   K      K+C   V
Sbjct: 289  NIEVNSL---KAELERSKESTKSHVDTIDTLRGEVERMKDAVEQKEK----LEKECKDRV 341

Query: 1354 TGSSRLKE-----NEHIT 1392
                +L+      NEH+T
Sbjct: 342  LQIGKLRHEAIILNEHLT 359

>TPHA0F02770 Chr6 complement(612966..613847) [882 bp, 293 aa] {ON}
            Anc_6.91
          Length = 293

 Score = 39.7 bits (91), Expect = 0.012
 Identities = 44/188 (23%), Positives = 85/188 (45%), Gaps = 6/188 (3%)
 Frame = +1

Query: 676  VEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYE 855
            ++DNK+ IN++ + L    T N  L           +++  E  +LQD   K++K+K Y 
Sbjct: 54   IDDNKLIINTINKLLQSINTKNKQL-----------EQINIEKNNLQDRLEKEIKEKTYI 102

Query: 856  VQKLKNEVKFLTNMNTNLKA---DKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDEC 1026
             +KL    K  T+   N++    +K     K+ +Y    I ++KY    K   NK ++  
Sbjct: 103  NEKLIQFQKNTTHNRGNIQKPVHNKKLTVAKDSKYKNDLIALQKYS---KINVNKLQNTI 159

Query: 1027 NRLK-FVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD--AHLEDRYHKVKEFM 1197
            + L+  ++   M+K +     L  + +       +T +++ QK   A  E  Y K  + +
Sbjct: 160  DELRNSLLSTKMRKSNPGSNDLTWKIDKD-----ITTKEDIQKQDTAPQEHVYKKYHDLI 214

Query: 1198 EQKLQTSK 1221
            + +L+  K
Sbjct: 215  KLRLELVK 222

>Kwal_14.2183 s14 complement(647952..649676) [1725 bp, 574 aa] {ON}
            YPR018W (RLF2) - p90 subunit of yeast Chromatin Assembly
            Factor-I (CAF-I) [contig 227] FULL
          Length = 574

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 31/168 (18%), Positives = 90/168 (53%), Gaps = 7/168 (4%)
 Frame = +1

Query: 658  IKEIEEVEDNKIS----INSLEQQLLEEKTANNI-LRRDYYKLQERGKRLCHEFQDLQDD 822
            +++++E ++++I+    I+  E + L EK    + L+R+  + QE+ ++   + ++ Q+ 
Sbjct: 65   VQQVQESKESRIAAKYKIDKNETKRLREKQKQELRLQRELKREQEKKEKELKKEREKQEK 124

Query: 823  YSKKM--KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVK 996
              KK+  K+++ E +K +   +     +  L+ ++ +  +++++  ++   +E+  + ++
Sbjct: 125  ELKKLEDKKRKEEEKKERERKRDEEKRHRELQREQEKREREQRKVEERRKKLEE-KAKLE 183

Query: 997  QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQD 1140
            +E  KKE   +R +  ++   +K   L+  +  +T+ + SF    V+D
Sbjct: 184  EEKRKKEASIDRSQTKINNFFRKASALKNVVATKTDFEKSFLPFYVKD 231

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
            Anc_2.633 YKL079W
          Length = 682

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 51/246 (20%), Positives = 100/246 (40%), Gaps = 33/246 (13%)
 Frame = +1

Query: 523  QLEKKDLNE-KSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEE----VEDN 687
            Q+ K  LNE K+L +A+++     K+N  ++   + +++ E LKS I   EE     E N
Sbjct: 385  QINKFGLNENKTLSIALENFK--LKENNFKIQQAESVKQIEELKSIITNKEESIVLEELN 442

Query: 688  KI---------SINSLEQQLLEEKTA-------------NNILRRD---YYKLQERGKRL 792
            K+          +N+L Q ++  K A             NN   R+   Y  + +     
Sbjct: 443  KLRSENAKLKAQVNTLTQLMVSPKLASPSPMLENNKTVRNNSAERNETSYENVVQTLMEK 502

Query: 793  CHEFQDLQ---DDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKY 963
            C +  D +   DD  K +   + E  ++K+ +  +  +N++L    T    + KQ S   
Sbjct: 503  CEKLADTELSLDDKLKDILVLKRENDQIKSNIASIETLNSHLLDRITNLELQLKQLSTSN 562

Query: 964  IYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDE 1143
              +EK + H     + +  +    +   + N KK      S+ +  ++          +E
Sbjct: 563  TIMEKELDHFSNLSDSQPFKAGTDRSRTELNSKKYSFRRPSVSSSMDSTMEQIEEEQSEE 622

Query: 1144 DQKDAH 1161
            + K+ +
Sbjct: 623  ENKEVN 628

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 44/194 (22%), Positives = 81/194 (41%), Gaps = 5/194 (2%)
 Frame = +1

Query: 811  LQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSH 990
            LQ++ +   ++ E +++KL++E +   +  T  + D  + S+    ++  Y  ++   S 
Sbjct: 192  LQENRALLAEEIEPKLEKLRSEKRIFLDFQTT-QTDLERTSRVVSAFN--YYNMKHRQSS 248

Query: 991  VKQEYNKKEDECNRLKFVVDKNMKKIDHL-----ERSLQAQTNAQNSFSAVTVQDEDQKD 1155
             +Q     ED+CN LK  ++K  ++I  L     E  LQ +    N    V  + E+   
Sbjct: 249  FEQTLQDSEDKCNHLKEEIEKVSEEIKSLNEDLEELKLQKKNEMDNEGRLVNFEKEES-- 306

Query: 1156 AHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTK 1335
                     +K+    K   S  ND      + L  +    E   K LE     Y++T K
Sbjct: 307  -------DLLKQISRIKTTLSIKNDSIDEAEKELQKLNSNNEELTKELEMKLAQYTSTEK 359

Query: 1336 KCLKYVTGSSRLKE 1377
            +     +  +RLKE
Sbjct: 360  EYEIANSELTRLKE 373

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 58/272 (21%), Positives = 103/272 (37%), Gaps = 15/272 (5%)
 Frame = +1

Query: 613  DGRDKLE------ETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNILRR------ 756
            D R+K E      ET++ ++     EE+E     + S ++  L+ +T    L R      
Sbjct: 176  DRREKAERTMAKKETKLQENRALLAEEIEPKLEKLRSEKRIFLDFQTTQTDLERTSRVVS 235

Query: 757  --DYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQF 930
              +YY ++ R        QD +D    K    + E++K+  E+K L      LK  K   
Sbjct: 236  AFNYYNMKHRQSSFEQTLQDSED----KCNHLKEEIEKVSEEIKSLNEDLEELKLQK--- 288

Query: 931  SQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQ 1110
             + E     + +  EK  S + +       + +R+K  +      ID  E+ LQ + N+ 
Sbjct: 289  -KNEMDNEGRLVNFEKEESDLLK-------QISRIKTTLSIKNDSIDEAEKELQ-KLNSN 339

Query: 1111 NSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTM 1290
            N                 E+   +++  + Q   T K  + + SE   L  + G     +
Sbjct: 340  N-----------------EELTKELEMKLAQYTSTEKEYEIANSELTRLKELQGKKSELL 382

Query: 1291 KTLE-GNSKYYSTTTKKCLKYVTGSSRLKENE 1383
             TL  G S   +T      + V    +L + E
Sbjct: 383  STLSTGISSNGATDDGYSAQLVATKKKLNDTE 414

 Score = 34.7 bits (78), Expect = 0.68
 Identities = 45/214 (21%), Positives = 94/214 (43%), Gaps = 23/214 (10%)
 Frame = +1

Query: 583  KVTKQNQRQVDGRDKLEETEVLKSFIKEIEE---VEDNKISINSLEQQLLEEKTANNILR 753
            KV +   + ++ + KL+E E      K ++    + D+K++I    Q+ L E +A  I++
Sbjct: 689  KVNELELKLIEMQKKLKEQEETSQKTKSLQNELNLADHKLNI---AQRRLVENSAAQIIK 745

Query: 754  RD---YYKLQ----------ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLT- 891
            R+   + +LQ          +    L  E +  + D  +  K K  ++ KLKNE++ L  
Sbjct: 746  RNKELHEELQGCEEQILVEKKNASALEIEIETTKKDAEEFSKDKNSKLSKLKNEIEKLNK 805

Query: 892  ------NMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
                  N + +L         + +Q + +    ++ M   K    K E+E    K  VD 
Sbjct: 806  AIEDVENKSESLYDLYQNLQLETEQLANEIKSNKEMMEQTKANVGKLEEE----KVSVDS 861

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKD 1155
            ++++++     ++ QT  +   + +   DE+ K+
Sbjct: 862  HLQELN--TSLIEVQTRVKEERARLLGIDEELKE 893

>YKL201C Chr11 complement(63930..67466) [3537 bp, 1178 aa] {ON}
            MNN4Putative positive regulator of mannosylphosphate
            transferase (Mnn6p), involved in mannosylphosphorylation
            of N-linked oligosaccharides; expression increases in
            late-logarithmic and stationary growth phases
          Length = 1178

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 61/291 (20%), Positives = 115/291 (39%), Gaps = 23/291 (7%)
 Frame = +1

Query: 508  LYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFI--------- 660
            L+ +E+   KDL++   Q  +D + K+   ++  V     L E+   ++F          
Sbjct: 899  LFGYEKAMWKDLSKSMNQTTLDQVTKIV--HEEYVGKIIDLSESLKYRNFSLFNITFDET 956

Query: 661  -KEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
               +++  ++    N++E   ++ K+  N     +  L   G  L   F     D ++K 
Sbjct: 957  GTTLDDNTEDYTPANTVEVNPVDFKSNLNFSSNSFLDLNSYGLDL---FAPTLSDVNRKG 1013

Query: 838  KQ----------KEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS 987
             Q          ++Y   KL  E K         K ++ +  +KE++  +K    EK   
Sbjct: 1014 IQMFDKDPIIVYEDYAYAKLLEERK----RREKKKKEEEEKKKKEEEEKKKKEEEEKKK- 1068

Query: 988  HVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLE 1167
              K+E  KK+ E    K   ++  KK +  E+  + +   +       +++ED+++   E
Sbjct: 1069 --KEEEEKKKKEEEEKKKKEEEEKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNE 1126

Query: 1168 DRYHKVKEFMEQKLQ---TSKNNDPSCSEAEALDNVLGLIENTMKTLEGNS 1311
            D   K  E  E+K Q     KN D    + E  +      E   K  EG+S
Sbjct: 1127 DEEKKKNEEEEKKKQEEKNKKNEDEEKKKQEEEEKKKNEEEEKKKQEEGHS 1177

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 64/323 (19%), Positives = 130/323 (40%), Gaps = 33/323 (10%)
 Frame = +1

Query: 514  YHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEET---EVLKSF-------IK 663
            YHE L   + + K     I  L    K+   Q+    K +ET    + K F       I 
Sbjct: 743  YHEDLINSEYSPK-----ISALNNSMKELDEQLSNISKNKETLQGSIYKDFANKVGFTIA 797

Query: 664  EIEEVEDNKISINSLEQQLLEEK--TANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKM 837
            E EE     +  +S E Q L+++  T  N L  +  +LQ  G R+ HE            
Sbjct: 798  EYEEHTGETLREHSRELQQLQKQIMTIENKLEFETERLQ--GTRVRHE------------ 843

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
             +   +++K+K E + L    + +++   Q   +  Q++++  ++++      Q     E
Sbjct: 844  -KTIGDLEKVKQETESLEEQESKIQSQIEQVDSQISQHNEEIEHLQEASRKKYQSVKALE 902

Query: 1018 DECNRLKFVVDKNMKKIDHLERSLQA-------------QTNAQ-----NSFSAVTVQDE 1143
            +  N L  +V  + +++D L+  ++               TN +     ++   + ++  
Sbjct: 903  EIANDLNEMVQTSKREVDQLKDDIEKTGIERVNLFKNCKMTNVELPTDKSTLDELPIERI 962

Query: 1144 DQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSK--- 1314
            D +   + +        ++ K + S +N       E  ++ +  IENT++ L+ NSK   
Sbjct: 963  DSEAIEMANSITVDYSSLDNKYKESGSN----LTREEFEDSIKDIENTLRELQPNSKAVE 1018

Query: 1315 YYSTTTKKCLKYVTGSSRLKENE 1383
             +    ++    +  S +LKE E
Sbjct: 1019 RFDEAKEQFSVAIDESEKLKEIE 1041

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 61/316 (19%), Positives = 121/316 (38%), Gaps = 5/316 (1%)
 Frame = +1

Query: 394  SISSISDL-AQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAI 570
            +ISS  +L A    TL   +  + + KA       A +  Y     E K  +E+  +   
Sbjct: 20   TISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFK 79

Query: 571  DHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEEKTANNIL 750
              L K+ +  +     +D  E+ +      K I+E  +    +N L+ QL E K  N I 
Sbjct: 80   LQLEKINENTESLRKEKDAFEDEK-----FKLIDEKANASKEVNLLKSQLTELKQQNEIF 134

Query: 751  RRDYYKLQERGKRLCHEFQDLQDDYSKKM---KQKEYEVQKLKNEVKFLTNMNTNLKADK 921
            R     + +       + +  QD+  + +   K    +V +L+NEV+   + +   KA+ 
Sbjct: 135  RSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEM 194

Query: 922  TQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQT 1101
             + +Q+         ++EK ++   +E+       N                   LQ   
Sbjct: 195  QRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVN-----------------SELQTAL 237

Query: 1102 NAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKN-NDPSCSEAEALDNVLGLI 1278
            +  NS  +  ++ E      L+ R + + + ++ K+   K+  D S  E +     + L 
Sbjct: 238  SELNSIRS-ELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLK 296

Query: 1279 ENTMKTLEGNSKYYST 1326
            +  +  LE   + + T
Sbjct: 297  QRLIDLLEKQIESFKT 312

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 49/250 (19%), Positives = 98/250 (39%), Gaps = 16/250 (6%)
 Frame = +1

Query: 520  EQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDG-RDKLEETEVLKSFIKEIEEVEDNKIS 696
            E L  K L E   ++   + L  ++  + Q +  R +LE+T +         +VE  K  
Sbjct: 885  ESLNNK-LEESEARIQAFNALNYSESVESQTETLRQELEKTRI--KLADAYSQVEQYKSM 941

Query: 697  INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQD----LQDDYSKKMKQKEYEVQK 864
             +S E+     K A    + +Y +  E   +    F+D    L+D  S    +  ++  +
Sbjct: 942  ADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQ 1001

Query: 865  LKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMS-----------HVKQEYNK 1011
             ++++   T    +LKA +++    + +Y QK   I++ ++           + +QE  K
Sbjct: 1002 FESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQK 1061

Query: 1012 KEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKE 1191
              D   ++  +  +  K     E    A  NA+ +     +  E Q   + ED      +
Sbjct: 1062 HADVSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDY-EDELRLAHQ 1120

Query: 1192 FMEQKLQTSK 1221
             +E     SK
Sbjct: 1121 RIEDLNAQSK 1130

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 62/304 (20%), Positives = 128/304 (42%), Gaps = 51/304 (16%)
 Frame = +1

Query: 472  AECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKL------- 630
            A+C   ++ I SL Y++ L +  +N+  L   +  + ++ ++ + +++ +DK        
Sbjct: 166  AKCHDLEDEIQSLKYNDSLTETTMNK--LSQDLKSISEIKERLETELENKDKKMSEYYSN 223

Query: 631  --EETEVLKSFIKEIEE------------VEDNKISINSLEQQLLEEKTANNIL------ 750
               E + L+  I  +E              ++N+I  ++L ++  + +   N+       
Sbjct: 224  CQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEE 283

Query: 751  -RRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKE----------YEVQKLKNE-VKFLTN 894
             +++    QE    L  + Q LQDDY++ +  K+           EV++LK + ++  T 
Sbjct: 284  SQKELSLKQEMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQ 343

Query: 895  MNTNLKADKTQFSQKEKQ--YSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKI 1068
            +N  L+  +    Q E     +Q+   ++     + QE  +KE   N+++  + +  KK+
Sbjct: 344  LNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKV 403

Query: 1069 ----------DHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTS 1218
                      D LE+ L   T    +      Q  ++ DA L   +  VK   E K  T 
Sbjct: 404  PTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDA-LRQNFKSVK--WETKSLTK 460

Query: 1219 KNND 1230
            + ND
Sbjct: 461  QRND 464

>Kpol_479.8 s479 complement(16333..17766) [1434 bp, 477 aa] {ON}
            complement(16333..17766) [1434 nt, 478 aa]
          Length = 477

 Score = 39.7 bits (91), Expect = 0.016
 Identities = 58/265 (21%), Positives = 122/265 (46%), Gaps = 11/265 (4%)
 Frame = +1

Query: 622  DKLEETEVLKSFIKEIEEVEDNKISINSLEQQLLEE-KTANNILRRDYYKLQERGKRLCH 798
            +K  + E+L    K+I+ ++    +++ L +   +E K +  +++ +  + Q+  + + H
Sbjct: 8    EKKRDAEILP-LKKKIDSIDSELKTLDKLMKTNSKEIKQSEKLVKSNEKEFQKIHREVLH 66

Query: 799  EFQDLQDDYSKKMKQKEYEVQKLKNEVK-FLTNMNTNLKADK--TQFSQKEKQYSQKYI- 966
              +  +DD   K+K KE E+++   E+K  L   N +L  D   ++  + ++Q + K + 
Sbjct: 67   S-ESHRDDIHGKIKNKEIEIKRKNAEIKSMLVKNNEDLSVDSVDSKIVETKRQLTDKDLT 125

Query: 967  YIEKYMSHVK----QEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTV 1134
             +EK    ++    Q + KK      ++  ++ +  ++  L+  L A     N    + V
Sbjct: 126  LVEKRKLSLELQSLQNHKKKLIPIKSIQDSIESDRAELASLKEQLHA-----NKLRELKV 180

Query: 1135 QDEDQKDAHLEDRYHKVKEFMEQKLQT--SKNNDPSCSEAEALDNVLGLIENTMKTLEGN 1308
            Q + +    +ED+  K+ E  E+K     SK +     ++E L  +  L  N  K L+  
Sbjct: 181  QLDKKSSVMIEDK-SKLFELKERKNFEIFSKTHQLHQEKSELLKQINKLNSNFDKDLKKF 239

Query: 1309 SKYYSTTTKKCLKYVTGSSRLKENE 1383
            +K     T +  K    +S+LKE E
Sbjct: 240  NKKNIELTIENEK----NSKLKELE 260

>NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {ON}
            Anc_8.636 YOR216C
          Length = 487

 Score = 39.7 bits (91), Expect = 0.016
 Identities = 72/367 (19%), Positives = 149/367 (40%), Gaps = 28/367 (7%)
 Frame = +1

Query: 376  IPTKHISISSISDLAQTFETLAVGITH-ETNRKAECERSKNAIDSLYYH--------EQL 528
            + T  +  S   D  Q  E +A  +   + N   E ++    I++L           E+ 
Sbjct: 39   VDTPEVQQSENKDDLQISEAVAPEVLEPKVNENTELQKKDAEIEALKKELAHLTKEFEET 98

Query: 529  EKKDLNEKSLQMAIDHLLKVTKQNQRQV----DGRDKLE-ETEVLKSFIKEIEEV----E 681
            + +  NE   Q+ I    + T     +     + RD  E +  +L S I  ++ V    +
Sbjct: 99   KSRASNEVPAQVKITTESEATSDQTEEFTKVKEERDHFESQYNMLLSRISSMKNVFQKMK 158

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCH-------EFQDLQDDY-SKKM 837
            +++  +  +++QL E ++ N  L+     + +  K L         EF  L+ +Y + + 
Sbjct: 159  ESQRELELVQEQLNEYESQNIKLKSKVESVTKENKELSSTVITLNKEFSTLESEYEALEN 218

Query: 838  KQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK-QYSQKYIYIEKYMSHVKQEYNKK 1014
               EYE +K+K+    L N +++  +   + SQKEK Q   +   +   + + KQ+    
Sbjct: 219  TSSEYE-KKIKSLEHQLDN-SSSTHSHALEASQKEKEQLDSQLQELIVILDNNKQDIADL 276

Query: 1015 EDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEF 1194
            +DE   LK           +L+     + N +N    V+++ E++ +   E+   K KE 
Sbjct: 277  KDEKEELK----------QNLQTYENEKKNLENLVEQVSMKLEEETNRSKENIQEKEKEI 326

Query: 1195 MEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTTKKCLKYV-TGSSRL 1371
               ++Q     + +   A+ + N+   IE   +     +K    +  + ++        +
Sbjct: 327  NALRVQLDTKLETNKELAQEMQNLNDEIEKLKEGTAAKAKLEEESKNQAVQIAKLRHEAI 386

Query: 1372 KENEHIT 1392
              NEH+T
Sbjct: 387  ILNEHLT 393

>YML071C Chr13 complement(129749..131572) [1824 bp, 607 aa] {ON}
            COG8Component of the conserved oligomeric Golgi complex
            (Cog1p through Cog8p), a cytosolic tethering complex that
            functions in protein trafficking to mediate fusion of
            transport vesicles to Golgi compartments
          Length = 607

 Score = 39.7 bits (91), Expect = 0.017
 Identities = 42/218 (19%), Positives = 95/218 (43%), Gaps = 24/218 (11%)
 Frame = +1

Query: 526  LEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEI--------EEVE 681
            L+ +  NE  ++M +   ++V +++         +     LKSF+ +         EE+E
Sbjct: 313  LDVESSNESLIEMMVKRKIEVLREHVY-------MSLNVFLKSFLYDTNDLEIPFPEELE 365

Query: 682  DNKISINSLEQQLLEEKTANNILRRDYYKLQ-----ERGKRLCHEFQDLQDDYSKKMKQK 846
               + IN   ++   E+      + +Y K       E         +D+Q++   K++ +
Sbjct: 366  STVLRINGTNEEKEIEEKEKETKKEEYQKQDSVANNEEDVTENKSIEDVQEEVQGKVEGE 425

Query: 847  EYEVQ-KLKNEVKFLTNMNTNLKADK----------TQFSQKEKQYSQKYIYIEKYMSHV 993
            +   + K +NE++  T   T  KA+K           +  ++E++ ++  +  E+    +
Sbjct: 426  DDGAERKTENEIENETVNKTEDKAEKEKEEEVNTKDNKAEKEEEEINKVEVTPEEPSKSI 485

Query: 994  KQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNA 1107
              +  K+E+E N+++   ++  KKI   +R  +  TNA
Sbjct: 486  DNKAEKEEEEINKVEVTPEEPSKKIRTSKRENKIPTNA 523

>ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 708

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 73/338 (21%), Positives = 137/338 (40%), Gaps = 49/338 (14%)
 Frame = +1

Query: 418  AQTFETLAV---GITHETNRKAECERSKNAIDSL-------YYH--EQLEKKDLNEKSLQ 561
            AQ  ETLA    G   +T +  E  R +  ++S        Y H  E L+ K  N ++  
Sbjct: 387  AQLEETLAAQEGGRDEKTRQLEELLRHREELESRISTLQKEYTHREENLQSKVQNLETEL 446

Query: 562  MAIDHLLKVTKQNQRQVDGRDKLE-ETEVLKSFIKEIEEVEDN----KISINSLEQQLLE 726
             +I+      + N+ Q+  R +LE + +  + + K  E V D+    +  +  L   + E
Sbjct: 447  KSINQNTHTHESNEAQL--RQELESKVQECQHWQKNYETVNDDVEILRAEVKELYSDIDE 504

Query: 727  EKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK----------KMKQKEYE-VQKLKN 873
             K   + L     +L+E+     H++++ + DY K          K    E E + +L+ 
Sbjct: 505  HKELKHYLETSIAQLEEQVNGWRHKYEEHRKDYDKVLLELDSIHLKYNNTEGEHLTELEQ 564

Query: 874  EVKFLTNMNTNLKADKTQFSQ------------KEKQYSQKYIYIEKYMSHVKQEYNKKE 1017
                L+++   LK D    SQ            K+ Q       + K +   K+++  KE
Sbjct: 565  LHDNLSSLQITLKKDSELISQLTRKNETLEFQLKDLQTPSDVPQLHKEIESWKEKFYNKE 624

Query: 1018 DECNR-LKFVVD--------KNMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLED 1170
             E NR LK + +        K+ +K+  L++    +T  Q     +++Q+E         
Sbjct: 625  AESNRSLKLLAEDLYIQYSSKHEQKVKLLKKGY--ETRYQGKLDKLSLQNEG-------- 674

Query: 1171 RYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIEN 1284
                    +EQ++   K+     +E +    ++GL+EN
Sbjct: 675  --------LEQEVDQLKSQ--LATERKEKQKLIGLLEN 702

 Score = 35.8 bits (81), Expect = 0.28
 Identities = 47/217 (21%), Positives = 92/217 (42%), Gaps = 15/217 (6%)
 Frame = +1

Query: 697  INSLEQQLLEEKTANNILRRDYY-KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKN 873
            I+S +  + + +   + LR+DY  KL++R   +    Q+  + Y ++       V + ++
Sbjct: 224  ISSCDSTVGKYRRQIDSLRQDYESKLEDRMSEMASVIQE-SNTYKERFNIARRRVSETRD 282

Query: 874  EVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDK 1053
            E+K + N N ++  +K + +  E             +   +++ N+ E+E ++LK    +
Sbjct: 283  EIKMI-NQNQSILRNKYEGATAE-------------LEECRRKLNELEEENSKLKSESSE 328

Query: 1054 NMKKIDHLE--------RSLQAQTNAQNSFSAVTVQDE--DQKDAHLEDR---YHKVKEF 1194
            N  K   LE        R+   +T  QN   A    D   D     L+DR     K+K  
Sbjct: 329  NGIKFSRLENMYQEALRRTQNLETANQNVLDAQAESDRKLDALSHELDDRSEECQKLKAQ 388

Query: 1195 MEQKLQTSK-NNDPSCSEAEALDNVLGLIENTMKTLE 1302
            +E+ L   +   D    + E L      +E+ + TL+
Sbjct: 389  LEETLAAQEGGRDEKTRQLEELLRHREELESRISTLQ 425

>KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conserved
            hypothetical protein
          Length = 760

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 40/206 (19%), Positives = 90/206 (43%), Gaps = 16/206 (7%)
 Frame = +1

Query: 523  QLEKKDLNEKSLQMAIDHLLKVTKQNQRQV-DGRDKLEETEVLKSFIKEIEEVEDNKISI 699
            +L+K+D +   ++   + L  + ++    V D  +   E +++KS ++E     DN I+ 
Sbjct: 396  ELKKQDRSSSRIRDLEEELSSLRERYDCSVEDAYNCRNELKIVKSELEETRHEVDNTINR 455

Query: 700  -----NSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMK-----QKE 849
                 + L++++    +    LR +     E  K+   + ++L+D   K        Q E
Sbjct: 456  MDKIKSDLKEEINRRISTEETLRGELDIAAESAKKELSKSEELRDSLIKSKNEQEALQAE 515

Query: 850  YEVQKLKNE-----VKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKK 1014
              V K +NE     +  L  + + L+A+  +  ++  Q  Q +   +   +H K    K 
Sbjct: 516  TLVLKEQNETSRSRINELVQLVSQLEAEARKAREENSQLQQSFQEKDVLATHAKMANVKL 575

Query: 1015 EDECNRLKFVVDKNMKKIDHLERSLQ 1092
            + +C R +  +    +++D L R ++
Sbjct: 576  QKDCQRERCKLLDGRRELDLLRRQME 601

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar to
            uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
            weakly similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component
          Length = 835

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 53/272 (19%), Positives = 121/272 (44%), Gaps = 8/272 (2%)
 Frame = +1

Query: 598  NQRQVDGRDKLEETEVLKSFIKE--IEEVEDNKIS--INSLEQQLLEEKTANNILRRDYY 765
            NQ+ ++ + KL + E   +  K+  + EV+       ++ ++ QL +     N  R +  
Sbjct: 184  NQQYLELKAKLIQVEANAAENKQEPVTEVDHTACQRELSYVQNQLEKTTLQLNTYRDEVA 243

Query: 766  KLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEK 945
             L+++  R+       Q+D   K +Q + E+Q L+++V    N+N +L         KE 
Sbjct: 244  HLEDKTIRI-------QEDQRAKEEQHQLEIQMLRSDV---NNLNVSL-------VNKES 286

Query: 946  QYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQTNAQNSFSA 1125
            +  +    I++ M+ + +  +K       L+  ++     I  LE+ ++A T+ +     
Sbjct: 287  ELEEDRAKIQRLMNQLHEFDHKGSQSLLDLERQLEMKRDSISSLEKEVRALTHDRVHLE- 345

Query: 1126 VTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTL-- 1299
              ++D + ++A       K++  +E+     KNN+ S  E   L +    +++ ++ L  
Sbjct: 346  TRIKDREIENA-------KIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDKVRNLTE 398

Query: 1300 --EGNSKYYSTTTKKCLKYVTGSSRLKENEHI 1389
                 ++  S   K+C ++    S+ + NE +
Sbjct: 399  ERHNLNQRISALRKECDEW---KSKYQRNESL 427

 Score = 35.4 bits (80), Expect = 0.38
 Identities = 46/219 (21%), Positives = 84/219 (38%), Gaps = 9/219 (4%)
 Frame = +1

Query: 469  KAECERSKNAIDSLYYHEQLEKKDLNEKSLQMAIDHLLKVTKQNQRQVDGRDKLE----E 636
            +A+ +R  N +    +       DL E+ L+M  D +  + K+ +     R  LE    +
Sbjct: 292  RAKIQRLMNQLHEFDHKGSQSLLDL-ERQLEMKRDSISSLEKEVRALTHDRVHLETRIKD 350

Query: 637  TEVLKSFIK-EIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDL 813
             E+  + I+ E+E + DN  + NS   ++ E K A   L      L E    L      L
Sbjct: 351  REIENAKIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDKVRNLTEERHNLNQRISAL 410

Query: 814  QDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYI----EKY 981
            + +  +   + +       N  K   ++   L+  KTQ  +  K   Q    +     K 
Sbjct: 411  RKECDEWKSKYQRNESLDSNHRKAFDSLRQELQTTKTQLEETRKTAQQLQTQVIENTTKN 470

Query: 982  MSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSLQAQ 1098
                 Q    KE +  +L+  +    +++    R LQA+
Sbjct: 471  SERTSQRIKDKETQIQKLESELQFCKQQLKDGSRRLQAE 509

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
            ZIP1Transverse filament protein of the synaptonemal
            complex; required for normal levels of meiotic
            recombination and pairing between homologous chromosome
            during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 51/237 (21%), Positives = 103/237 (43%), Gaps = 22/237 (9%)
 Frame = +1

Query: 580  LKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQLL-------EEKTA 738
            LK   Q Q+Q + + K+       +  K  E+V   K  + +L++++         ++T 
Sbjct: 194  LKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETK 253

Query: 739  NNILRRDYYKLQERGKRLCHEFQDLQ---DDYSKKMKQKEYEVQKLKNEVKFLT----NM 897
               LR+++   Q R        ++L    +D  K  K+ + E+ K   E+++L     + 
Sbjct: 254  LKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKGKEIEYLKRELDDC 313

Query: 898  NTNLKADKTQFS----QKEKQYSQKYIYIEKYMSHVKQ----EYNKKEDECNRLKFVVDK 1053
            +  L  +K + S    +  K   +    IE + S  K     ++NK E+   R+  + +K
Sbjct: 314  SGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDKAHHLLQFNKFEE---RVHDLFEK 370

Query: 1054 NMKKIDHLERSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKN 1224
             ++K  H +    A+          TV+     +  L+ +Y  +KE +EQK+ +SK+
Sbjct: 371  KLQK--HFD---VAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENLEQKMSSSKD 422

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,479,345
Number of extensions: 2503185
Number of successful extensions: 12140
Number of sequences better than 10.0: 834
Number of HSP's gapped: 11823
Number of HSP's successfully gapped: 1079
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)
S2: 35 (18.1 bits)