Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3446.69ON46546523150.0
YOR177C (MPC54)6.69ON46446518420.0
Suva_8.2336.69ON46546518180.0
Smik_15.3626.69ON46546518130.0
CAGL0A00583g4.121ON64665830.13
KLTH0E01650g7.488ON139690830.15
Kpol_1008.29singletonON538150830.15
Ecym_60652.399ON28272770.49
ZYRO0A11308gsingletonON28559770.59
ZYRO0A11242gsingletonON28559731.8
TDEL0A034005.476ON810131732.0
NDAI0G035308.125ON53978714.0
SAKL0A08206g6.69ON64546714.3
Kpol_1053.373.106ON74486714.5
SAKL0H25608g4.25ON204165685.2
ZYRO0E04708gsingletonON61198696.1
Kwal_55.198087.488ON825105696.2
TBLA0A104705.267ON199991697.4
NOTE: 6 genes in the same pillar as Skud_15.344 were not hit in these BLAST results
LIST: KLTH0G15334g AGR274C Kwal_56.23256 TDEL0G04560 Ecym_3119 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.344
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...   896   0.0  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...   714   0.0  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...   704   0.0  
Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...   702   0.0  
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    37   0.13 
KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa] ...    37   0.15 
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    37   0.15 
Ecym_6065 Chr6 complement(122890..123738) [849 bp, 282 aa] {ON} ...    34   0.49 
ZYRO0A11308g Chr1 complement(907471..908328) [858 bp, 285 aa] {O...    34   0.59 
ZYRO0A11242g Chr1 complement(901859..902716) [858 bp, 285 aa] {O...    33   1.8  
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...    33   2.0  
NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125     32   4.0  
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    32   4.3  
Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON} (57362....    32   4.5  
SAKL0H25608g Chr8 complement(2243456..2244070) [615 bp, 204 aa] ...    31   5.2  
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    31   6.1  
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    31   6.2  
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    31   7.4  

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/465 (94%), Positives = 440/465 (94%)

Query: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 120
           KNSSIRRG                         DCGFDYERRFETRDDTFKEVNDAVNRC
Sbjct: 61  KNSSIRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVNDAVNRC 120

Query: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180
           YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD
Sbjct: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180

Query: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240

Query: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300
           LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN
Sbjct: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300

Query: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360
           TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE
Sbjct: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360

Query: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420
           RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD
Sbjct: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420

Query: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465
           NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN
Sbjct: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/465 (75%), Positives = 395/465 (84%), Gaps = 1/465 (0%)

Query: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPED SY+  FE++ NN SH ISP+KDS++K+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDTSYSNSFEDYYNN-SHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59

Query: 61  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 120
           KN++++R                             FD E + E++++T KEVNDAVNRC
Sbjct: 60  KNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119

Query: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180
           YALCNIPTKH+SI+SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179

Query: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETE LKSFI+EIEEV+DNKISINSL+QQL
Sbjct: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239

Query: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300
           LEEKTANNILRRDYYKLQERG+RLCHEFQ+LQDDYSK+MKQKEYEVQKLKNE+K L NMN
Sbjct: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299

Query: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360
            NLKA+K  +SQKEKQY QKY YIEKYM+HVK+EYN+KEDEC +L F++DK+MKKI+HLE
Sbjct: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359

Query: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420
           RSLQ Q  AQNSFS   +Q+E  KDAHL+DRYHKVKEFMEQKLQTSK NDPSCSEAEALD
Sbjct: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419

Query: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465
           NVL LIE++MKTL+ NSK Y   TKKC+KYVT S RLKENEH+TN
Sbjct: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/465 (74%), Positives = 392/465 (84%)

Query: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPED  Y+  + E +N+N + +SP+KDS+FK++TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 120
           K+S I++                            GFDY  + E+ D+TFK+VNDAVNRC
Sbjct: 61  KSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180
           YALCNIPTKH+SI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETEVLKSF +EIEEV+DNKISIN+LEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240

Query: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300
           LEEK ANNILRRDYYKLQERG+RLCHEFQDLQ+DY++++K KEYE+QKLKNE+K L NMN
Sbjct: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300

Query: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360
            NLKADKTQFSQ EKQY QKY YIEKYM+HVK+EYNKKEDEC++LKF++D N+KKIDHLE
Sbjct: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360

Query: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420
           R+LQ+Q   QNSFS   +Q+ED  DAHLEDRY KVKEFMEQKLQTSK +DP  SE EALD
Sbjct: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420

Query: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465
           NVLGLIENTMKTL+ NSKY  TTTKKC+KYV GSSRLKENEHITN
Sbjct: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465

>Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/465 (74%), Positives = 394/465 (84%)

Query: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MP+DI+Y+  FEEF+N+N+  +SP+KD +FK+MTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGFDYERRFETRDDTFKEVNDAVNRC 120
           KNSSI+R                             F+Y  + ETR++TFK+VNDAVNRC
Sbjct: 61  KNSSIKRTFQTSTSTTTTPNKSSLKSPKSKKTSKDIFNYGNKSETREETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180
           YALCNIPTKHISI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL++TEVLKSFI+EIEEV+DNKISINSLEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240

Query: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300
            EEKTANNILRRDYYKLQERG+RLCH+FQDLQDDYSK+MKQKEYEVQKLKNE+K L  MN
Sbjct: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300

Query: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360
            NLKAD+T  SQKEKQY QK  YIEKYM+HVK+EYN+KE+ECN+LK+++DK+MK+I+HLE
Sbjct: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360

Query: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420
           RSLQ+Q+  QNSFS  T+ +E  KD  LEDRYHKVKEFMEQKLQTSK +D SCSE EALD
Sbjct: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420

Query: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465
           NVLGLIENTMK L+ N+KY  TT KKC+KYVTGSSR  ENEHITN
Sbjct: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465

>CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly
           similar to uniprot|Q06149 Saccharomyces cerevisiae
           YLR266c
          Length = 646

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%)

Query: 385 DAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALDNVLGLIENTMKTLEGNSKYYSTTT 444
           D H+ED + +    + +++  S +N+P+  +   LD ++G++E  +  L  NS  +  T 
Sbjct: 512 DLHIEDVFPEYGTVVGEEILNSYSNNPNVFKIVLLDILIGVLELKLAPLWSNSDLFQFTL 571

Query: 445 KKCLK 449
            K LK
Sbjct: 572 VKSLK 576

>KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1396

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%)

Query: 274 DYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ 333
           + S ++ Q   E+  L N+V  LTN  T +   KT+  Q+ K+ +     IE  M+ ++ 
Sbjct: 597 NASLQLSQATTELANLSNQVGSLTNQATLVNERKTRAQQELKRINNLKSSIETKMTTLRG 656

Query: 334 EYNKKEDECNRLKFVVDKNMKKIDHLERSL 363
            Y K+  E  +L+ ++ K+ ++ + L+R L
Sbjct: 657 SYEKELSETEQLESILTKSRQESEELKREL 686

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 62/150 (41%), Gaps = 31/150 (20%)

Query: 38  PNVRFGDDDVNIFDQRKKVNEINKNSSIRRGXXXXXXXXXXXXXXXXXXXXXXXXXDCGF 97
           P +RF  + + IFDQ K+V++    S I++                              
Sbjct: 72  PKIRFDCNRILIFDQDKEVSK----SGIQKILTKSSSSQKSILKKRED------------ 115

Query: 98  DYERRFETRDDTFKEVNDAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRK 157
           D E +   +DD   E+   V R + LC +  KH  I  IS   +  E L+V IT+  N K
Sbjct: 116 DIEDKLYPQDD---EITQIVKRMFTLCGVNLKH--IEGIS-FKEQLERLSVSITNAFNTK 169

Query: 158 AECERSKNAIDSLYYHEQLEKKDLNEKSLQ 187
             C +        Y  ++LE + LN+K L+
Sbjct: 170 EMCSK--------YIKQKLESQ-LNDKILE 190

>Ecym_6065 Chr6 complement(122890..123738) [849 bp, 282 aa] {ON}
           similar to Ashbya gossypii ADR244W
          Length = 282

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 291 NEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQ---------EYNKKEDE 341
           N ++ L  + T LK D  QFS K    S KY+YIE   + +++         E+ + ++ 
Sbjct: 64  NNLQVLEEVTTPLKGDVVQFSFKAPSISCKYLYIEGSQTFIRRFQIGFITGNEFLQTKEV 123

Query: 342 CNRLKFVVDKNM 353
            ++L FV+   M
Sbjct: 124 LSKLGFVMRNAM 135

>ZYRO0A11308g Chr1 complement(907471..908328) [858 bp, 285 aa] {ON}
           no similarity
          Length = 285

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 171 YYHEQLEKKDLNEKSLQMAIDH-LLKVTKQNQRQVDGRDKLE-ETEVLKSFIKEIEEVE 227
           +YH  LE +  +E      I H LL  T      +DGR+K+  ET+VL+  +KE+ EV+
Sbjct: 75  FYHNPLESELSDEFCPLWTISHYLLCFTFSIFSFIDGREKVNIETKVLQKLLKEVAEVD 133

>ZYRO0A11242g Chr1 complement(901859..902716) [858 bp, 285 aa] {ON}
           no similarity
          Length = 285

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 171 YYHEQLEKKDLNEKS-LQMAIDHLLKVTKQNQRQVDGRDKLE-ETEVLKSFIKEIEEVE 227
           +YH+ LE +  +  S L M I +LL  T      +D R K++ ET+VL+  +KE+ EV+
Sbjct: 75  FYHDPLESELSDFLSPLWMIIHYLLCFTFSIFSFIDDRKKVKIETKVLQKLLKEVAEVD 133

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 11/131 (8%)

Query: 218 SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK 277
           SFI     + + +     LE +L E   + + LR DY+ LQ +   L  + + L  D  K
Sbjct: 265 SFILHRYSIFNQQFQSQQLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVK 324

Query: 278 KMK--QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE----KYMSHV 331
            +   QK   +QKL +EV        +LK D ++  Q +K + Q+  Y+E    ++ +++
Sbjct: 325 LLDFLQKFVTLQKLSSEVYH----EASLKDDPSKLHQFQK-HQQEMSYLEQEILRFKANL 379

Query: 332 KQEYNKKEDEC 342
            Q   KK   C
Sbjct: 380 MQRLTKKLGSC 390

>NDAI0G03530 Chr7 (849660..851279) [1620 bp, 539 aa] {ON} Anc_8.125
          Length = 539

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 9/78 (11%)

Query: 220 IKEIEEVEDNKIS----INSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 275
           I  I+E+ DN +S       L QQLL   +   I   D  K  +R     H FQ+  DDY
Sbjct: 399 ISSIKELTDNNLSDTQLFTILFQQLLTPGS--KISSLDLEKFYQR---KIHSFQNKLDDY 453

Query: 276 SKKMKQKEYEVQKLKNEV 293
           S+ +   E  +  +  ++
Sbjct: 454 SRVLSDIESAISGINGDI 471

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 115 DAVNRCYALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAEC 160
           +A+ RC+ LCN+P + +      DL  + + L+ GI      +  C
Sbjct: 217 EAITRCFNLCNVPLEDL---DEDDLVMSLQRLSFGIVSAFKTQEMC 259

>Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON}
           (57362..59596) [2235 nt, 745 aa]
          Length = 744

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 217 KSFIKEIEEVEDNKISINSLE-QQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDY 275
           KS I E+EEVED+KI   S+E +QL++E   N   R   +  +          +D ++D 
Sbjct: 127 KSIISEVEEVEDSKIDPPSIEKEQLVDEHQPNRFWRSWRHSHRHGSASDLSSVRDFEEDE 186

Query: 276 SKKM--KQKEYEVQKLKNEVKFLTNM 299
           + K   K +  E   L NE K   NM
Sbjct: 187 NVKTLRKSQSREELILSNEAKRKRNM 212

>SAKL0H25608g Chr8 complement(2243456..2244070) [615 bp, 204 aa]
           {ON} similar to uniprot|Q07843 Saccharomyces cerevisiae
           YLL033W
          Length = 204

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 78/165 (47%), Gaps = 15/165 (9%)

Query: 240 LLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNM 299
           L+ E    ++++  Y +L  R K    + + +QD Y       EY   K K+E   L + 
Sbjct: 34  LINEYPREDVIKITYRRLI-RLKPFVSQRKMVQDTYV------EYLRYKYKSEDYKLKSS 86

Query: 300 NTNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHL 359
             N++ + T+ S  E Q +Q   +I K +SH++        + N L   + KN+  +++ 
Sbjct: 87  LCNIRIEHTEASDLE-QATQSLQFILKAVSHIESGSCPSAVD-NTLCRKILKNLLTMEYY 144

Query: 360 ERSLQAQTNAQN------SFSAVTVQDEDQKDAHLEDRYHKVKEF 398
           +++L  Q+   N      SF  +    +D++D H+  RY+ + E+
Sbjct: 145 KQTLIRQSPTSNYQLLRKSFGYLAPSKDDKRDNHINSRYNSMGEY 189

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 33/98 (33%), Gaps = 11/98 (11%)

Query: 30  FKDMTPSKPNVRFGDDDVNIFDQRKKVNEINKNSSIRRGXXXXXXXXXXXXXXXXXXXXX 89
           F  +   K NV+FGD ++ IF++ +++    K +S                         
Sbjct: 68  FSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANSSVDNVILPLPILKISQKGASDIKYM 127

Query: 90  XXXXDCGFDYERRFETRDDTFKEVNDAVNRCYALCNIP 127
                     ER FE              RCY LCN+P
Sbjct: 128 EPDNKMATQQERLFE-----------VFRRCYTLCNLP 154

>Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047C
           (EDE1) - EH domain protein involved in endocytosis
           [contig 159] FULL
          Length = 825

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 50/105 (47%), Gaps = 2/105 (1%)

Query: 259 ERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYS 318
           +RG R   +   L  D S ++     E+  L N+V  LTN  T +   K +  Q+ K+ +
Sbjct: 572 QRGTRDMSD--SLDGDTSLQLSHATTELANLSNQVGSLTNQATLVNERKARAQQELKRIN 629

Query: 319 QKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLERSL 363
                IE  M  ++  Y  +  +   ++ ++ ++ ++++ L+R L
Sbjct: 630 DLKSSIETKMVSLRGSYQSELKQTEEIEALLSQSRQQVEELKREL 674

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]
           {ON} Anc_5.267 YHR023W
          Length = 1999

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 11/91 (12%)

Query: 233 INSLEQQLLEE-------KTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYE 285
           INSL+  +LE+       K  ++   + +  L E    L  + + + D    KM+ +E E
Sbjct: 908 INSLKNHILEKNDELDKIKLESDATLKKWESLNETNNTLTKDLKSMTD----KMETREKE 963

Query: 286 VQKLKNEVKFLTNMNTNLKADKTQFSQKEKQ 316
           ++ LKN+   +  +NT LK  K +  QK+K+
Sbjct: 964 IETLKNDTTKIDEINTQLKEAKEKILQKDKE 994

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,266,431
Number of extensions: 2455156
Number of successful extensions: 15516
Number of sequences better than 10.0: 1371
Number of HSP's gapped: 15219
Number of HSP's successfully gapped: 1967
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)