Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3366.65ON28626612791e-179
Smik_15.3526.65ON2882699991e-137
Suva_8.2276.65ON2872689931e-136
YOR174W (MED4)6.65ON2842669711e-132
NCAS0F003306.65ON2812386941e-90
ZYRO0D14190g6.65ON2951826655e-86
Kpol_1042.116.65ON2922556385e-82
CAGL0L04620g6.65ON2642276331e-81
KNAG0M010206.65ON2792216072e-77
NDAI0J013206.65ON3342216087e-77
SAKL0A08426g6.65ON2991766013e-76
AGR270W6.65ON2942315831e-73
TBLA0G005506.65ON3181905832e-73
KAFR0G025006.65ON2892365778e-73
KLTH0G15444g6.65ON2632275531e-69
Kwal_56.232426.65ON2562255487e-69
TPHA0F025906.65ON3062325475e-68
Ecym_31246.65ON2741975062e-62
TDEL0G040606.65ON2201645004e-62
KLLA0F20185g6.65ON2851694881e-59
KNAG0E024802.467ON493142750.64
KLLA0F23309g7.48ON328115721.1
KLLA0C04994gsingletonON608109721.4
KLLA0D11132g2.101ON12934672.4
Suva_13.1992.590ON84078702.8
TDEL0B003308.864ON461123693.6
TPHA0H008402.56ON81553693.9
TBLA0F038408.235ON125697685.4
NDAI0J025504.300ON47989675.7
NDAI0G056301.295ON1229133676.1
KLLA0C12551g2.591ON60758676.5
KNAG0H011903.278ON21841657.4
KAFR0I024905.32ON36277667.9
TBLA0D01940singletonON107885659.8
TDEL0H010401.222ON35462659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.336
         (286 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   497   e-179
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   389   e-137
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   387   e-136
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   378   e-132
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   271   1e-90
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   260   5e-86
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   250   5e-82
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   248   1e-81
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   238   2e-77
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   238   7e-77
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   236   3e-76
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   229   1e-73
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   229   2e-73
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   226   8e-73
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   217   1e-69
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   215   7e-69
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   215   5e-68
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   199   2e-62
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   197   4e-62
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   192   1e-59
KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.4...    33   0.64 
KLLA0F23309g Chr6 complement(2175773..2176759) [987 bp, 328 aa] ...    32   1.1  
KLLA0C04994g Chr3 (453438..455264) [1827 bp, 608 aa] {ON} weakly...    32   1.4  
KLLA0D11132g Chr4 (950190..950579) [390 bp, 129 aa] {ON} highly ...    30   2.4  
Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {...    32   2.8  
TDEL0B00330 Chr2 (61668..63053) [1386 bp, 461 aa] {ON} Anc_8.864...    31   3.6  
TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.5...    31   3.9  
TBLA0F03840 Chr6 complement(950528..954298) [3771 bp, 1256 aa] {...    31   5.4  
NDAI0J02550 Chr10 (629573..631012) [1440 bp, 479 aa] {ON} Anc_4....    30   5.7  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    30   6.1  
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    30   6.5  
KNAG0H01190 Chr8 complement(201945..202601) [657 bp, 218 aa] {ON...    30   7.4  
KAFR0I02490 Chr9 complement(504333..505421) [1089 bp, 362 aa] {O...    30   7.9  
TBLA0D01940 Chr4 complement(480209..483445) [3237 bp, 1078 aa] {...    30   9.8  
TDEL0H01040 Chr8 complement(179980..181044) [1065 bp, 354 aa] {O...    30   9.9  

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  497 bits (1279), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 254/266 (95%), Positives = 254/266 (95%)

Query: 1   MSVQNTKAVEFPMGHIKXXXXXXXXXXXXNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60
           MSVQNTKAVEFPMGHIK            NMNSEDKLSKVQLYEDLCRYEGVLSKLVESV
Sbjct: 1   MSVQNTKAVEFPMGHIKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60

Query: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120
           DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE
Sbjct: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120

Query: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180
           CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF
Sbjct: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISD 240
           IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISD
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISD 240

Query: 241 KDTFIFKGTPHKDAEHTPGIKDKEEE 266
           KDTFIFKGTPHKDAEHTPGIKDKEEE
Sbjct: 241 KDTFIFKGTPHKDAEHTPGIKDKEEE 266

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  389 bits (999), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/269 (72%), Positives = 218/269 (81%), Gaps = 3/269 (1%)

Query: 1   MSVQNTKAVEFPMGHIKXXXXXXXXXXXXNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60
           MSVQ+TKAV+F MGH+K            NMNSEDKLSKVQLYEDLCRYE  L KLVESV
Sbjct: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60

Query: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120
           DRFKPD+DVARDLI  DESLFNNV LL++YDNIDRNL+KIDKDSEELDSK+++ILEI+NE
Sbjct: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120

Query: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180
           CHDEL  LP LEQVEFEKNTILQQRSKINSTALLDYATKLSKFT+IPPTFDKG++GPNNF
Sbjct: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQ---EEQEAQNED 237
           IWPAEDALRRGMLAMASLHSKELTRVPGE+ +E  E     +S P Q     E +   E+
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEE 240

Query: 238 ISDKDTFIFKGTPHKDAEHTPGIKDKEEE 266
           +   D+FIF GT +K++E     KDKEEE
Sbjct: 241 VPSTDSFIFNGTANKNSEEVGDAKDKEEE 269

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  387 bits (993), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 199/268 (74%), Positives = 224/268 (83%), Gaps = 2/268 (0%)

Query: 1   MSVQNTKAVEFPMGHIKXXXXXXXXXXXXNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60
           MSVQ+TKAVEFPM  I+            +MNSE K SKVQLYEDLCRYE +L KLVESV
Sbjct: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60

Query: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120
           DRFKP+L++A+DLI  DESLFNNVKLLADYD ID NL+KIDKDSEELDSK+RKILEILNE
Sbjct: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180
           CHDELS LP LEQVEFEK TILQQRSKINSTALLDYATKLSKFT+IPPTFDKGTVGPNNF
Sbjct: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQN--EDI 238
           IWPAEDALRRGMLAMASLHSKELTR+PGE+EQETEEVPT  LSQP +++++ ++N  ++ 
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNS 240

Query: 239 SDKDTFIFKGTPHKDAEHTPGIKDKEEE 266
             KD+FIF G  +KD +     KDK EE
Sbjct: 241 PTKDSFIFNGIANKDTDQADNDKDKIEE 268

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  378 bits (971), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/266 (73%), Positives = 214/266 (80%), Gaps = 1/266 (0%)

Query: 1   MSVQNTKAVEFPMGHIKXXXXXXXXXXXXNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60
           MSVQ+TKAVEF MGHI+            N NSEDKLSKVQLYEDLCRYE  LSKLVESV
Sbjct: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60

Query: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120
           DRFKP+LD+A+DLI  DE+LF NVKLLA+YDNI RNLQKIDKDSEELDSK+RKILEILNE
Sbjct: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180
           CHDEL  LP LEQVEFEKNTILQQRSKINST LLDYATKLSKFTKIPPTFDKG VGPNNF
Sbjct: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISD 240
           IWPAEDALRRGMLAMASLHSKELTR+PGE+ +ETE     P SQ  +Q+ Q A+ E    
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPP-SQSEEQKGQMAKKEGTPK 239

Query: 241 KDTFIFKGTPHKDAEHTPGIKDKEEE 266
            D+FIF GT  +  +     KDKE+E
Sbjct: 240 TDSFIFDGTAKEVGDEADNTKDKEKE 265

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  271 bits (694), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 170/238 (71%), Gaps = 9/238 (3%)

Query: 13  MGHIKXXXXXXXXXXXXNM--NSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVA 70
           MGHI+            N   N ED +SKVQ+Y DLC YE  L+ LV SVD+FKPD++ A
Sbjct: 15  MGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAA 74

Query: 71  RDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPT 130
           R+LI  D  LF  +    +YD ID +L+K++ +S ELD+++++IL ILNECHDEL+ LP 
Sbjct: 75  RELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPM 134

Query: 131 LEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRR 190
           L+QVEFE  TILQQRSKINS+ LLDYATKLSKFTKIPPTFDKG++GPNNFIWPAEDALRR
Sbjct: 135 LKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRR 194

Query: 191 GMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKG 248
           GMLA+ASLH+ ELT+ PG  E E E +P    S+P  QEE        + +++F F G
Sbjct: 195 GMLALASLHADELTKAPGAHEGEEELIPKG--SEPIAQEEPVT-----TRRESFTFSG 245

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  260 bits (665), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 155/182 (85%)

Query: 32  NSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYD 91
           N++D+LSKVQ+Y DL +YE  L+ LVESVD FKPD+ +  +LI  D+SL+ ++   A+YD
Sbjct: 38  NNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYD 97

Query: 92  NIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINST 151
            ID  L ++DK+S ELD K++++LE L+EC++ L+GLP LEQVEFEK +IL+QRSK+NS+
Sbjct: 98  RIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSS 157

Query: 152 ALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDE 211
            LL+YATKLSKFTKIPPTFDKGT+GPNNF+WPAEDALRRGMLA+ASLHSKE+TR+PGE E
Sbjct: 158 VLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPE 217

Query: 212 QE 213
           +E
Sbjct: 218 EE 219

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  250 bits (638), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 171/255 (67%), Gaps = 16/255 (6%)

Query: 13  MGHIKXXXXXXXXXXXXNM------------NSEDKLSKVQLYEDLCRYEGVLSKLVESV 60
           MGH+K            N             N  + LSKVQ+Y D+  YE  L KLVESV
Sbjct: 6   MGHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESV 65

Query: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120
           D+FKPD+ +A  LI  DE LF ++    +YD I   L++ DK++ ELD+K+++IL  LNE
Sbjct: 66  DKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNE 125

Query: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180
           CH  L+ LP LEQVEFEK+ IL+QRSKINS  LLDYATKLSKFTKIPPTF+KG++GPNNF
Sbjct: 126 CHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNF 185

Query: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETE-EVPTAP--LSQPGQQEEQEAQNED 237
           IWPAEDALRRGMLAMASLHSKELT++P E E+ +E +  T P   ++P ++E+    NE 
Sbjct: 186 IWPAEDALRRGMLAMASLHSKELTKLPNEPEEASEPDKSTEPDKSTEPIEEEKITVDNEG 245

Query: 238 ISDKDTFIFKGTPHK 252
                + ++ G+ HK
Sbjct: 246 DISMGSIVYDGS-HK 259

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  248 bits (633), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 167/227 (73%), Gaps = 6/227 (2%)

Query: 33  SEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDN 92
           SE +L KVQLY DLC YE  L+KLV+SVD FKP L++ + LI AD+ L++ + LL  YD+
Sbjct: 13  SEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDS 72

Query: 93  IDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTA 152
           +   L+ +D +  ++D +++ IL ILNECHD+L+ LP LE+VEFEK  IL+QR KI S  
Sbjct: 73  VFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNV 132

Query: 153 LLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDEQ 212
           LL+YATKL+KFTKIPPTFDKGT+GPNNFIWPAEDALR+GMLAMASLH KELT++PG+++ 
Sbjct: 133 LLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQEDG 192

Query: 213 ETEEVPTA----PLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAE 255
           E E+  TA     + +  +  E E + +D  + D+F+F G    DAE
Sbjct: 193 E-EDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVF-GANANDAE 237

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 155/221 (70%), Gaps = 14/221 (6%)

Query: 37  LSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRN 96
           L KV++Y  +  YE  L+ LVESVD +KPD+ VA+ L+ AD+ LF ++    +YD I   
Sbjct: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99

Query: 97  LQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDY 156
           L ++   S  LD+K+R ILE LNECHDEL+ LP LEQV+FE +TIL+QR KINS+ LLDY
Sbjct: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159

Query: 157 ATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDEQETE- 215
           ATKLSKFT+IPPTFDKG++GPNNFIWPAEDALR+GMLA+A+LHS+ELTR+PG+D+ E + 
Sbjct: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKK 219

Query: 216 ---EVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKD 253
              E P  P   P  +E           + +F+F  T   D
Sbjct: 220 KQTEKPDVPEPAPVTEER----------RSSFVFGDTSTAD 250

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  238 bits (608), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 117/221 (52%), Positives = 168/221 (76%), Gaps = 2/221 (0%)

Query: 30  NMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLAD 89
           N +S+D LS+V++Y+D+  YE  LS+L++SVD+FKP+L++A++LI AD+SLF+ +     
Sbjct: 69  NDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQ 128

Query: 90  YDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKIN 149
           YD ID +L+ ++  + ++D  ++  L+ LNECHD+L+ LPTL Q+EFE NTIL QR+KIN
Sbjct: 129 YDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKIN 188

Query: 150 STALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE 209
           ST LLDYATKLSKFTKIPPTFDKG++GPNNFIWPAED+LRRGMLAMASL + +LT +PG+
Sbjct: 189 STILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQ 248

Query: 210 DEQETEE--VPTAPLSQPGQQEEQEAQNEDISDKDTFIFKG 248
            +  ++E  +PT       Q + Q+   E+   +++F+F G
Sbjct: 249 AQSMSKEKALPTEVQETQEQTQTQQQDQEEQPRRESFVFSG 289

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  236 bits (601), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 138/176 (78%)

Query: 34  EDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNI 93
           +D LS+V++Y D+C YE  L KLV SVD+FKPDL VA++LI  D+ LF  ++    YD I
Sbjct: 41  QDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKI 100

Query: 94  DRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTAL 153
           D  L  ++K S+E+D K+ KILE+LN CH +L+ LP LEQV  E++T+L+QR KI S  L
Sbjct: 101 DGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVL 160

Query: 154 LDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE 209
           LDYA KL+KFT++PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTR+PG+
Sbjct: 161 LDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  229 bits (583), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 164/231 (70%), Gaps = 8/231 (3%)

Query: 34  EDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNI 93
           ++KL  V +YEDLC+YE  L +LV SVD+F+PDL+ A++LI  D  L++N+  L  YD I
Sbjct: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103

Query: 94  DRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTAL 153
           D  L+K++++S+++D ++ KIL IL EC+++L+ LP +EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163

Query: 154 LDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDEQE 213
           L+YA KLSKFT++PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL SKELT +PG+ +QE
Sbjct: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQE 223

Query: 214 TEEVPT---APLSQPGQQEEQEAQNEDISDKDTFIFKGT----PHKDAEHT 257
            E+      A  + PG    + A N   + + +F F G     P  DA+ +
Sbjct: 224 AEQASAGKEADTAGPGVSTLEPA-NGGHNRRGSFEFTGIRKPPPASDADSS 273

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  229 bits (583), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 110/190 (57%), Positives = 145/190 (76%), Gaps = 2/190 (1%)

Query: 30  NMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLAD 89
           N +  D+LSK+Q Y DL +YE  LSKL  SVD++KPDL  A DLI  D  L++ +     
Sbjct: 30  NNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVK 89

Query: 90  YDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKIN 149
           YD I   L+K++ D++ LD K++ +L+ LN+CH+ L+ LP LEQVEFEKNT+L+QR KIN
Sbjct: 90  YDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKIN 149

Query: 150 STALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE 209
           S  LLDYATKL+KFTKIPPTF+K T+GPNNFIWPAEDALRRGMLA+AS H++ELT +PG 
Sbjct: 150 SKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGS 209

Query: 210 --DEQETEEV 217
             DE+ ++++
Sbjct: 210 VGDEENSKDI 219

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  226 bits (577), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 163/236 (69%), Gaps = 11/236 (4%)

Query: 37  LSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRN 96
           ++KV +Y DL +YE  LS+L++S+D +KPD  +A++LI  D  LFN++     YD I   
Sbjct: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100

Query: 97  LQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDY 156
           L+  +K  +E   K+++ILE LNECH+ L+ LPT++QV FE NT+L+QR KINS+ LLDY
Sbjct: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160

Query: 157 ATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG-------E 209
           ATKLSKFTKIPPTFDKG++GPNNF+WPAEDALRRGMLA+A+ H+ ELT++ G       +
Sbjct: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDD 220

Query: 210 DEQETEEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAEHTPGIKDKEE 265
           +    +E+ +    +    E++++     S + ++IF G   K+AEH    ++KEE
Sbjct: 221 NSIALDEIKSVDAGEGPIPEKKDSS----SRRGSYIFAGQSGKNAEHKNNEENKEE 272

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  217 bits (553), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 108/227 (47%), Positives = 156/227 (68%), Gaps = 7/227 (3%)

Query: 34  EDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNI 93
           E+ LSK+Q+Y D+C +E  L KLV SVDRF PDL++AR LI AD+ L+ +++ L  YD I
Sbjct: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78

Query: 94  DRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTAL 153
           D   + +D++  + D K+ +ILE L EC  +L+ LP LEQVEFE+ T+L+QR K+ +  L
Sbjct: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138

Query: 154 LDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDEQE 213
           LDYA KL+KFT +PPTFDKGTVGPNNF+WPAEDA+RRGMLA+ASL + E      +++Q 
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGAN--AQEQQA 196

Query: 214 TEEVPTAPLSQPGQQEEQEAQNED-----ISDKDTFIFKGTPHKDAE 255
           + E  T+  S   ++ + + ++ D     ++ + +F F G+  KD E
Sbjct: 197 SSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDGSGAKDHE 243

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  215 bits (548), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 145/225 (64%), Gaps = 6/225 (2%)

Query: 32  NSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYD 91
           N+E +LSK Q+Y D+C +E  L KLV SVD+F PDL +A  LI  D+ L   ++ L  YD
Sbjct: 17  NAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYD 76

Query: 92  NIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINST 151
            ID   +++D+   E D +  +ILE L EC  +L+ LP LEQVEFE+ T+L+QR K+ + 
Sbjct: 77  EIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTN 136

Query: 152 ALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDE 211
            LLDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+ASL + E  + P    
Sbjct: 137 VLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETGA 196

Query: 212 QET-EEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAE 255
            +T EE    P S P  + E+  Q      +D+F F GT  K  E
Sbjct: 197 AQTAEETTKQPQSSPQLKVEEPMQR-----RDSFEFNGTGTKSPE 236

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  215 bits (547), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 111/232 (47%), Positives = 159/232 (68%), Gaps = 6/232 (2%)

Query: 30  NMNSE--DKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLL 87
           NMN+   D L+ V +Y D+  YE  L KLV S+D F+PD++VA+ LI  D+ L+ N+   
Sbjct: 48  NMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSF 107

Query: 88  ADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSK 147
            +YD ID  + KI  DSE+LD +++ IL+ILN+  + L+ LP LE++ FE++ + +++ K
Sbjct: 108 KEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKK 167

Query: 148 INSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVP 207
           INS  LLDYATK+SKFTKIPPTF+KG++GPNNFIWPAEDALRRGMLA+AS+H  ELT++P
Sbjct: 168 INSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLP 227

Query: 208 GEDEQET--EEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAEHT 257
            +   ++  E        Q G +  +EA  E    +++F+F G  HK+ E T
Sbjct: 228 NDTSYDSDKELEEQQEQEQHGTENTREADVEQ-EQEESFVFDG-KHKNEEKT 277

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  199 bits (506), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 149/197 (75%), Gaps = 6/197 (3%)

Query: 37  LSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRN 96
           + +V LY+DLC++E  L KLV SVD+F PDL  A+DLI++D  L++ ++ L  YD+ID  
Sbjct: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81

Query: 97  LQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDY 156
           L+++D +S+E+D ++ KIL IL++C++ L+ LP +EQVEFE   + +Q+ KI S  LL+Y
Sbjct: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEY 141

Query: 157 ATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE-DEQETE 215
           A KL+KFT++PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL S+ELTR+P E + +E +
Sbjct: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201

Query: 216 EVPTAPLSQPGQQEEQE 232
           E P     Q GQ +E++
Sbjct: 202 EPP-----QKGQSQEED 213

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  197 bits (500), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 90/164 (54%), Positives = 122/164 (74%), Gaps = 3/164 (1%)

Query: 41  QLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKI 100
           Q+Y DL RYE  L +LVESVD+F+PDL  AR+L+ AD +L  ++     YD +D+ LQ++
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 101 DKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKL 160
           D++SE L+  + + LE L+EC+  LS LP LEQV+FE+  +L+QR ++NS  LL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 161 SKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELT 204
           SKFTK P       VGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  192 bits (488), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 125/169 (73%)

Query: 35  DKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNID 94
           ++L  V +Y+DL RYE  + +L +SVD FKPDL +   +I  D+ L+  ++   +Y  I+
Sbjct: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIE 89

Query: 95  RNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALL 154
             L ++DK+ + +D+K+R+ILE LN C++ L+ LP LEQVEFE+  +L+QR KI+S  +L
Sbjct: 90  EELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149

Query: 155 DYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKEL 203
           DYA KL+KFT+ PPTFDK  +GPNNFIWPAED+LR+GMLAMASL  KEL
Sbjct: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.467
           YMR094W
          Length = 493

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 16/142 (11%)

Query: 81  FNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNT 140
           F NVK   D  ++  N+ K  K + +L    +++L  L   +      P LE  E++   
Sbjct: 25  FTNVK--PDDPDLLSNVFKAMKSTGDLSLDKKRLLRKLYPRYK-----PYLEMFEYDPEL 77

Query: 141 ILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDAL------RRGMLA 194
           I+   + +  ++ L Y   +    ++  + D G +GP ++I+  ED L      R G L 
Sbjct: 78  IV---TWLQYSSWLRYDAVILDCLRLNHSLDAGIMGPFDWIYMGEDTLKIGYFQRTGFLL 134

Query: 195 MASLHSKELTRVPGEDEQETEE 216
                  E TR   E E+   E
Sbjct: 135 QVWYSKLEYTRWIVESEKTVGE 156

>KLLA0F23309g Chr6 complement(2175773..2176759) [987 bp, 328 aa]
           {ON} similar to uniprot|Q12182 Saccharomyces cerevisiae
           YOR342C Hypothetical ORF
          Length = 328

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 47/115 (40%), Gaps = 21/115 (18%)

Query: 141 ILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMA-SLH 199
           +L+Q   IN      Y   L       PT +   +  +N  W +      G++A    + 
Sbjct: 182 MLKQNPSINVVDAFSYVKNLR------PTVNN--MKEDNIYWCS------GLVAYHERVK 227

Query: 200 SKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDA 254
           SKELT  PG     + E+      +  Q EE EA++ DIS      F   P+ DA
Sbjct: 228 SKELTWRPGSTNGSSTEITNFATKRREQFEEDEAEDGDIS------FGNKPYSDA 276

>KLLA0C04994g Chr3 (453438..455264) [1827 bp, 608 aa] {ON} weakly
           similar to uniprot|Q04433 Saccharomyces cerevisiae
           YDR534c Mannoprotein that is incorporated into the cell
           wall via a glycosylphosphatidylinositol (GPI) anchor,
           involved in the retention of siderophore-iron in the
           cell wall
          Length = 608

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 149 NSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208
           NST   +Y TK    +K    F K    P  F+W  E     G+   AS  ++E +    
Sbjct: 169 NST--TEYETKTLTLSKNGHWFTKTVTQPVGFVWTGEATTYTGVAPWASSSAEEASTTLD 226

Query: 209 EDEQETEEVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAEHT 257
            DE ET    T  LS+ G         + ++    F++ G P + A  T
Sbjct: 227 ADELET---VTLTLSKNGHW-----FTKTVTQTKGFVWTGEPSRSAATT 267

>KLLA0D11132g Chr4 (950190..950579) [390 bp, 129 aa] {ON} highly
           similar to uniprot|P53900 Saccharomyces cerevisiae
           YNL153C GIM3 Subunit of the heterohexameric cochaperone
           prefoldin complex which binds specifically to cytosolic
           chaperonin and transfers target proteins to it,
          Length = 129

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 25/34 (73%)

Query: 85  KLLADYDNIDRNLQKIDKDSEELDSKSRKILEIL 118
           KL +D +NID N++K++ D  ELDS+ +++  IL
Sbjct: 84  KLESDAENIDSNIEKLESDEAELDSRIKELKSIL 117

>Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {ON}
           YMR031C (REAL)
          Length = 840

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 13/78 (16%)

Query: 93  IDRNLQKIDKDSEELDSKSRKILE-ILNECHDELSGLPTLEQVEFEKNTILQQRSKINS- 150
           +D++L++  KD E+  S +RK  E +L   H++L      E  E E  T+L++R  IN+ 
Sbjct: 521 LDQDLEEWGKDCEQDISNARKEQEELLKPYHEDL------ENAEKEHTTLLEERDAINTE 574

Query: 151 -----TALLDYATKLSKF 163
                 A++D+ TK+S +
Sbjct: 575 ISRLQGAIVDHKTKISNY 592

>TDEL0B00330 Chr2 (61668..63053) [1386 bp, 461 aa] {ON} Anc_8.864
           YML126C
          Length = 461

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 14/123 (11%)

Query: 75  SADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHD---ELSGLPTL 131
           +A   L    KLL +Y     ++ +++  +E L  KS+ I  +L +  D   +L G+ TL
Sbjct: 67  TASMCLTACSKLLKNYSIDPHHIGRLEVGTESLIDKSKSIKSVLTQLFDGNSDLEGVDTL 126

Query: 132 EQVEFEKNTILQQRSKINSTAL-----LDYATKLSKFTKIP--PTFDKGTVGPNNFIWPA 184
                  N +    + I S+A      +     ++ + K P  PT   GTV     +W  
Sbjct: 127 NACYGGTNALFNSLNWIESSAWDGRDAIVVCGDIAIYDKGPARPTGGAGTVA----LWIG 182

Query: 185 EDA 187
            DA
Sbjct: 183 PDA 185

>TPHA0H00840 Chr8 (170246..172693) [2448 bp, 815 aa] {ON} Anc_2.56
           YDL220C
          Length = 815

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 108 DSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKL 160
           ++K  ++  IL  C DE      L   +F KNT++QQ+  I+   L+DY  K+
Sbjct: 409 ETKYFQLYCILLACSDESHSFLKLTVTDFTKNTMIQQKYLIDK-FLIDYNNKI 460

>TBLA0F03840 Chr6 complement(950528..954298) [3771 bp, 1256 aa] {ON}
           Anc_8.235 YDR097C
          Length = 1256

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 11/97 (11%)

Query: 39  KVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQ 98
           K++L+E + +   V+ +L+E +  F+    +   L    ESLFN+VK   ++ N     +
Sbjct: 732 KMKLFEKVIQGFEVIVELIEQLKSFELKGALKTFLSQVPESLFNDVK---NWSNAFDRRK 788

Query: 99  KIDKDSEEL--------DSKSRKILEILNECHDELSG 127
            +++D  EL        D     IL I NE +D LSG
Sbjct: 789 ALEEDIIELHLGVEPEFDQSRECILSIENELNDILSG 825

>NDAI0J02550 Chr10 (629573..631012) [1440 bp, 479 aa] {ON} Anc_4.300
           YLR423C
          Length = 479

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 53  LSKLVESVDRFKPDLDVARD----LISADESLFNNVKLLAD----YDNIDRNLQKIDKDS 104
           + KL+E V +++  L + +D    L +  E   ++++++ D    Y N +++ Q + K+ 
Sbjct: 352 VKKLIEEVLKYQEYLMIFKDISDLLTTFKEGCMDDIRVVEDLCEFYTNFEKSYQNLLKEV 411

Query: 105 EELDSKSRKILEILNECHDELSGLPTLEQ 133
           E       K+  ILNEC ++L  L + +Q
Sbjct: 412 ERRKQVRNKMEIILNECDNKLQKLNSRDQ 440

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 20/133 (15%)

Query: 76   ADESLFNNVKLLADYDNIDRNLQKIDKDSEEL-----DSKSRKILEILNECHDELSGLPT 130
            A++++     L    D + + +++I   SE++     D  S ++LE L   +DE++GL  
Sbjct: 931  AEKTMIKKTTLSTRRDELQQKIREIGLLSEDVLHDFNDLSSEELLEKLKSVNDEIAGLNN 990

Query: 131  LEQVEF-------EKNTILQQRSK---INSTALLDYATKL--SKFTKIPPTFDKGTVGPN 178
            + +  F       EK+T L++R+     + T++ +  T+L   K T +  TF+K +    
Sbjct: 991  VNKRAFENFKKFDEKHTELEKRASELDESKTSIKELITRLKQQKVTAVDSTFEKVS---K 1047

Query: 179  NFIWPAEDALRRG 191
            NF+   E  + RG
Sbjct: 1048 NFVTVFESLVPRG 1060

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 62  RFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILN 119
           R + ++D AR L +    + NN++  ADY+N+  +L+      + + +   K  E LN
Sbjct: 43  RSELEMDYARRLGALSARIMNNLERYADYNNMSESLKYFQSSQQTIANGHSKAYERLN 100

>KNAG0H01190 Chr8 complement(201945..202601) [657 bp, 218 aa] {ON}
           Anc_3.278 YDR041W
          Length = 218

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 79  SLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILN 119
           ++F    L AD+D++D  L + D D+ E D  +RKI+E+LN
Sbjct: 174 NVFKREPLKADFDSVD--LPQHDTDAVENDLVNRKIMELLN 212

>KAFR0I02490 Chr9 complement(504333..505421) [1089 bp, 362 aa] {ON}
           Anc_5.32 YMR294W
          Length = 362

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 45  DLCRYEGVLSK-LVESVDRFKPDLDVARDLISADESLFN-----NVKLLADYDNIDRNLQ 98
           D  RY G L+  +VES+DR +      +DL        N     N KL+A   NID NL+
Sbjct: 284 DRVRYIGDLNNNVVESLDRIRCIDSTIKDLQVQSNKWENTLKTMNEKLIAQEKNIDGNLK 343

Query: 99  KIDKDSEELDSKSRKIL 115
            I    +EL+ K  K+L
Sbjct: 344 GIYSKIDELNMKLDKVL 360

>TBLA0D01940 Chr4 complement(480209..483445) [3237 bp, 1078 aa] {ON}
           
          Length = 1078

 Score = 29.6 bits (65), Expect = 9.8,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 99  KIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYAT 158
           KID +S   D  S K ++I +  +D   GLP       E N  +  R   N+   +DY  
Sbjct: 911 KIDHESNYGDITSIKKVQITSNAYDPKMGLPIASYESIEGNRKI--RVLYNNGDYMDYKL 968

Query: 159 K---LSKFTKIPPTFDKGTVGPNNF 180
           +   L+K+    P+  K   GP  F
Sbjct: 969 ENNHLNKYQPQNPSLYKRERGPEGF 993

>TDEL0H01040 Chr8 complement(179980..181044) [1065 bp, 354 aa] {ON}
           Anc_1.222 YJL131C
          Length = 354

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 73  LISADESLFNNVKLLADYDNIDR-NLQKI-DKDSEELDSKSRKILEILNECHDELSGLPT 130
           L  AD++  N+  L AD+DN+ + N +K+ +KD ++  S    + E L E  +E S  P 
Sbjct: 243 LYIADKAHINSKNLAADFDNVQKPNTKKLSNKDLQQRSS----VYEKLQEIFEEYSAQPV 298

Query: 131 LE 132
           +E
Sbjct: 299 IE 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,527,158
Number of extensions: 1325256
Number of successful extensions: 8093
Number of sequences better than 10.0: 210
Number of HSP's gapped: 8341
Number of HSP's successfully gapped: 213
Length of query: 286
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 178
Effective length of database: 41,097,471
Effective search space: 7315349838
Effective search space used: 7315349838
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)