Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3035.476ON74872632020.0
YOR140W (SFL1)5.476ON76673226800.0
Smik_15.3195.476ON76273026010.0
Suva_8.1915.476ON75873025840.0
NCAS0H022805.476ON6573674511e-46
NDAI0C013805.476ON7671444212e-42
ZYRO0D11286g5.476ON7171474167e-42
TDEL0A034005.476ON8101474116e-41
KNAG0B040405.476ON8521493949e-39
Kwal_55.212545.476ON8531453725e-36
KLTH0F14982g5.476ON8281443629e-35
CAGL0I07183g5.476ON7711443502e-33
Ecym_23125.476ON7561413492e-33
KLLA0E03191g5.476ON7701463493e-33
AFR136C5.476ON6951443421e-32
SAKL0G03586g5.476ON8532823405e-32
Kpol_1062.85.77ON4331451964e-15
TPHA0A052505.77ON6011531888e-14
KAFR0C022506.209ON613831833e-13
KLLA0A05368g5.77ON412821795e-13
YGL073W (HSF1)6.209ON833781825e-13
Smik_7.2096.209ON837781807e-13
TDEL0E051706.209ON546781798e-13
Skud_7.2086.209ON836781808e-13
KNAG0F020206.209ON771781808e-13
TPHA0H011305.77ON4391381761e-12
ZYRO0G08734g6.209ON572791771e-12
Suva_7.1976.209ON846781781e-12
SAKL0H02354g5.77ON385871751e-12
Kpol_1033.466.209ON717641762e-12
TBLA0A020006.209ON627981743e-12
NCAS0E038705.77ON393701723e-12
NDAI0D034304.385ON597801744e-12
Kwal_56.240366.209ON567781734e-12
SAKL0A04576g6.209ON557831734e-12
KAFR0B044105.77ON465711725e-12
TBLA0G02700singletonON445961715e-12
KLLA0D03322g6.209ON6771061735e-12
KLTH0H04290g6.209ON569781726e-12
KNAG0K004705.77ON4141401707e-12
Suva_7.5445.77ON469861707e-12
YHR206W (SKN7)4.385ON622741719e-12
NCAS0A064504.385ON609711709e-12
Skud_7.5825.77ON452681691e-11
CAGL0F08195g5.77ON325811661e-11
Skud_8.2734.385ON623731691e-11
Ecym_22086.209ON529781681e-11
Smik_8.2964.385ON625731691e-11
NCAS0D037806.209ON760781692e-11
KNAG0M001804.385ON615711672e-11
AFL085C6.209ON569781672e-11
NDAI0B009405.77ON526671663e-11
KAFR0B069904.385ON545641653e-11
TDEL0G010105.77ON398671643e-11
NDAI0I011106.209ON905781656e-11
CAGL0H03443g6.209ON706781646e-11
Smik_16.585.77ON453681627e-11
ZYRO0C11506g5.77ON334681608e-11
KLTH0D17182g4.385ON464641618e-11
Suva_15.4124.385ON617641621e-10
Kwal_47.167704.385ON461641601e-10
YGR249W (MGA1)5.77ON456721591e-10
CAGL0F09097g4.385ON630641602e-10
Kpol_265.24.385ON549691592e-10
TPHA0C001504.385ON5101421582e-10
SAKL0B12408g4.385ON465641582e-10
TDEL0D003204.385ON547641583e-10
TBLA0A107004.385ON5871421583e-10
ADL388W4.385ON482731555e-10
TPHA0E028806.209ON718641565e-10
ZYRO0G00484g4.385ON647641556e-10
Ecym_55735.77ON5721401557e-10
KLLA0A10219g4.385ON475761521e-09
Ecym_74744.385ON496731512e-09
AEL216C5.77ON4501421493e-09
KLTH0H00814g5.77ON3901411483e-09
TBLA0E049804.385ON791651494e-09
Kpol_1050.795.77ON4331451378e-08
Skud_10.3734.385ON346751206e-06
Suva_12.2414.385ON349701091e-04
YJR147W (HMS2)4.385ON358701037e-04
Smik_10.4424.385ON34763930.012
TPHA0L019802.639ON55637771.4
SAKL0C00462g1.5ON117755771.6
AGR381C2.315ON33589751.7
NDAI0G021408.408ON55356716.5
NCAS0E00690singletonON24755697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.303
         (748 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...  1238   0.0  
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...  1036   0.0  
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...  1006   0.0  
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   999   0.0  
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    178   1e-46
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   166   2e-42
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   164   7e-42
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   162   6e-41
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   156   9e-39
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   147   5e-36
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   144   9e-35
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   139   2e-33
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   139   2e-33
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   139   3e-33
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   136   1e-32
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   135   5e-32
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    80   4e-15
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    77   8e-14
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    75   3e-13
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    74   5e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    75   5e-13
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    74   7e-13
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    74   8e-13
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    74   8e-13
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    74   8e-13
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    72   1e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    73   1e-12
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    73   1e-12
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    72   1e-12
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    72   2e-12
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    72   3e-12
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      71   3e-12
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     72   4e-12
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    71   4e-12
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    71   4e-12
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    71   5e-12
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               70   5e-12
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    71   5e-12
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    71   6e-12
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    70   7e-12
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    70   7e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    70   9e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   9e-12
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    70   1e-11
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    69   1e-11
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    70   1e-11
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    69   1e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    70   1e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     70   2e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    69   2e-11
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    69   2e-11
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    69   3e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    68   3e-11
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    68   3e-11
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    68   6e-11
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    68   6e-11
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    67   7e-11
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    66   8e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    67   8e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    66   1e-10
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    66   1e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    66   2e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    66   2e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    65   2e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   2e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    65   3e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    65   3e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    64   5e-10
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    65   5e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    64   6e-10
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    64   7e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    63   1e-09
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    63   2e-09
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    62   3e-09
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    62   3e-09
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    62   4e-09
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    57   8e-08
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    51   6e-06
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    47   1e-04
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    44   7e-04
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    40   0.012
TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2....    34   1.4  
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...    34   1.6  
AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}...    33   1.7  
NDAI0G02140 Chr7 (484059..485720) [1662 bp, 553 aa] {ON} Anc_8.4...    32   6.5  
NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON}      31   7.5  

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/726 (85%), Positives = 618/726 (85%)

Query: 23  DASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS 82
           DASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS
Sbjct: 23  DASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS 82

Query: 83  KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXX 142
           KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDV             
Sbjct: 83  KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNS 142

Query: 143 XXXXXXXATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXX 202
                  ATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIK               
Sbjct: 143 SGEENNGATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRK 202

Query: 203 XXXXXXYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATH 262
                 YDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATH
Sbjct: 203 NSSNQNYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATH 262

Query: 263 GPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKN 322
           GPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKN
Sbjct: 263 GPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKN 322

Query: 323 VSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHXXXXXXXXXXXXXXXXX 382
           VSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLH                 
Sbjct: 323 VSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHAATATATAPALASSSAC 382

Query: 383 XPKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVXXXXXXXXXXXXXXXXXXXHMAYS 442
            PKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSV                   HMAYS
Sbjct: 383 APKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQFFVQYQPQPQLQPQQHMAYS 442

Query: 443 KQPAHMPNFINXXXXXXXXXXXYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPLT 502
           KQPAHMPNFIN           YADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPLT
Sbjct: 443 KQPAHMPNFINQPIPIQQLPPQYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPLT 502

Query: 503 PATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRSLGST 562
           PATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRSLGST
Sbjct: 503 PATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRSLGST 562

Query: 563 SSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNXXXXXXXXXXXXXXXXXXXNNPAPIRYSQ 622
           SSLPNDRRNSPLKLTPRSSLNEDSLYSKPKN                   NNPAPIRYSQ
Sbjct: 563 SSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNSLKSSISGTSLSSSFTLVSNNPAPIRYSQ 622

Query: 623 QGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTSLSHP 682
           QGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTSLSHP
Sbjct: 623 QGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTSLSHP 682

Query: 683 EPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEETAPP 742
           EPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEETAPP
Sbjct: 683 EPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEETAPP 742

Query: 743 SKKVRM 748
           SKKVRM
Sbjct: 743 SKKVRM 748

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/732 (71%), Positives = 565/732 (77%), Gaps = 12/732 (1%)

Query: 23  DASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS 82
           D +EDVKKHGSKMLVGPRPPQNAIFIHKLYQILED+SLHDLIWW+ SGLSFMIKPVERFS
Sbjct: 41  DGAEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFS 100

Query: 83  KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXX 142
           KALATYFKHTNITSFVRQLNIYGFHKVSHDH+SN+ NSGDDANTND              
Sbjct: 101 KALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNS 160

Query: 143 XXXXXXXATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXX 202
                    VQEKEK  SNPTKIWEFKHSSGIFKKGDIEGLKHIK               
Sbjct: 161 SGDENTGGGVQEKEK--SNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRK 218

Query: 203 XXXXXXYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATH 262
                 YD DSG R RPSSIQDP+ +SN F N+VPQI GANN IPE FNNSHV YENA H
Sbjct: 219 NSSNQNYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANH 278

Query: 263 GPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKN 322
            P+E NNPE QEQ RP +FQDETL HLKEIN DM+KIIESMQHFISLQH+FCS+SFTFKN
Sbjct: 279 APLESNNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKN 338

Query: 323 VSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSL------HXXXXXXXXXXX 376
           VSKKKSENI+KDHQKQL+ FE+DMLTFKQHVMSRAHRT+DSL                  
Sbjct: 339 VSKKKSENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNAAATAASVAPAPAP 398

Query: 377 XXXXXXXPKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVXXXXXXXXXXXXXXXXXX 436
                  PKSQY+MMVPPGNQYVPQKSSS+TNIPSRFNT+SV                  
Sbjct: 399 TSTSAYAPKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQ--- 455

Query: 437 XHMAYSKQPAHMPNFINXXXXXXXXXXXYADTFNTPQMMHNPFASKNGHKPGNTKRTNSV 496
            H+ Y+KQPAH+PNFIN           YADTF+TPQMMHNPFASKN +KPGNTKRTNSV
Sbjct: 456 -HVTYAKQPAHVPNFINQPIPIQQLPPQYADTFSTPQMMHNPFASKNNNKPGNTKRTNSV 514

Query: 497 LMDPLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKM 556
           LMDPLTPA SVG+QG LNYPIMNINP+VRDYNK VPQNMAPSPIYPINEPTTR+YSQPKM
Sbjct: 515 LMDPLTPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKM 574

Query: 557 RSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNXXXXXXXXXXXXXXXXXXXNNPA 616
           RSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLY KP+N                   NNPA
Sbjct: 575 RSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSLSSSFTLVANNPA 634

Query: 617 PIRYSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHG 676
           PIRYSQQGLLRSLNKAANC PDSV PLDS+VLTGP PKNMDNLPA+SSNLINSPMNVEH 
Sbjct: 635 PIRYSQQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHS 694

Query: 677 TSLSHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAK 736
           +SLS  EP P IELPQPSLPTT+ TK   E DN+KR GSGVYSLLNQE+S +S+ADP+ +
Sbjct: 695 SSLSQAEPAPQIELPQPSLPTTSTTKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTE 754

Query: 737 EETAPPSKKVRM 748
           ++ AP  KKV+M
Sbjct: 755 DKAAPALKKVKM 766

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/730 (68%), Positives = 558/730 (76%), Gaps = 12/730 (1%)

Query: 23  DASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS 82
           D SEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWS SGLSFMIKPVERFS
Sbjct: 41  DVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS 100

Query: 83  KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXX 142
           KALATYFKHTNITSFVRQLNIYGFHKVSHDH+SN+ N GD+ANTND              
Sbjct: 101 KALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTND--------DSSGNK 152

Query: 143 XXXXXXXATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXX 202
                    V  +EKE+SNPTKIWEFKHSSGIFKKGDIEGLKHIK               
Sbjct: 153 NTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNSSSINSRK 212

Query: 203 XXXXXXYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATH 262
                 YD DSGVRARPSS+QDP+ +S+ F N+VPQI  ANN IPECFNNSHV YEN +H
Sbjct: 213 NSSNQNYDTDSGVRARPSSVQDPSTSSSAFGNFVPQIPSANNTIPECFNNSHVTYENLSH 272

Query: 263 GPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKN 322
           G +E+NNP+ QEQ++P SFQDE L HLK+INVDM+KIIESMQHFISLQH+FCS+SFTFKN
Sbjct: 273 GALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKN 332

Query: 323 VSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHXXXXXXXXXXXXXXXXX 382
           VSKKKSENI+K+HQKQLK FENDMLTFKQHVMSRAHRT+DSL+                 
Sbjct: 333 VSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYAINSNAIATAPAPAPAS 392

Query: 383 ----XPKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVXXXXXXXXXXXXXXXXXXXH 438
                PKSQYD+MVPPGNQYVPQKSSSSTNIPSRFNTSSV                   +
Sbjct: 393 ISAYAPKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVQYQSQPQAQPQQY 452

Query: 439 MAYSKQPAHMPNFINXXXXXXXXXXXYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLM 498
           M Y+KQP HMPNF++           YADTF+TPQMMHNPFASKN +KPGNT+RTNSVLM
Sbjct: 453 MTYAKQPTHMPNFVHQPIPIQQLPPQYADTFSTPQMMHNPFASKNTNKPGNTRRTNSVLM 512

Query: 499 DPLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRS 558
           DPLTPA SVG+Q  LNYPIMNINP  RDYNKSVPQNMAPSPIYPINEPTTR+YSQPKMRS
Sbjct: 513 DPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRLYSQPKMRS 572

Query: 559 LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNXXXXXXXXXXXXXXXXXXXNNPAPI 618
           LGSTSSLPNDR+NSPLKLTPR SLNEDSLY KP+N                   NNPAPI
Sbjct: 573 LGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNSLKSSTSGTSLSSSLTLVANNPAPI 632

Query: 619 RYSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTS 678
           RYSQQGLLRSL+KAANC PD   PLDS+VLTGP PKNMDNLPA+SSNLINSPMNV+HG+S
Sbjct: 633 RYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSPMNVDHGSS 692

Query: 679 LSHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEE 738
           +SH E    IE+PQPS   T A K+ DE DN+KR+GS VYSLLN+E++ +S+ D + +E+
Sbjct: 693 ISHAESISSIEVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASSTDFKTEEK 752

Query: 739 TAPPSKKVRM 748
             P  KKV+M
Sbjct: 753 ATPVLKKVKM 762

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/730 (69%), Positives = 552/730 (75%), Gaps = 18/730 (2%)

Query: 26  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKAL 85
           EDVKKHGSK LVGPRPPQNAIFIHKLYQILEDDSLHDLIWWS SGLSFMIKPVERFSKAL
Sbjct: 40  EDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKAL 99

Query: 86  ATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXX 145
           ATYFKHTNITSFVRQLNIYGFHKVSHDH SN+ NSGDD NTND                 
Sbjct: 100 ATYFKHTNITSFVRQLNIYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGD 159

Query: 146 XXXXATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXX 205
               A  QEKEK  SNPTKIWEFKHSSGIFKKGDIE LKHIK                  
Sbjct: 160 ETTGAGAQEKEK--SNPTKIWEFKHSSGIFKKGDIESLKHIKRRASSRNNSSINSRKNSS 217

Query: 206 XXXYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYENATHGPM 265
              YD +S +RARP+SIQDP + S+ F NYVPQISGA++ IPECF  SHVPYENA HGP+
Sbjct: 218 NQNYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYENANHGPL 275

Query: 266 EFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSK 325
           EFNNP+TQE ++P SFQDETLTHLK+IN DMIKIIESMQHFISLQHNFCS+SFTFKNVSK
Sbjct: 276 EFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSK 335

Query: 326 KKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHXXXXXXXXXXXXXXXXXXPK 385
           KKSENI+KDHQ QLK FE+DMLTFKQHVMSRAHRT+D+LH                   K
Sbjct: 336 KKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTLVPAH---K 392

Query: 386 SQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSV-------XXXXXXXXXXXXXXXXXXXH 438
           SQY++MVPP NQ+ PQKSS S +IPSRFNTSSV                          H
Sbjct: 393 SQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYQPQPQPQQQQQQQQQQQH 452

Query: 439 MAYSKQPAHMPNFINXXXXXXXXXXXYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLM 498
           MAY KQP HM NFIN           YA+TFNTPQMMHNPFASKN HKPGNTKRTNSVLM
Sbjct: 453 MAYPKQPPHMQNFINQPIPIQQLPPQYAETFNTPQMMHNPFASKNSHKPGNTKRTNSVLM 512

Query: 499 DPLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYSQPKMRS 558
           DPLTPA     QG LNYPIMN+NP+ RDYNK VPQN APSPIYP+NEPTTR+YSQPKMR+
Sbjct: 513 DPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRLYSQPKMRT 568

Query: 559 LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNXXXXXXXXXXXXXXXXXXXNNPAPI 618
           LGSTSSLPNDRRNSPLKLTPRSSLNEDSLY KP+N                   NNPAPI
Sbjct: 569 LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSISSSFTLVSNNPAPI 628

Query: 619 RYSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMNVEHGTS 678
           RYSQQGLLRSLNKAANC PDS  PLD ++L GPTPKN+DNLP +SSNLINSPMNVEHGTS
Sbjct: 629 RYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSPMNVEHGTS 688

Query: 679 LSHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNADPRAKEE 738
           LSHP+PTP +ELPQPSLPTTN TK  DETD  +R+GSGVYSLLN+++S S+NA+ +AK E
Sbjct: 689 LSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLNKDDSSSANANSKAKGE 748

Query: 739 TAPPSKKVRM 748
           T P SKK R+
Sbjct: 749 TTPASKKARL 758

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  178 bits (451), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 175/367 (47%), Gaps = 84/367 (22%)

Query: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103
           N IFIHKLY ILED  L DLIWWSSSG SF IKP E+FSKALATYFKHTNITSFVRQLNI
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHKVS+DH    IN  ++ N+ND                        +E+E   +   
Sbjct: 107 YGFHKVSNDH--QYINYPNNNNSNDNDSKG-------------------KEREDLTNETI 145

Query: 164 KIWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXXXYDA------------ 211
           KIWEFKHS+GIFKKGD+EGLK IK                      ++            
Sbjct: 146 KIWEFKHSAGIFKKGDVEGLKLIKRRSSSRNISAMNQKKNLVSMQLNSSINNNVMPANTF 205

Query: 212 -----DSGVRA---RPSS-----IQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYE 258
                D   RA   RP++     IQ     + G   Y  ++       P+     H+ Y+
Sbjct: 206 MEANNDKKNRAPFGRPNNGNEPMIQGDLGINAGHFPYSQRVQQ-----PQAQPQKHIQYQ 260

Query: 259 NATHGPMEF-------NNPETQEQARPSSF--QDETLTH----------LKEINVDMIKI 299
              + P          NN   Q    P+ +  +DE+ TH          L+ IN DM K+
Sbjct: 261 RYPYTPYSSVDSNTYQNNRRKQLNMSPNQYNEEDESSTHGKFSVSEIDDLRSINQDMAKL 320

Query: 300 IESMQHFISLQHNFCSKSFTFKNVSKKKSENIMKDHQKQ-LKTFENDMLTFKQHVMSRAH 358
           I  M++F++L  +    S  +K         I  D QKQ  + F+N++  FK +V+ R H
Sbjct: 321 IGFMEYFVTLHLD----SGKYK---------IDDDPQKQNWENFQNELANFKNNVIKRLH 367

Query: 359 RTMDSLH 365
             + + H
Sbjct: 368 TKLGASH 374

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 473 QMMHNPFASKNGHKPGNTKRTNSVLMDPLTPATSV 507
           Q+M NPF   N     +TKR  SVL+DPLTP  SV
Sbjct: 478 QIMQNPFERTNNSI--STKRNQSVLLDPLTPVVSV 510

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 93/144 (64%), Gaps = 17/144 (11%)

Query: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103
           N IFIHKLY ILED  L DLIWWS+ G SF+I+P ERFSKALATYFKHTNITSFVRQLNI
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHKVS+DH      + DD  TN                        + + E+      
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTN------------VTNHANTDVNNNITDNEQ-----V 179

Query: 164 KIWEFKHSSGIFKKGDIEGLKHIK 187
           KIWEFKHS+GIF+KGD+E LK IK
Sbjct: 180 KIWEFKHSAGIFRKGDVESLKLIK 203

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 274 EQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSENIMK 333
           EQ  P    +     +K  N+DMIK+I+ MQ F+SL +   +   +  ++     +N MK
Sbjct: 352 EQPDPQYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNTNGIISEPSIGTSLKDNEMK 411

Query: 334 DHQKQLKTFENDMLTFKQHVMSR 356
              +Q   F++++  FK+ ++SR
Sbjct: 412 ---QQWDEFQSEITNFKRSILSR 431

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 473 QMMHNPFASKNGHKPGNTKRTNSVLMDPLTPA 504
           QMM NPF S N     ++KR  SVL+DPLTP 
Sbjct: 557 QMMQNPFNS-NASSRYSSKRHRSVLLDPLTPV 587

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  164 bits (416), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/147 (53%), Positives = 98/147 (66%), Gaps = 16/147 (10%)

Query: 41  PPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 100
           P Q+ +FIHKLY ILEDD L DLIWWS SGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132

Query: 101 LNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKS 160
           LN+YGFHKVS+DH  +  +     +  +                     A VQE      
Sbjct: 133 LNMYGFHKVSNDHGKSSEHDSASNSRTNN---------SNSSDNNNNSNADVQED----- 178

Query: 161 NPTKIWEFKHSSGIFKKGDIEGLKHIK 187
              KIW+F+HS+G+FK+GDIEGLK+IK
Sbjct: 179 --IKIWKFRHSTGLFKRGDIEGLKYIK 203

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 19/81 (23%)

Query: 283 DETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSENIMKDHQKQLKTF 342
           DE L +LK +N+DM+ ++E ++  +++Q             S + S        ++    
Sbjct: 385 DEALGYLKGVNMDMVHVLELLESLVTIQ------------TSSEPSP-------QEFSGL 425

Query: 343 ENDMLTFKQHVMSRAHRTMDS 363
           E ++L FK  +MSR HR  D+
Sbjct: 426 EQELLRFKALLMSRVHRNSDA 446

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 467 DTFNTPQMMH-NPFAS-KNGHKPGNTKRTNSVLMDPLTPATS--VGIQGTLNYPIMNINP 522
           D F+ P+MM  NPF S  NG     +KR  S+LMDPL PA +  +G+  +   P MN +P
Sbjct: 525 DHFSGPRMMMMNPFESTGNG-----SKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSP 579

Query: 523 TV 524
             
Sbjct: 580 VT 581

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  162 bits (411), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 90/147 (61%), Gaps = 28/147 (19%)

Query: 41  PPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 100
           P QN +FIHKLY ILEDD L DLIWWS SG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105

Query: 101 LNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKS 160
           LN+YGFHKVS+DHN                                      Q   +   
Sbjct: 106 LNMYGFHKVSNDHNKG----------------------------IQQQQQQQQPSSEAGQ 137

Query: 161 NPTKIWEFKHSSGIFKKGDIEGLKHIK 187
           +  KIWEF+HS GIFK+GDIEGLK IK
Sbjct: 138 DGVKIWEFRHSMGIFKRGDIEGLKFIK 164

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 283 DETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSE-NIMKDHQKQLKT 341
           DE L  L+ +N DM+K+++ +Q F++LQ    S+ +   ++    S+ +  + HQ+++  
Sbjct: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367

Query: 342 FENDMLTFKQHVMSRAHRTMDS 363
            E ++L FK ++M R  + + S
Sbjct: 368 LEQEILRFKANLMQRLTKKLGS 389

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 469 FNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPLTPA 504
           F  P+MM NPF +    +  + KR  S+LMDPL+ A
Sbjct: 533 FAGPRMMMNPFETTG--QTSSVKRNMSILMDPLSSA 566

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  156 bits (394), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 95/149 (63%), Gaps = 4/149 (2%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 102
           QN +FIHKLY ILEDD+L DLIWW+ +G+SF I+P E FSK LATYFKHTNITSFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 103 IYGFHKVSHDHNSNEI----NSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKE 158
           IYGFHKV++ +++       N G + +   +                       +     
Sbjct: 121 IYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPGA 180

Query: 159 KSNPTKIWEFKHSSGIFKKGDIEGLKHIK 187
            S+P KIWEFKHS+ +F++GDIEGLK IK
Sbjct: 181 TSSPVKIWEFKHSANLFRRGDIEGLKFIK 209

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  147 bits (372), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 86/145 (59%), Gaps = 29/145 (20%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 106
           FIHKLY +LED+ +H+LIWWS S  SF+I+P ERFSKALATYFKHTN+ SFVRQLN+YGF
Sbjct: 60  FIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMYGF 119

Query: 107 HKV----SHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNP 162
           HKV    +H   S   N G++A                                +   N 
Sbjct: 120 HKVNDHKAHGAKSGAANKGEEAGLKT-------------------------RGGQPTDNS 154

Query: 163 TKIWEFKHSSGIFKKGDIEGLKHIK 187
           T +WEFKHSS  F++GD+E LK IK
Sbjct: 155 TSVWEFKHSSAAFRRGDMESLKLIK 179

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  144 bits (362), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 85/144 (59%), Gaps = 27/144 (18%)

Query: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103
           N  FIHKLY +LED  + +LIWWS    SF+I+P ERF KALATYFKHTN+ SFVRQLN+
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHKV +DH ++  +    A T+D                             +  N T
Sbjct: 131 YGFHKV-NDHKTHAASKNGAAKTDD--------------------------PASKSENTT 163

Query: 164 KIWEFKHSSGIFKKGDIEGLKHIK 187
            IWEFKHSS  F++GD+E LK IK
Sbjct: 164 SIWEFKHSSSAFRRGDMESLKLIK 187

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  139 bits (350), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 87/144 (60%), Gaps = 20/144 (13%)

Query: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103
           N +FI+KLY +LE+  L DLIWW+++G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHK+S+DH  N        ++ D                       V        N  
Sbjct: 68  YGFHKISNDHFHNLKREKKQKSSTD-------------------NNTGVSNNNSGDEN-I 107

Query: 164 KIWEFKHSSGIFKKGDIEGLKHIK 187
           K+WEFKHS G+FKKGD+E LK IK
Sbjct: 108 KVWEFKHSGGLFKKGDLENLKLIK 131

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 88/141 (62%), Gaps = 28/141 (19%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 106
           FIHKLY +LED+ + DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 73  FIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 132

Query: 107 HKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPTKIW 166
           HKVS DH SNE +S  D    +                         + E++  N   +W
Sbjct: 133 HKVS-DHKSNEKSSETDGAHGN------------------------GDIEEDSIN---LW 164

Query: 167 EFKHSSGIFKKGDIEGLKHIK 187
           EF+HS G F+KGD E LK IK
Sbjct: 165 EFRHSLGCFRKGDKESLKSIK 185

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  139 bits (349), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 85/146 (58%), Gaps = 35/146 (23%)

Query: 42  PQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQL 101
           PQN  FIHKLY +LEDD L +LIWWS S  SF+I+P ERFSKAL+ +FKHTN+ SFVRQL
Sbjct: 83  PQNPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQL 142

Query: 102 NIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSN 161
           N+YGF KVS DH S    + DD++   +                                
Sbjct: 143 NMYGFQKVS-DHKSTWAANTDDSDEPSI-------------------------------- 169

Query: 162 PTKIWEFKHSSGIFKKGDIEGLKHIK 187
              +WEFKHSSG F+KGD E LK IK
Sbjct: 170 --NLWEFKHSSGYFRKGDTESLKSIK 193

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 84/144 (58%), Gaps = 35/144 (24%)

Query: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103
           N  FIHKLY +LEDD++ DLIWWS+S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+
Sbjct: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHKVS DH  +                                     + E E  N  
Sbjct: 84  YGFHKVS-DHKPSSAKG-------------------------------TSQDEDEAIN-- 109

Query: 164 KIWEFKHSSGIFKKGDIEGLKHIK 187
            +WEF+HS G F+KGD E LK IK
Sbjct: 110 -LWEFRHSMGCFRKGDKESLKSIK 132

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 134/282 (47%), Gaps = 52/282 (18%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 106
           FIHKLY +LED  + DLIWWS +  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 45  FIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 104

Query: 107 HKVSHDHNSNEIN--SGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPTK 164
           HKV +D+   + +  S D A+TN+                                +   
Sbjct: 105 HKV-NDNTGKQTDKYSTDSASTNE--------------------------------DSIN 131

Query: 165 IWEFKHSSGIFKKGDIEGLKHIKXXXXXXXXXXXXXXXXXXXXXYDADSGV---RARPSS 221
           +WEFKHSS  F+KGD+EGLK IK                       ++S     R   S+
Sbjct: 132 LWEFKHSSSAFRKGDMEGLKTIKRRSSRNPILARKNSSTASTPAEQSESWTDHNRHPLSN 191

Query: 222 IQDPTATSNGFCNY----VPQISGANNPIP-ECFN----NSHVPYEN----ATHGPMEFN 268
              P   S  + N      PQ S     +P E F      SH   +N    + H     N
Sbjct: 192 ASAPEMNSQSYTNLRSISSPQHSNGMVYVPVEYFGVQPAASHNQQQNQVLDSKHNEGVQN 251

Query: 269 NPETQ-EQARPSSFQDETLTHLKEINVDMIKIIESMQHFISL 309
               + EQA      D+T+  L+  N+DMI+++E ++ +  L
Sbjct: 252 TTSLKNEQANAPWNCDQTVYELRTTNMDMIRLLELIEKWFFL 293

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 465 YADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPL 501
           Y+ +  TP +M NPFA +         R  SVLMDPL
Sbjct: 541 YSGSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPL 577

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 72/145 (49%), Gaps = 10/145 (6%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLS-FMIKP--VERFSKALATYFKHTNITSFVRQLNI 103
           F+H+LY IL    L D I+WS    S F IKP   +  S+ L +YFKH N++SFVRQL++
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGFHK+SH +       G+D N N+                      +      +  + T
Sbjct: 66  YGFHKLSHLN-----KQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLT 120

Query: 164 KIWEFKHSSGIFKK-GDIEGLKHIK 187
            IW F H SG F K  DI  L+ I+
Sbjct: 121 -IWYFTHPSGYFHKNADILNLEKIQ 144

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 72/153 (47%), Gaps = 16/153 (10%)

Query: 46  IFIHKLYQILEDDSLHDLIWW--SSSGLSFMIKPVER-FS-KALATYFKHTNITSFVRQL 101
           +FIH+LY IL+   L + I W   + G+ F IKP    FS K L  YFKH N TSFVRQL
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGV-FAIKPFHHNFSQKVLQKYFKHKNFTSFVRQL 61

Query: 102 NIYGFHKVSHDHN------SNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEK 155
            +YGFHK+S + N      S   N+G  + TN                      +   + 
Sbjct: 62  YMYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKN 121

Query: 156 EKEKSNPTKIWEFKHSSGIFKKG-DIEGLKHIK 187
            KE       W F H SG+F KG D+  L  I+
Sbjct: 122 GKEDIE----WYFTHPSGLFHKGSDVVTLNKIQ 150

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 7/83 (8%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L D+S  DLI WS+ G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 152 FVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMYG 211

Query: 106 FHKVSHDHNSNEINSGDDANTND 128
           +HKV       ++ SG   N++D
Sbjct: 212 WHKVQ------DVKSGSIQNSSD 228

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 103
           FIH+L+ IL  D L + I WS    S F+IKP    FS K L  +FKH N++SFVRQL++
Sbjct: 6   FIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVRQLHM 65

Query: 104 YGFHKVSHDHNSNEINSGDDAN 125
           YGFHK+ H  +S    SG D N
Sbjct: 66  YGFHKLPHSASSTLAASGADNN 87

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 175 FVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 234

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 235 WHKV-QDVKSGSIQSSSD 251

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 235

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 236 WHKV-QDVKSGSIQSSSD 252

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (66%), Gaps = 1/78 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++K++ +L D+S  +LI WS  G SF++   E F  + L  YFKH+N+ SFVRQLN+YG
Sbjct: 120 FVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMYG 179

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV    + +  NS DD
Sbjct: 180 WHKVQDVKSGSIQNSSDD 197

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 236 WHKV-QDVKSGSIQSSSD 252

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L D +  DLI W+  G SF++   E+F    L  YFKH+N  SFVRQLN+YG
Sbjct: 169 FVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMYG 228

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV    + +  NS DD
Sbjct: 229 WHKVQDVKSGSIQNSTDD 246

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 71/138 (51%), Gaps = 13/138 (9%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSG-LSFMIKP-VERFS-KALATYFKHTNITSFVRQLNI 103
           F+H+L+ IL  ++L++ I+W+      F IKP   +FS K L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 104 YGFHKVSHDHNSNEINSG----DDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEK 159
           YGFHK+S+ +N ++        D++ T                       A  Q++ K  
Sbjct: 66  YGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDRAKT- 124

Query: 160 SNPTKIWEFKHSSGIFKK 177
                IW F H SG+F K
Sbjct: 125 -----IWYFTHPSGVFHK 137

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (65%), Gaps = 1/79 (1%)

Query: 46  IFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIY 104
           +F++K++ +L D+S  +LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+Y
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 105 GFHKVSHDHNSNEINSGDD 123
           G+HKV    + +  NS DD
Sbjct: 172 GWHKVQDVKSGSIQNSSDD 190

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 236 WHKV-QDVKSGSIQSSSD 252

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 6/87 (6%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSS-SGLSFMIKPV--ERFSKALATYFKHTNITSFVR 99
           Q   FIH+L+ IL+ + L   I+WSS S   F +KP   E  S+ L  YFKH N++SFVR
Sbjct: 2   QTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVR 61

Query: 100 QLNIYGFHKVSHDHNSNEINSGDDANT 126
           QL++YGFHK++   +SN   S   ANT
Sbjct: 62  QLHMYGFHKIA---SSNAPQSQIAANT 85

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 105
           F++K++ ++ DD+  +LI WSS GLS +I   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 186 FVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMYG 245

Query: 106 FHKV 109
           +HKV
Sbjct: 246 WHKV 249

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 57/98 (58%), Gaps = 13/98 (13%)

Query: 34  KMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHT 92
           ++L   RP     F++KL+ +L D    D+I WS  G SF++   E+F    L  YFKH+
Sbjct: 154 RVLAKTRPA----FVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHS 209

Query: 93  NITSFVRQLNIYGFHKVSHDHNSNEINSG--DDANTND 128
           N  SFVRQLN+YG+HKV       +I SG  + AN ND
Sbjct: 210 NFASFVRQLNMYGWHKVQ------DIRSGSMNMANNND 241

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 3/70 (4%)

Query: 47  FIHKLYQILEDDSLHDLIWWSS-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 103
           FIH+L+ IL++ +L D I WSS     F++KP +  FS K L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFVRQLHM 65

Query: 104 YGFHKVSHDH 113
           YGFHK++  H
Sbjct: 66  YGFHKIATVH 75

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (63%), Gaps = 8/80 (10%)

Query: 31  HGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYF 89
           HGSK         N  F+ KLY+ILE ++  +L+ W+  G SF++    +F+ + L T+F
Sbjct: 74  HGSK-------AANNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHF 126

Query: 90  KHTNITSFVRQLNIYGFHKV 109
           KH+N +SFVRQLN Y FHKV
Sbjct: 127 KHSNFSSFVRQLNKYDFHKV 146

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (61%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D +   LI WSS G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I    D
Sbjct: 220 WHKV-QDVRSGSIQGNSD 236

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 7/83 (8%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D S   LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 166 FVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMYG 225

Query: 106 FHKVSHDHNSNEINSGDDANTND 128
           +HKV       ++ SG   N +D
Sbjct: 226 WHKVQ------DVRSGSIQNNSD 242

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 52/71 (73%), Gaps = 4/71 (5%)

Query: 47  FIHKLYQILEDDSLHDLIWWS-SSGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 103
           FIH+L+ IL++  LH+LI WS      F++KP +  FS + L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLHM 65

Query: 104 YGFHKV-SHDH 113
           YGFHK+ SH+H
Sbjct: 66  YGFHKLPSHNH 76

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 58/96 (60%), Gaps = 9/96 (9%)

Query: 34  KMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHT 92
           ++L   RP     F++KL+ +L++    D+I W+  G SF++   E+F    L  YFKH+
Sbjct: 112 RVLAKTRPA----FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHS 167

Query: 93  NITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTND 128
           N  SFVRQLN+YG+HKV  D  S  +N    ANTND
Sbjct: 168 NFASFVRQLNMYGWHKV-QDIRSGSMNM---ANTND 199

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 60/106 (56%), Gaps = 8/106 (7%)

Query: 24  ASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-S 82
           A   V KH SK  +     + A F++KL+ ++ D S    I WS+SG S ++   ERF  
Sbjct: 175 AKAHVDKHHSKKKLSTTRARPA-FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQ 233

Query: 83  KALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTND 128
           + L  YFKH+N  SFVRQLN+YG+HKV       ++ SG   + ND
Sbjct: 234 EVLPKYFKHSNFASFVRQLNMYGWHKVQ------DVKSGSMLSNND 273

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D +   LI WS+ G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 161 FVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYG 220

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I+   D
Sbjct: 221 WHKV-QDVRSGSIHGNSD 237

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSS-GLSFMIKPVER-FSK-ALATYFKHTNITSFVR 99
           Q   F+HKL+ IL++  + +LI WS     +F +KP +  F+   L  YFKH N++SFVR
Sbjct: 2   QIKTFVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVR 61

Query: 100 QLNIYGFHKVSHDHNSNEINSGDDANT-NDVXXXXXXXXXXXXXXXXXXXXATVQEKEKE 158
           QL++YGFHK+      N I+    +++ N+                     +  QE ++ 
Sbjct: 62  QLHMYGFHKIPVLDVKNTISPLPSSDSINNTSTNSTGPEFTGNNNENSSLESMAQETDQR 121

Query: 159 KSN-PTKIWEFKHSSGIFKK 177
           +++  + IW F H SG F K
Sbjct: 122 RTDKASTIWYFSHPSGNFYK 141

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 5/86 (5%)

Query: 47  FIHKLYQILEDDSLHDLIWWS-SSGLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 103
           F+H+L+ IL +  ++  I+WS +  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDV 129
           YGFHK+SH   S E  S ++ NT ++
Sbjct: 66  YGFHKLSHP--SPEQTSANNGNTKEL 89

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 37  VGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNIT 95
            G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  
Sbjct: 78  AGAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFA 136

Query: 96  SFVRQLNIYGFHKV 109
           SFVRQLN Y FHKV
Sbjct: 137 SFVRQLNKYDFHKV 150

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 2/71 (2%)

Query: 40  RPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITSFV 98
           RPP N  F+ KLY ILE ++  D++ W+ +G +F++    +F++  L  +FKH+N  SFV
Sbjct: 50  RPPANE-FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFV 108

Query: 99  RQLNIYGFHKV 109
           RQLN Y FHK+
Sbjct: 109 RQLNKYDFHKI 119

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 49/68 (72%), Gaps = 3/68 (4%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSS-GLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 103
           F+H+L+ IL +  ++  I+WSS+  + F +KP +  FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVRQLHM 65

Query: 104 YGFHKVSH 111
           YGFHK+SH
Sbjct: 66  YGFHKLSH 73

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 4/81 (4%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSS--GLSFMIKPV--ERFSKALATYFKHTNITSFV 98
           Q+  F+H+L+ IL D +L  +I W+    G  F++KP   E     L  YFKH N++SFV
Sbjct: 2   QHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFV 61

Query: 99  RQLNIYGFHKVSHDHNSNEIN 119
           RQL++YGFHKV ++  ++ IN
Sbjct: 62  RQLHMYGFHKVGNNSVNSHIN 82

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 38  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITS 96
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 79  GAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 137

Query: 97  FVRQLNIYGFHKV 109
           FVRQLN Y FHKV
Sbjct: 138 FVRQLNKYDFHKV 150

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D +   LI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 214 FVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 273

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 274 WHKV-QDVKSGSIQSNSD 290

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 38  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITS 96
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 80  GSKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 138

Query: 97  FVRQLNIYGFHKV 109
           FVRQLN Y FHKV
Sbjct: 139 FVRQLNKYDFHKV 151

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D++ H LI WS  G SF++     F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 197 FVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMYG 256

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HK+  D  S  I S  D
Sbjct: 257 WHKI-QDVKSGSIQSSSD 273

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (2%)

Query: 40  RPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFV 98
           RPP N  F+ KL++ILE +   +++ W+  G SF++    +F+ + L  +FKH+N  SFV
Sbjct: 72  RPPSNE-FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFV 130

Query: 99  RQLNIYGFHKV 109
           RQLN Y FHKV
Sbjct: 131 RQLNKYDFHKV 141

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (61%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++KL+ ++ D     LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 220 WHKV-QDVKSGSIQSNSD 236

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 47  FIHKLYQILEDDSLHDLI-WWSSSGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 103
           F+++L+ IL+   LH  I W+S     F++KP +  FS K L  YFKH NI+SFVRQL++
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 104 YGFHKVS 110
           YGFHK+S
Sbjct: 66  YGFHKIS 72

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KLY ILE++   D++ W++ G SF++    +F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 106 FHKV 109
           FHK+
Sbjct: 121 FHKI 124

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 47  FIHKLYQILEDDSLHDLI-WWSSSGLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 103
           FIH+LY IL++  L + I W+      F++KP +  FSK  L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 104 YGFHKVS 110
           YGFHK++
Sbjct: 66  YGFHKIT 72

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F++K++ ++ D     LI WS  G SF+++  E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 266 FVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMYG 325

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV    +++ + + DD
Sbjct: 326 WHKVQDAKSNSILTTADD 343

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 2/78 (2%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F++K++ ++ D     LI WS  GLS ++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 230 FVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMYG 289

Query: 106 FHKVSHDHNSNEINSGDD 123
           +HKV  D  S  I S  D
Sbjct: 290 WHKV-QDVKSGSIQSSSD 306

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 47  FIHKLYQILEDDSLHDLIWWS-SSGLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 103
           F+H+L+ IL +  ++  I+WS +  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 104 YGFHKVSH 111
           YGFHK+SH
Sbjct: 66  YGFHKLSH 73

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 5/68 (7%)

Query: 47  FIHKLYQILEDDSLHDLIWWS--SSGLSFMIKPVERF--SKALATYFKHTNITSFVRQLN 102
           FIH+L+ IL D +L + I WS    G+ F+++P +++  +  L  YFKH N++SFVRQL+
Sbjct: 6   FIHQLHAILNDATLAEWIRWSDDQDGV-FVLRPYDKWFSTLVLKRYFKHGNVSSFVRQLH 64

Query: 103 IYGFHKVS 110
           +YGFHK+S
Sbjct: 65  MYGFHKLS 72

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL++ILE    +D+I W+  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 106 FHKV 109
           FHK+
Sbjct: 90  FHKI 93

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITSFVRQLNIYG 105
           F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 106 FHKV 109
           FHKV
Sbjct: 147 FHKV 150

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL++ILE     D+I W++ G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 106 FHKV 109
           FHK+
Sbjct: 89  FHKI 92

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWS-SSGLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 99
           Q   F+H+L+ IL +  ++  I+WS +    F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 100 QLNIYGFHKVSH 111
           QL++YGFHK+SH
Sbjct: 62  QLHMYGFHKLSH 73

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL+ ILE +   +++ WS++G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 106 FHKV 109
           FHK+
Sbjct: 137 FHKI 140

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 42  PQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQ 100
           PQ+  F+ K+Y ILE     D++ W+ +G SF++     F S+ L  +FKH+N  SFVRQ
Sbjct: 82  PQSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQ 141

Query: 101 LNIYGFHKV 109
           LN Y FHKV
Sbjct: 142 LNKYDFHKV 150

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 61/142 (42%), Gaps = 43/142 (30%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F+ K+Y ILE     +++ W+ +G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 106 FHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPTKI 165
           FHKV                                           QE+ K        
Sbjct: 111 FHKVKR----------------------------------------TQEERKVWQYGELS 130

Query: 166 WEFKHSSGIFKKGDIEGLKHIK 187
           WEFKH   +FK+G  E L +IK
Sbjct: 131 WEFKHP--LFKRGQEENLDNIK 150

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL+ ILE     D++ W+ +G SF++     F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 106 FHKV 109
           FHKV
Sbjct: 86  FHKV 89

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KLY ILE     D++ W+ +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 106 FHKV 109
           FHKV
Sbjct: 94  FHKV 97

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 62/142 (43%), Gaps = 43/142 (30%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 105
           F+  +Y ILE +   D+I WS  G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 106 FHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPTKI 165
           FHKV                                           QE++K+     + 
Sbjct: 127 FHKVKR----------------------------------------TQEEKKKWKYGEQS 146

Query: 166 WEFKHSSGIFKKGDIEGLKHIK 187
           WEF H   +FK+   +GL +IK
Sbjct: 147 WEFCHP--LFKRNHDDGLNNIK 166

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 38  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITS 96
           G R   N  F+ KL+ ILE     D+I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 30  GSRAAYND-FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSS 88

Query: 97  FVRQLNIYGFHKV 109
           FVRQLN Y FHKV
Sbjct: 89  FVRQLNKYDFHKV 101

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 105
           F++K++ ++ D S + LI W+  G SF +   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 171 FVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMYG 230

Query: 106 FHKV 109
           +HK+
Sbjct: 231 WHKI 234

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL+ ILE     D++ W+  G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 106 FHKV 109
           FHKV
Sbjct: 104 FHKV 107

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 62/140 (44%), Gaps = 14/140 (10%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 99
           Q   FIH+L+ +L D SL   I WS+     F +KP   E   K L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVR 61

Query: 100 QLNIYGFHKVSHDHNS--NEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEK 157
           QL++YGFHK+    N     +N+G  A                           + +  K
Sbjct: 62  QLHMYGFHKLQTGPNGMHTTVNAGAGAG-----LPASAATAGSTTSMDNEPPTHIIKSNK 116

Query: 158 EKSNPTKIWEFKHSSGIFKK 177
           E    + +W F H SG F K
Sbjct: 117 E----SMVWYFTHPSGYFYK 132

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 105
           F+ KL+ ILE +    +I WS  G +F++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 106 FHKVSHDHNSNEINSG 121
           FHKV      NE++ G
Sbjct: 103 FHKVK--RKKNEVSEG 116

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 38  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSK-ALATYFKHTNITS 96
           G R   N  F+ KL+ ILE     ++I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 35  GTRAAYND-FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSS 93

Query: 97  FVRQLNIYGFHKV 109
           FVRQLN Y FHKV
Sbjct: 94  FVRQLNKYDFHKV 106

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 61/142 (42%), Gaps = 29/142 (20%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 99
           Q   FIH+L+ +L D SL   I WS+     F +KP   E     L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVR 61

Query: 100 QLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEK 159
           QL++YGFHK+          S   A  N+                       + +  KE 
Sbjct: 62  QLHLYGFHKLQ---TGPGAASSGPAGDNE-------------------PPTHIIKSNKE- 98

Query: 160 SNPTKIWEFKHSSGIFKKGDIE 181
              + +W F H SG F KG  +
Sbjct: 99  ---SMVWYFTHPSGYFYKGACQ 117

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 60/141 (42%), Gaps = 8/141 (5%)

Query: 43  QNAIFIHKLYQILEDDSLHDLIWWSSS----GLSFMIKPVER-FSK-ALATYFKHTNITS 96
           QN  FIH+L+ IL+   L   I W       G+ F ++P +  FS   L  YFKH N++S
Sbjct: 2   QNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVSS 60

Query: 97  FVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKE 156
           FVRQL++YGFHK++             A T+                      A      
Sbjct: 61  FVRQLHMYGFHKLAAPTAPTSTEPASPA-TSPAASAGSSVAGGGTSSADGSAGAAATTAG 119

Query: 157 KEKSNPTKIWEFKHSSGIFKK 177
            +      +W+F H SG F +
Sbjct: 120 TKSGKSAVVWQFSHPSGAFCR 140

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 46  IFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 104
           +F+  L+ ILED+   ++I W+  G  F++     F S  L  +F H+N  SFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 105 GFHKV 109
           GFHK+
Sbjct: 94  GFHKI 98

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 61/145 (42%), Gaps = 12/145 (8%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLS-FMIKPV--ERFSKALATYFKHTNITSFVRQLNI 103
           F+H+L+ +L      + I W +   S F+I P   E   K L  YFKH N +SFVRQL++
Sbjct: 4   FVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLHM 63

Query: 104 YGFHKVSHDHNSNEINSGDDANTNDVXXXXXXXXXXXXXXXXXXXXATVQEKEKEKSNPT 163
           YGF K+        I + DD+N N                             + K   T
Sbjct: 64  YGFQKL-------PIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSRPKRGST 116

Query: 164 KIWEFKHSSGIF-KKGDIEGLKHIK 187
             W F H SG F +  D+  L  I+
Sbjct: 117 -TWHFTHPSGFFHRNSDVVTLNRIQ 140

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 46  IFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIY 104
           +F+ KL+ +L+ ++   +I WSS G  F+I   E+F+K  L  +F  ++ T+FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 105 GFHKVSHDHNSNEIN 119
            F K    H     N
Sbjct: 66  SFQKTKRPHCEEFFN 80

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 46  IFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHT--NITSFVRQLNI 103
           +F+ KL+Q+L+ ++  ++I W   G  F+I   ++F+K +   F  +  +  SFVRQL+ 
Sbjct: 6   VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 104 YGFHKVSHDH 113
           Y F K+   H
Sbjct: 66  YEFQKMERLH 75

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 40  RPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKA-LATYFKHTNITSFV 98
           R  Q  +F+ KLY +L+ ++  ++I WS+ G   +I   ++F+K  L  +F      +FV
Sbjct: 6   RMEQPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFV 65

Query: 99  RQLNIYGFHK 108
           +QL+ Y F K
Sbjct: 66  KQLSKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 47  FIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 105
           F+  L++IL+ ++   +I WS+ G  F+I   ++F+K  L  +F   +  +F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 106 FHK 108
           F K
Sbjct: 67  FQK 69

>TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2.639
           YMR068W
          Length = 556

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 536 APSPIYPINEPTTRMYSQPKMRSLGSTSSLPNDRRNS 572
            PSPIY +N PT  +YSQ  +  L + S + N RR S
Sbjct: 228 GPSPIYSLNSPTVSLYSQANV--LNNLSRISNGRRAS 262

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
           some similarities with uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 1177

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 650 GPTPKNMDNLPAISSNLINSPMNVEHGTS--LSHPEPTPGIELPQ--PSLPTTNA 700
           GP P N+ +L A   NL N+   + HG     S  +  PGI  P+  PS PT  A
Sbjct: 651 GPRPGNVIDLGAYGGNLANADAGLGHGVDGLTSRIKQIPGIRTPETLPSKPTLQA 705

>AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL153W
           (PEX14)
          Length = 335

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 273 QEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSENIM 332
           QEQ     F+D+ +  LKE++  +IK+  +++     ++N    +F F+++  + +E   
Sbjct: 154 QEQ---DEFRDQQVEKLKELDATIIKLQGALEETTKTRNNI---NFEFRDLKLQVTEMAK 207

Query: 333 K--------DHQKQLKTFENDMLTFKQHV 353
           K        DH  QL   ++DM + K+ +
Sbjct: 208 KLDEFRQARDHNSQLTALQSDMESLKRLI 236

>NDAI0G02140 Chr7 (484059..485720) [1662 bp, 553 aa] {ON} Anc_8.408
           YDR200C
          Length = 553

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 12/56 (21%)

Query: 304 QHFISLQHNFCSKSFTFKNVSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHR 359
           +H   LQ+N        +    K+ E++MKDHQK+L   END     QH M +  +
Sbjct: 378 KHLSHLQNNL-------RQALTKQQESLMKDHQKELNDIEND-----QHAMEKQFK 421

>NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON} 
          Length = 247

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 12/55 (21%)

Query: 291 EINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSENIMKDHQKQLKTFEND 345
           E  VD  KII +M  FI          FT K   +KK   + +DHQ++L TF  D
Sbjct: 12  EKEVDKNKIINTM--FI----------FTIKRDGRKKCRCVARDHQQKLGTFNED 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,192,437
Number of extensions: 3312637
Number of successful extensions: 10659
Number of sequences better than 10.0: 147
Number of HSP's gapped: 11007
Number of HSP's successfully gapped: 167
Length of query: 748
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 631
Effective length of database: 40,065,477
Effective search space: 25281315987
Effective search space used: 25281315987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)