Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3025.475ON67864533590.0
Smik_15.3185.475ON67264527630.0
YOR138C (RUP1)5.475ON67164527030.0
Suva_8.1905.475ON66664726530.0
Kpol_543.95.475ON64264614420.0
TDEL0A033905.475ON62265714260.0
TPHA0J027805.475ON63165414160.0
KAFR0E025405.475ON65966013631e-180
SAKL0G03564g5.475ON60564713301e-176
NCAS0H022705.475ON69652512561e-163
NDAI0C013905.475ON70971011871e-153
Kwal_55.212675.475ON60464411111e-143
KLTH0F15004g5.475ON59750510571e-135
TBLA0A025405.475ON67852410241e-129
ZYRO0D11264g5.475ON5474979271e-116
KNAG0B040505.475ON6734989291e-115
CAGL0I07205g5.475ON6036559171e-114
TBLA0B022305.475ON7905138891e-108
KLLA0E03169g5.475ON5445016262e-72
Smik_5.3088.185ON42835870.075
NDAI0C058908.185ON46233810.38
YER143W (DDI1)8.185ON42835790.62
Skud_5.2808.185ON42835790.65
AGR023C3.270ON78044771.4
KLLA0E10341g8.185ON41433751.7
Suva_2.707.488ON138034743.3
TBLA0H005708.440ON1109115733.7
KAFR0C004103.270ON76958715.6
Ecym_71787.488ON126936725.7
NCAS0A039208.185ON47233706.6
Kpol_1048.52.125ON163577716.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.302
         (678 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...  1298   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...  1068   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...  1045   0.0  
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...  1026   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   560   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   553   0.0  
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   550   0.0  
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   529   e-180
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   516   e-176
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   488   e-163
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   461   e-153
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   432   e-143
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   411   e-135
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   399   e-129
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   361   e-116
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   362   e-115
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   357   e-114
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   347   e-108
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   245   2e-72
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    38   0.075
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    36   0.38 
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    35   0.62 
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    35   0.65 
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    34   1.4  
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    33   1.7  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   3.3  
TBLA0H00570 Chr8 (116301..119630) [3330 bp, 1109 aa] {ON} Anc_8....    33   3.7  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    32   5.6  
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    32   5.7  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    32   6.6  
Kpol_1048.5 s1048 complement(22179..27086) [4908 bp, 1635 aa] {O...    32   6.8  

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score = 1298 bits (3359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/645 (97%), Positives = 628/645 (97%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60
           MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60

Query: 61  SENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAA 120
           SENRMMAGSNSYDVPNSGDQEDIDM                 ITENHSGSSSSNERGPAA
Sbjct: 61  SENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAA 120

Query: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180
           RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF
Sbjct: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180

Query: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240
           PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL
Sbjct: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240

Query: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300
           WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM
Sbjct: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300

Query: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360
           CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN
Sbjct: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360

Query: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420
           DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP
Sbjct: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420

Query: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480
           QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN
Sbjct: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480

Query: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540
           DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN
Sbjct: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540

Query: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600
           PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET
Sbjct: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600

Query: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH
Sbjct: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score = 1068 bits (2763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/645 (81%), Positives = 572/645 (88%), Gaps = 4/645 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60
           MMDNQAVKSLLEMGIPHEVA++AL RTGGNLEAAVNFIFSNELP+Q     E     PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60

Query: 61  SENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAA 120
           SENR+MAG NSYDVPN+G+Q D+DM                  T++ SGS+S+NE   AA
Sbjct: 61  SENRIMAG-NSYDVPNNGEQ-DVDMPDVGGVDVDYDDDEDI--TDDRSGSNSTNEYRRAA 116

Query: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180
           ++YDHYS+SETSI PPSYNIVQ NEFK  +DDPTVVLPLPLNSLIESYFGLFALLVSVYF
Sbjct: 117 QEYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYF 176

Query: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240
           PHVFLKPDFQDLN+ PDWFKG+SFT PKYR+AYREADDGS TS+IVLASG SD+LQP LL
Sbjct: 177 PHVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLL 236

Query: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300
           WQLQKLISV+NTRMCERAFVSA+LFTLSLEPQLKSKLA+SEHLYEVLP FIKSLAVDLEM
Sbjct: 237 WQLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEM 296

Query: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360
           CPGIRD+ETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE 
Sbjct: 297 CPGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEE 356

Query: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420
           +EE+  R GG GQE+E + EPENTLKEVAPVLTILFNELETNTES+TLPNGVD+PLEFYP
Sbjct: 357 EEEEVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYP 416

Query: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480
           QLYTKRCKDQLIRH+ISKRKQAR+RSR LL+EI+ LKSYQGKN  T+LESTLAYLQ SP+
Sbjct: 417 QLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPD 476

Query: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540
           DANN+AA QIASLKDTLNS RSAKMEEYKDLASK+HGEW+LSHPETHII TAKQL LIEN
Sbjct: 477 DANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 536

Query: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600
           PY+LT+AA+SPYSYF+RNRNGVWSW+QSN LGTEFK+  C S SVVQEAI+HGTKYASE 
Sbjct: 537 PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEM 596

Query: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           PLMFIYCEEGKIPTEE V KAL +N GCSKFAKDD++SLRTL S 
Sbjct: 597 PLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQ 641

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/645 (80%), Positives = 567/645 (87%), Gaps = 5/645 (0%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60
           MMDNQAVKSLLEMGIPHEVA+DAL RTGGNLEAAVNFIFSNELPEQA+ G E    QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60

Query: 61  SENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAA 120
           SEN+++AG+   DVPN+GDQ DIDM                  T+  SGS+S++     A
Sbjct: 61  SENKIVAGTKPCDVPNNGDQ-DIDMPDVSGVDVDYDDDEDI--TDERSGSNSTSGCRVTA 117

Query: 121 RDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYF 180
           ++YD YSISETSI PPSY+IVQ NEFK  V DPTVVLPLPLNSLIESYFGLFALL +VYF
Sbjct: 118 QNYDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYF 177

Query: 181 PHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240
           PHVFLKPDF+DLNY  DWFKGSSFT PKYRLAY EA+DGS TSEIVLASG ++ LQP LL
Sbjct: 178 PHVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLL 237

Query: 241 WQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEM 300
           WQLQKLISV+NTR CERAFVSA++FT SLEPQL+SKLADSEHLYEVLP FIKSLAVDLEM
Sbjct: 238 WQLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEM 297

Query: 301 CPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEN 360
           CPGIRDRETR+LFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE 
Sbjct: 298 CPGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEE 357

Query: 361 DEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYP 420
           +EED  R  GG QE+  + EPENTLKEVAPVLTILFNELETNTES++LPNGVDIPLEFYP
Sbjct: 358 EEEDVIR--GGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYP 415

Query: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480
           QLYTK+CKDQLIRH+ISKRKQAR RSR LLQEIN LKSYQGKNIST+LESTLAYLQ  P+
Sbjct: 416 QLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPD 475

Query: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIEN 540
           DANN+AA+QIASLKDTLNS R+AKMEEYKDLASK+HGEW+LSHPETHII TAKQL LIEN
Sbjct: 476 DANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 535

Query: 541 PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASET 600
           PYILT+AALSPYSYF+R+RNG WSW+QSN LGTEFK+K C SPSVVQEAIKHGTKYASET
Sbjct: 536 PYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASET 595

Query: 601 PLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           PLMFIYCEEGKIPTEE V++AL++N+GC KFA+DD+NSL+TLRS 
Sbjct: 596 PLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQ 640

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/647 (79%), Positives = 567/647 (87%), Gaps = 19/647 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60
           MMDNQAVKSLLEMGIPHEVA+DAL RTGGNLEAAVNFIFSNELPEQ  TG      QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATG------QPRI 54

Query: 61  SENRMM--AGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGP 118
           SENR++  AG+ +YDVPNSGDQ DIDM                 +T++ SGSSSSN RGP
Sbjct: 55  SENRVVPDAGAGAYDVPNSGDQ-DIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGP 113

Query: 119 AARDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSV 178
                DHYSISETS+ PPSY+IVQ N+FK AVDDPTVVLPLPLNSLIESYFGLFALL S+
Sbjct: 114 -----DHYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASM 168

Query: 179 YFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPR 238
           YFPHVFLKPDFQDLNY PDWFKGSSF  P+YRLAYRE+ DGS TSEIV+ASG S D+QP 
Sbjct: 169 YFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPH 228

Query: 239 LLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDL 298
           LLWQLQKLISV+NT+MCERAFVSA+LFTLSLEPQLK+KLADSEHLYEVLPTFIKSLAVDL
Sbjct: 229 LLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDL 288

Query: 299 EMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE 358
           EMCPGIRDRETRNLFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE
Sbjct: 289 EMCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE 348

Query: 359 ENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEF 418
           E +E +    G G  +     EPENTLKEVAPVLTILFNELETNTES+TLPNGVD+PLEF
Sbjct: 349 EEEEGEVVYGGDGAHQ-----EPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEF 403

Query: 419 YPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQAS 478
           YPQLYTKRCKDQLIRH+ISKRKQAR++SR+LLQEINNLKSYQGKNIST+LESTLAYLQA 
Sbjct: 404 YPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQAD 463

Query: 479 PNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLI 538
             DA+N+A++QIASLKDTLNS+R+AKMEEYKDLASK+HGEW+LSHPE HII TAKQL LI
Sbjct: 464 TKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLI 523

Query: 539 ENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYAS 598
           ENPYIL++A LSPYSYF R+R+G WSW+QSN LGTEFKI  C SPSVVQEAI+HGTKYAS
Sbjct: 524 ENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYAS 583

Query: 599 ETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           E PLMFIYCEEG+IPT++EVSKAL+NNTGC KFAKDD+++L TLR+ 
Sbjct: 584 EMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQ 630

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/646 (43%), Positives = 421/646 (65%), Gaps = 31/646 (4%)

Query: 2   MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRIS 61
           ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +A+           I 
Sbjct: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSD--------IE 55

Query: 62  ENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAAR 121
                  +N  ++ N    +  D+                 + +N     S+        
Sbjct: 56  IISYKEKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCYVSDKIV 115

Query: 122 D-YDHYSISETSIA--------PPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLF 172
           D  D+YS     I         PPSY IV+ ++ K  + DPTV+LPLP NS+IE+YF L+
Sbjct: 116 DNMDYYSSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALY 175

Query: 173 ALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRL-AYREADDGSATSEIV-LASG 230
           +L ++ Y PH+ ++PDF+DL+++ DWFKGSSF+ PK  L +  +     +T +I  +   
Sbjct: 176 SLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDM 235

Query: 231 SSDDLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTF 290
           + DD QP LLWQLQKL S++N+ M ERA+V A++F++ L+ Q + +LA+++HL EVLP+F
Sbjct: 236 NQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSF 295

Query: 291 IKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMF 350
           IK L V+LE CPG  + E R LFISSA +TP+ ++ P+ T LSLFHFLP+EYDSNLYKMF
Sbjct: 296 IKYLVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMF 355

Query: 351 NVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPN 410
           NVLLYP    DE D+    G    DE  +E  N+L +++P+L+I+F+E E  +  ++LP 
Sbjct: 356 NVLLYP----DENDSDYESG----DE--SEQGNSLGDISPILSIVFDEAEEGSSGISLPE 405

Query: 411 GVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLES 470
           GV++PLEF+PQ+YTK CK++LI+H+I+KRK A+ +S+ +L +IN++KS+QGK+I   + S
Sbjct: 406 GVEVPLEFFPQIYTKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINS 465

Query: 471 TLAYLQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIK 530
           +L YL+   ++ ++    ++  +K+ +   ++ KM EY+DLA K+  EW++S+PETHI++
Sbjct: 466 SLEYLER--DNKSDNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVE 523

Query: 531 TAKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAI 590
           T ++L LI  PY+L +A LSPYSY++R R G W+ VQ +  G +F ++ C S   V++ I
Sbjct: 524 TGRKLGLIGEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTI 583

Query: 591 KHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDE 636
           K  T++ASETPLMF+YC    IP E E+ K+ ++N+GC  F K+D+
Sbjct: 584 KQATRHASETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/657 (44%), Positives = 416/657 (63%), Gaps = 67/657 (10%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60
           M D  AV+SL+EMGI  +VA DAL RT G++EAA NFIF N+ P Q     E  A     
Sbjct: 1   MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVEQRA----- 55

Query: 61  SENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAA 120
               + AGS S   P  GD  +                              SN     +
Sbjct: 56  -HIELPAGSASGFQP--GDLNEY----------------------------ISNAPDTES 84

Query: 121 RDYDHYSISETSI-APPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVY 179
            D++   + E S+   PS     +   K  + DPTVVLPLP N L E YF LF L V+ Y
Sbjct: 85  EDFEEIDVEEDSVETGPSLECSGR---KGQISDPTVVLPLPPNFLFEGYFALFCLFVANY 141

Query: 180 FPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASG---SSDD-- 234
            PH+  +PDF DLNY  +W++G S+T  +YRL Y  + +GS   +I +      + +D  
Sbjct: 142 MPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYL-SKNGSDDEQIEIVPKDELTQEDGD 200

Query: 235 --LQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIK 292
             LQ  LLWQLQKL SV N+RM +RA+V A++F +++EPQ++  +A++EHL+EVLP+FIK
Sbjct: 201 YTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIK 260

Query: 293 SLAVDLEMCPGIRDRETRNLFISSALHTPNKNEP----PMETFLSLFHFLPEEYDSNLYK 348
           S+AVDLEMCP  +D E R  FISSA HTP+ + P     M+T+LSLFHFLPEEY++NLY+
Sbjct: 261 SVAVDLEMCPNFQDNEVRECFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYR 320

Query: 349 MFNVLLYPEE--ENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESM 406
           MFN LL+ ++  E+D+ D+    G           EN+L E+APV TI+F+E+E  TE++
Sbjct: 321 MFNALLFADDSVESDQSDSPDGEG-----------ENSLSEIAPVFTIVFDEMEETTEAV 369

Query: 407 TLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNIST 466
            L  GV++PLEFYPQLYTK CKD+LI+H+I+KR+Q++  SR +LQEI +LKS+QGK++S 
Sbjct: 370 PLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSK 429

Query: 467 VLESTLAYLQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPET 526
            + S+L YLQ   ++ + +  + +  LKD + + ++ KM EYK++A ++  EW+LS PE 
Sbjct: 430 FINSSLDYLQK--DEKSPELIKGLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEI 487

Query: 527 HIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVV 586
            I+KTAK+L LI++ Y+LT+A +SPY Y+ RNR+G W +VQS      + ++ C SP  +
Sbjct: 488 QIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEI 547

Query: 587 QEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLR 643
           Q+AIK  T+  SE PLMFIYC++G IP ++ V KAL+NN GC +FAKDD+  L  ++
Sbjct: 548 QDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQ 604

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/654 (44%), Positives = 414/654 (63%), Gaps = 43/654 (6%)

Query: 1   MMDNQ-AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPR 59
           M DN+ +VKS+++MGIP +VA+DAL+R  G+LEAAVNFIFSNELP+  + G   G  +  
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDN-NMGESVGNEKYT 59

Query: 60  ISENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNE-RGP 118
            SE+  ++  N++    +GD  ++                     E  SG  SS+E   P
Sbjct: 60  TSEHVNISNDNNF---QAGDLSEV---------MNVSNYGYDNRFETDSGDLSSDEVSDP 107

Query: 119 AARDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSV 178
              + D   IS  ++  P+YNIV+    K ++ DPTVV+PLP NS+IESYFGLF++ +S+
Sbjct: 108 EIVEND---IS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISI 163

Query: 179 YFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYRE----ADDGSATSEIVLASGSSDD 234
           Y PH+ LKPDF+DLNY  +W+ G  F  PK+ +         DD   + E +       D
Sbjct: 164 YLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLD 223

Query: 235 LQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSL 294
            QP+LLWQLQKL +++N+ M ER++VS++LF+L L+   K KL D+EHLYEVLP+FIK L
Sbjct: 224 DQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYL 283

Query: 295 AVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLL 354
             +LEMCP  R  E RN  ISSA + P+ +EPP++T L+LFHFLP+EY+SNLYKMFN+LL
Sbjct: 284 TSNLEMCPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILL 343

Query: 355 YPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDI 414
           Y ++E+         G G  DE      N+L  +AP LTI+F+E++  +    LP GV I
Sbjct: 344 YADDED---------GDGAIDE-----GNSLNYLAPNLTIIFDEIDELSSMTPLPEGVSI 389

Query: 415 PLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAY 474
           PLEFYPQLYTK CKDQLI+H+I KR+ A+  SR  L+++N+LKS+QGK+I   L STL +
Sbjct: 390 PLEFYPQLYTKECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDF 449

Query: 475 L------QASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHI 528
           L      Q    + N K    +  +K+ L   ++ KM  YKDL  K++  W+LS+PE  I
Sbjct: 450 LDRDGQRQNGLTEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSI 509

Query: 529 IKTAKQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQE 588
           I TAK+L LI+ PY L++A +SP  Y+++ R+G W  VQ    G +F I+ C S   +Q+
Sbjct: 510 IATAKKLGLIDEPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQD 569

Query: 589 AIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTL 642
            ++  T++ SETPLMF+Y +EG IP ++ V K L+ NTGC +F KDD+  L  +
Sbjct: 570 CVRQYTRHGSETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  529 bits (1363), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 292/660 (44%), Positives = 422/660 (63%), Gaps = 41/660 (6%)

Query: 6   AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISENRM 65
           ++ SLLEMGI   VA+DAL +  GNLEAA+N+IFSN++  ++          P + E+ +
Sbjct: 7   SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEHTV 66

Query: 66  MAGSNSYD--------VPNS-GDQEDIDMXXXXXXXXXXXXXXXXXI---TEN-----HS 108
               + +          P + GD++D+                   +   TE       S
Sbjct: 67  ELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEEGSLQNPDQTVAGETEKVNIPIDS 126

Query: 109 GSSSSNERGPAARDYDHYSISETSIAPP-SYNIVQQNEFKCAVDDPTVVLPLPLNSLIES 167
            SSS +    +  + +   +SE +   P  Y+ VQ +E K  + DPT+VLPLP NSLIE+
Sbjct: 127 QSSSYSSFSTSLSNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLPLPPNSLIEN 186

Query: 168 YFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVL 227
           Y  L+AL ++ +F   FLKPDF+DLNY  +W++ SS   P YR+ + +AD+    +EIV 
Sbjct: 187 YLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE--TENEIVP 244

Query: 228 AS--GSSDDLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYE 285
           A+    +D  QP+LLWQLQKLI+V+N+ + ERA+VSA++F  S   QL+SKL D+EHL E
Sbjct: 245 AAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSKLGDAEHLNE 304

Query: 286 VLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSN 345
           VLP FIK+LAVDLE C G +  + + LFISSA + P++NEP  ET+LS FHFLPEEYD+N
Sbjct: 305 VLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFHFLPEEYDTN 364

Query: 346 LYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNT-E 404
           LYKMFNVLL P+E+++E         G+ DE+  +P+N+L  ++P LTI+FNE++ +T +
Sbjct: 365 LYKMFNVLLIPDEDDEE--------SGESDED--QPDNSLNIISPFLTIVFNEMDESTDD 414

Query: 405 SMTLP---NGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQG 461
           +MT      GVDIP EFYPQLYTK+CKD+LI+H++SKRK+++ + + +LQEIN LKSY G
Sbjct: 415 NMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHG 474

Query: 462 KNISTVLESTLAYLQASPNDANN---KAARQIASLKDTLNSTRSAKMEEYKDLASKVHGE 518
           K+I   L ST+ +LQ   N  +    + A+++  L+  +N  ++   +EYK+L+ K+H E
Sbjct: 475 KDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNE 534

Query: 519 WDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV--WSWVQSNALGTEFK 576
           W+LS+P+ HII+TAK L LI+ PY+LT   +SPY YF+R+R  V  W  VQSN LGT+F 
Sbjct: 535 WNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFH 594

Query: 577 IKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDE 636
           I N      V   IK  TK  +E+PLMFIYC+E  I +++++ K ++ N GCS F K D+
Sbjct: 595 ITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQ 654

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 280/647 (43%), Positives = 406/647 (62%), Gaps = 61/647 (9%)

Query: 4   NQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISEN 63
           NQ+++ LL+MGI HEVA+DAL RT G+LEA+VN+IFS EL  QA T           SEN
Sbjct: 5   NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL--QATTEHVDLTQDDSDSEN 62

Query: 64  RMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAARDY 123
            +  G  +  +PN+ +   ++                    EN                 
Sbjct: 63  GIKPGMLNDVIPNTDNVTTVETRE----------------VEN----------------- 89

Query: 124 DHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHV 183
              +I +  +AP           K +++DPTVVLPLP N+L+E+YF LF L V + FPH 
Sbjct: 90  ---TIPDDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHH 146

Query: 184 FLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLWQL 243
           FLKPDFQDLNY+ +WFKG  ++ P+YRL +   ++ S   +  L    S  LQP LLWQ 
Sbjct: 147 FLKPDFQDLNYNRNWFKGY-YSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQF 205

Query: 244 QKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPG 303
           QK I+V+N+ + +R FVSA++F   LEP +  KL   +HL+EVLP+FIKSLA D+EMC  
Sbjct: 206 QKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLL 265

Query: 304 IRD-RETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEENDE 362
             D R+ R LFIS+A H P+K+E  +ET +SL HFLPEEYD+NLY+MFN LLYPEE+ D 
Sbjct: 266 KEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPEEDEDG 325

Query: 363 EDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYPQL 422
           E+                  N+L  +AP+LT++F+E++ +TE+++L  GVD+PL+FYPQ+
Sbjct: 326 EEVE----------------NSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQI 369

Query: 423 YTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPNDA 482
           YTK  KD LI HVI+KRK+A+  S  +LQ++N LKS+QGK+I++ L ST+ +    P   
Sbjct: 370 YTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQ 429

Query: 483 NNKAA----RQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLI 538
           N+K      + + S+K+ + + ++ KMEEYK+++  +H +W+LSHP+ +++  AK++ LI
Sbjct: 430 NDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLI 489

Query: 539 ENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYAS 598
           + PY+LT A LSPY Y++R R+G+W  V S A G++ +  +   P  V E+IK  T++AS
Sbjct: 490 DEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLE-ASITEPHEVSESIKLATRHAS 548

Query: 599 ETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           ETPLMF YC+E KI  E  + K+L++N G SKF K D+  L  L+++
Sbjct: 549 ETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNN 595

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  488 bits (1256), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 243/525 (46%), Positives = 351/525 (66%), Gaps = 28/525 (5%)

Query: 133 IAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDL 192
           + PP YN+V +   K  +D PT++LPLPLNS+IE+Y  LFAL   +  P  FLK DF+DL
Sbjct: 162 MIPPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDL 221

Query: 193 NYSPDWFKGSSFTGPKYRLAYREADDGSATSE------------IVLASGSSDDL---QP 237
           NY+ +W+KG+SF  PK+ L +  ++D +  +E             ++  G+SD +   QP
Sbjct: 222 NYNKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQP 281

Query: 238 RLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVD 297
            LLWQLQKL ++ +  M ERA+ SAR+F+L    Q++S L+ S++L +VLP FIKS+  D
Sbjct: 282 FLLWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTD 341

Query: 298 LEMCPGIRDRET-RNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP 356
           L++CP   D E+ ++LFI+SA H P K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP
Sbjct: 342 LQLCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYP 401

Query: 357 EE--ENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDI 414
           ++  EN+E++       G+++E +    N+L + A ++T++FNE +  T  MT  +GV+I
Sbjct: 402 DDPSENNEDN-------GEQEEVY---NNSLNKAAHIITVIFNEADAYTPEMTSNSGVEI 451

Query: 415 PLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAY 474
           PL FYPQLY K+CKDQLI+H++ KR+QA  RS+ LL EI  LKS++GK+IS  LES   Y
Sbjct: 452 PLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEY 511

Query: 475 LQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQ 534
           LQ   N         I  ++  +   +++KMEEYK L+S++H +W+LSHPE  II+TAK 
Sbjct: 512 LQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKT 571

Query: 535 LRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGT 594
           L LI+ PY+LT   +SPY Y++R ++G+W  VQ N LGT+F++    S + VQE IK  T
Sbjct: 572 LGLIDEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQT 631

Query: 595 KYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSL 639
              +ETPLMF++C E  IP E+ V KA++ N GC +FAK D+ SL
Sbjct: 632 SRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 39/45 (86%)

Query: 1  MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPE 45
          M +N+ VK+LLEMGIP EVA+DAL RTGGNLE AV FIFSNELP+
Sbjct: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQ 45

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  461 bits (1187), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/710 (38%), Positives = 401/710 (56%), Gaps = 81/710 (11%)

Query: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELP----EQADTGGEGGAG 56
           M  N +V SL+EMGIP EVA++AL R  GNLEAAV FIFSNE+P    E +    +   G
Sbjct: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60

Query: 57  QPRISE---NRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXI-TENHSGSSS 112
           Q   S+       +G++ Y   +S   E   M                 I T N    +S
Sbjct: 61  QQEPSQLPPRSEASGADPYQT-HSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTS 119

Query: 113 SNERGPAARDYDHYSISETS---------------IAPPSYNIVQQNEFKCAVDDPTVVL 157
            +      RD D  +I E                  +PP+YN+V   + K  V DPT++L
Sbjct: 120 QHGED---RDDDGDNIQENDESTFSSSSTSSQSPAPSPPNYNVVTYTQLKARVTDPTIIL 176

Query: 158 PLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYR--- 214
           P+P+NSL+E+Y  L  L +++  P  FL+PDF+DLNY  DW+KG+S + P Y L  +   
Sbjct: 177 PVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDH 236

Query: 215 EADDGSAT----SEIVLASGS-----SDDLQPRLLWQLQKLISVINTRMCERAFVSARLF 265
           +ADD   +    + I+   G      +DD+QP+LLWQLQKLISV+N+ + ER+++S ++F
Sbjct: 237 DADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVF 296

Query: 266 TLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGI--------------------- 304
           +L L P ++  LA+ E+L +VLP F KSLA ++E C  I                     
Sbjct: 297 SLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNG 356

Query: 305 ----RDR-ETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE 359
               R R E  +LF+S+A +        ++T ++   F PEEY+SNLYKMFN LL+PE +
Sbjct: 357 NSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEID 416

Query: 360 NDEEDATRNG---GGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPL 416
           N  + A   G   G G            L  +AP+ T++F+ +++ T+ + LP GVD+P+
Sbjct: 417 NPSKTAVSEGDVPGTG-----------CLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPM 465

Query: 417 EFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQ 476
           EFYPQLYT  C+D L+R V  +RK+A   S+ LLQ+ N L+S+QGK+I+  L+ST+ YL 
Sbjct: 466 EFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLT 525

Query: 477 ASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLR 536
                +  KA  ++  L+  +N+ ++  ME+YK L++ + G  ++SHPE  II  AK   
Sbjct: 526 KDCG-SETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASN 584

Query: 537 LIEN-PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTK 595
           LI++ PY+LT+A +SP +YF+RNR G W  V+ N + TEF+I  C S   VQ AIK  T 
Sbjct: 585 LIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTI 644

Query: 596 YASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSH 645
           +A+E PLMFIYC +  I  +  + K L++N GC +F+KDD+ +L  LR  
Sbjct: 645 HANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQ 694

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 246/644 (38%), Positives = 369/644 (57%), Gaps = 58/644 (9%)

Query: 2   MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRIS 61
           M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q   G E    QP   
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQ---GPESKPLQP--- 54

Query: 62  ENRMMAGSNSYDVPNSGDQEDIDMXXXXXXXXXXXXXXXXXITENHSGSSSSNERGPAAR 121
               +            D+ED  +                  TE  S S+   E     R
Sbjct: 55  ----LHADAEQGPQKEEDREDSALLEH---------------TEYASVSNGPLEEPERYR 95

Query: 122 DYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFP 181
           DY   +  E +           NE K   +DP VV P   N+L E+YF LF L V + FP
Sbjct: 96  DYTLSTQEEAA-----------NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFP 144

Query: 182 HVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLW 241
           H FL PDF+DLNY PDW +G  F  P++R+ +   +D +      L S  +  LQP LLW
Sbjct: 145 HYFLGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLW 203

Query: 242 QLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMC 301
           Q QK ++V ++    R  VSAR  T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+C
Sbjct: 204 QFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELC 263

Query: 302 PGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEND 361
           PG   +  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP     
Sbjct: 264 PG--SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYP----- 316

Query: 362 EEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYPQ 421
                       +D++  E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P++FYPQ
Sbjct: 317 --------NDADDDDDVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQ 368

Query: 422 LYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYL-----Q 476
           LYT+  K  LI+ V     + + R+ ++L+ +N LKS+QGK+I + L STL ++      
Sbjct: 369 LYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSA 428

Query: 477 ASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLR 536
            + N   N     +  +K  L+  ++  M EYK ++ K++ +W+LSHPE  II+  ++L 
Sbjct: 429 VTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLG 488

Query: 537 LIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKY 596
           LI+ PYILT A +SP++YF+R R+  W  V          +    + +V    I+  T+ 
Sbjct: 489 LIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTN-TIRLNTRT 547

Query: 597 ASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLR 640
           ASETPLMF Y +E  I T E +++A++ NTG + FA+ D++SL+
Sbjct: 548 ASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  411 bits (1057), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/505 (42%), Positives = 310/505 (61%), Gaps = 23/505 (4%)

Query: 145 EFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSF 204
           + K   +DP VV P   N+L E+YF LF L V + FPH FL+PDFQDL Y  DW+KG  F
Sbjct: 102 QLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQ-F 160

Query: 205 TGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLWQLQKLISVINTRMCERAFVSARL 264
             P YR+ +   DD S   +  L S  +  LQP LLWQ QK ++V N+  C R +V+AR 
Sbjct: 161 LKPAYRVKFENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARY 220

Query: 265 FTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKN 324
            T  LEPQ+  KL +S+HL+E LP+FIKSLA D+E+CPG      + LFIS+A + P   
Sbjct: 221 LTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHS--VKELFISTAYYKPVSE 278

Query: 325 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENT 384
             P+ET +SL HF+PEEYD+N+YKMFN LLYP+                ED E  + +N+
Sbjct: 279 PEPIETLVSLLHFMPEEYDTNIYKMFNALLYPD--------------SNEDAEMDDIQNS 324

Query: 385 LKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARI 444
           L  +AP++TI+F+E++ +TE  TLP+GVD+PLEFYPQLYT+  K+ LI+ V      ++ 
Sbjct: 325 LGNLAPMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQT 384

Query: 445 RSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPNDANNKAARQ-----IASLKDTLNS 499
           ++R++L+ +N+LKS+QGK I + L S L ++    +  + ++  Q     +  +K  L S
Sbjct: 385 QARSILRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGS 444

Query: 500 TRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNR 559
            ++ KM +YK ++ +++ E +LSHPE  II+ AK L LI+ PY+LT A +S  +YF+R  
Sbjct: 445 KKTEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQN 504

Query: 560 NGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVS 619
           NG W  V   +      +    + S V  AI+  T+ ASE+PLMF Y +   I TE +V 
Sbjct: 505 NGQWFHVVGRSNSEHMDVTKTDA-STVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVK 563

Query: 620 KALQNNTGCSKFAKDDENSLRTLRS 644
           +A+ +N G   FA+ D+  + TL +
Sbjct: 564 EAVGHNKGAKLFAEQDQKHINTLSA 588

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%)

Query: 2  MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQA 47
          M   A++SLL+MGI  EVA++AL +T G++E +VN+IFS ELP+Q 
Sbjct: 1  MSENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG 46

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  399 bits (1024), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 323/524 (61%), Gaps = 16/524 (3%)

Query: 129 SETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPD 188
           S+    PP Y+       K   DDPTV+L L  + L+ +YFGLF++ ++++ P +F+ PD
Sbjct: 154 SQQIFVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPD 213

Query: 189 FQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATS--EIVLASGSSDD-----LQPRLLW 241
           F +LN++ +W KG     P+Y + Y    +       EIV A   S+       QP +LW
Sbjct: 214 FVNLNFNDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILW 273

Query: 242 QLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMC 301
           QLQK+IS++N+++  RA++S+ +++L L+   + KL ++ HLY++LPTFI+SL  D +  
Sbjct: 274 QLQKVISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHV 333

Query: 302 PGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEND 361
           P +     +N+F+S A H    ++ P +  L LFHFLPEEYDSNLYKMFN LLY     D
Sbjct: 334 PDLDQNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLY--RSYD 391

Query: 362 EEDATRNGGGGQED-----EEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPL 416
           E    R      +      E   E E++L E++ +LT++F+EL+ +TE +T P+GV+IP 
Sbjct: 392 EPIYPRTNQNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPF 451

Query: 417 EFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQ 476
           EFYP+LYTK+CK++LI  ++  R Q +++ + +L ++N+LKS++GK+I   L STL YLQ
Sbjct: 452 EFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQ 511

Query: 477 ASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLR 536
               +       +++ +K+ L+  ++ KM EYK ++  +  EW++  PE  II+ A+ L 
Sbjct: 512 RDGKEG--PMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLG 569

Query: 537 LIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKY 596
           LI +P++L +A LSPY YF R+R   W   QS+ +GT+F+I    S   VQ+ IK  TK 
Sbjct: 570 LIGDPHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKS 629

Query: 597 ASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLR 640
           ASETP+MF+YC++  IP +  V +    N GCS FA+ DE SL+
Sbjct: 630 ASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSLK 673

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 13 MGIPHEVAMDALHRTGGNLEAAVNFIF 39
          MGI  +VA   L++ GGNLEAA+N IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  361 bits (927), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/497 (40%), Positives = 298/497 (59%), Gaps = 61/497 (12%)

Query: 143 QNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGS 202
           Q+  K  V DPTVV+PLP +SL E+YF LF+L +  Y PH+  KP+  DL Y+P W +GS
Sbjct: 109 QSPKKSLVTDPTVVIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGS 167

Query: 203 SFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLWQLQKLISVINTRMCERAFVSA 262
           S                              D     + QLQ+L SV+N    +R +VSA
Sbjct: 168 S------------------------------DPSTSFIQQLQRLCSVVNASFSDRCYVSA 197

Query: 263 RLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPN 322
           +LF   L+  LK KLA++EHL+EVLP+FI+SL   LE C    + + R+LF+SSAL +  
Sbjct: 198 KLFAAVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSALSSEC 257

Query: 323 KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPE 382
           K      + LS+  F+PEEY+S+LY MFN LLYPE E  EE                   
Sbjct: 258 K------SLLSVLQFMPEEYESSLYAMFNALLYPELEEGEESG----------------- 294

Query: 383 NTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQA 442
           N+L ++APVLTI+F+E++ +TE +T   GVD+PLEFYPQLYTK  KD ++R +  +RK A
Sbjct: 295 NSLLDLAPVLTIVFDEMDADTE-VTSNRGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAA 353

Query: 443 RIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPNDANNKAARQIASLKDTLNSTRS 502
           + RSR +L E+N LKSYQGK+    + STL YLQ   ++ + +   ++ SLK+++   ++
Sbjct: 354 QERSRQVLAEMNGLKSYQGKDTLKFINSTLDYLQR--DNQSKEIIDKLESLKNSIADHKT 411

Query: 503 AKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV 562
            +  EYK+L+ K+HGEW+LSHP T++I  A +  LI+ PY+L +  LSP  Y  R+R+G 
Sbjct: 412 QRKNEYKELSQKLHGEWNLSHP-TYLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSGQ 470

Query: 563 WSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKAL 622
           W  +++++     +I +C +PS VQ  I+  T + S+TPLM +Y +   +  +  VSK+L
Sbjct: 471 WKMIRTDS--NMIRISDC-APSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSL 527

Query: 623 QNNTGCSKFAKDDENSL 639
           ++N G + F + D+  L
Sbjct: 528 ESNEGITNFLRIDQEEL 544

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  362 bits (929), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/498 (38%), Positives = 300/498 (60%), Gaps = 26/498 (5%)

Query: 167 SYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIV 226
           +Y  LFA  V+ Y P  F++ DF++LNY  +W+ G +   P   ++   AD GS   +IV
Sbjct: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGS--RQIV 233

Query: 227 LASGSSDD--LQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLY 284
                + D  +QP +LWQLQ++ISV ++++ ER++VSA++FT   + +++S + DS+HLY
Sbjct: 234 PEEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLY 293

Query: 285 EVLPTFIKSLAVDLEMCPGIR-DRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYD 343
           E LP+FIKS+  D EMCP    + + +++F+SSA+    +   P ETFL LFHF PEEY+
Sbjct: 294 EALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYN 353

Query: 344 SNLYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNT 403
           +NLYKMFN LLYPE   D+     +      ++   + E +LKE+AP+LTI+FNE +   
Sbjct: 354 ANLYKMFNALLYPE---DDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQ 410

Query: 404 ES-------MTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNL 456
            S       +  P GV++P  FYPQLYT+  K+Q+++ ++ +RK AR   R  L  +N L
Sbjct: 411 LSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQL 470

Query: 457 KSYQGKNISTVLESTLAYLQASP---------NDANNKAARQIASLKDTLNSTRSAKMEE 507
           KSY+GK     LE     L   P          +   +  +++ S+K  LN  R+   ++
Sbjct: 471 KSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQ 530

Query: 508 YKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV--WSW 565
           Y DL++K+  EW++S+PE  +I  AK+L L++ P++L++  LSPY Y +R+ +G   W+ 
Sbjct: 531 YVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTL 590

Query: 566 VQSNALGTEFKIKNCPSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNN 625
           VQSN+ GT+  I    +   VQ+ I+  TK A++ PLMFIYC E    ++EE   A++ N
Sbjct: 591 VQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKN 650

Query: 626 TGCSKFAKDDENSLRTLR 643
            GCS+F K D+  L T R
Sbjct: 651 MGCSEFNKADQLYLLTHR 668

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (78%)

Query: 3  DNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELP 44
          +  AV SL EMGIP +VA+DAL R  GNL AAVN+IFSN++P
Sbjct: 4  EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP 45

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  357 bits (917), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 239/655 (36%), Positives = 353/655 (53%), Gaps = 84/655 (12%)

Query: 7   VKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRISENRMM 66
           V+SLLEMGI  +VA  AL    G++EAA+N+IF+                 P   +N  M
Sbjct: 7   VQSLLEMGIARDVAEQALRECNGDVEAALNYIFNT----------------PNEIDNDAM 50

Query: 67  AGSNSYDVPNSGDQEDIDMXXXXXXX----XXXXXXXXXXITENHSGSSSSNERGPAARD 122
           AG     VP  G Q   D                      + EN   ++  ++    +  
Sbjct: 51  AGQQMGSVP-VGTQGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDS 109

Query: 123 YDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFPH 182
               S+ ++        I QQ  FK  +D PTVV+P P       Y  LFAL +S++ PH
Sbjct: 110 DSSSSLEQSQYTSIDDLIPQQ--FKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPH 167

Query: 183 VFLKPDFQD--LNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLL 240
            F+K D  D  L +SPDWF              RE +D                 +P L+
Sbjct: 168 YFVKADHDDMPLLFSPDWFNDID----------REPED-----------------EPLLV 200

Query: 241 W--QLQKLISVINTR-MCERAFVSARLFTLSLEPQLKSK---LADSE--HLYEVLPTFIK 292
              QL KLI+V N+     RAFV++++F + L+  ++S    L +    HLY++LP+FIK
Sbjct: 201 LRDQLHKLIAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIK 260

Query: 293 SLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNV 352
           ++A +L           +NLFISSA+    +     E+ LSLFHFLPEEY+SNLYKMFNV
Sbjct: 261 TIA-NLSYT-------EKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNV 312

Query: 353 LLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGV 412
           LLYP++++D          G++++E +E  N+LKE+APV+TI+FNE E   E+  + NGV
Sbjct: 313 LLYPDDDHD---------IGEDEDEVSE--NSLKELAPVMTIIFNEAENIDENAPVTNGV 361

Query: 413 DIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTL 472
           ++PL+FYPQLYTK+CKDQLI HV+SKRK  R   + +L++I NLKSYQGK+I + + S+L
Sbjct: 362 EVPLKFYPQLYTKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSL 421

Query: 473 AYLQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTA 532
            YL    +D+    A ++  LKD L + ++ KM  YK ++ K+H EW++ +PE  I++TA
Sbjct: 422 DYLTKDKDDSG--IAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETA 479

Query: 533 KQLRLIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGT---EFKIKNCPSPSVVQEA 589
            +L LI+ PY L LA +SP+ YF+RNR   W  V+ N   T   +  +  C  P  V + 
Sbjct: 480 TKLGLIDEPYFLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQH 539

Query: 590 IKHGTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRS 644
           +K+ T   + TPLMF+Y ++  +  + E+ + L  N     F K D+  L+   +
Sbjct: 540 VKNSTTVPNSTPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFEN 594

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  347 bits (889), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/513 (36%), Positives = 303/513 (59%), Gaps = 54/513 (10%)

Query: 147 KCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFP-HVFLKPDFQDLNYSPDWFKGSSFT 205
           K  + DPTV+LPL  N L+E+Y  LF   + +  P  +F    F DL Y+  W+      
Sbjct: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS----- 232

Query: 206 GPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLWQLQKLISVINTRMCERAFVSARLF 265
                                +++ + +     L  QLQ++ S+IN+RM ERAF+S ++F
Sbjct: 233 ---------------------ISNNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMF 271

Query: 266 TLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNE 325
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325

Query: 326 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE--ENDEEDATRNGGGGQEDEEFAEPEN 383
               + +S+ +FLPEEY+SNLYKMFN L+YP E   ND+E +        +D+     ++
Sbjct: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDE-SLQTDDDDNDDANDS 384

Query: 384 TLKEVAPVLTILFNEL-ETNTESMTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQA 442
            L+E++P+ TILF E  E+++ S TLP GV+IPL+FYPQLY+K+  DQLI+H+ISKRK+A
Sbjct: 385 ALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEA 444

Query: 443 RIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPNDANNKAARQIASLKDTLNSTRS 502
           + +SR+LL EIN+LKS+QGK+I  +L+ST+ Y++   +    K+A  + ++   + + ++
Sbjct: 445 QSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD-SQRETKSANNLTNILTEMKNCKN 503

Query: 503 AKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGV 562
            KM++YK+L  K+H EW+LSHPE  II+TAKQL LI++PY L++   SP  Y ++  N  
Sbjct: 504 LKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVD 563

Query: 563 WSWVQSNALGTE----------------FKIKNCPSPSVVQEAIKHGTKYASETPLMFIY 606
           W  +   ++                   F ++ C S   +Q+ IK  T+  SETPLMFIY
Sbjct: 564 WYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIY 623

Query: 607 CEEGKIPTEEEVSKALQNNTGCSKFAKDDENSL 639
           C+E  +P E++V K+ ++N  C+KF K+D+ +L
Sbjct: 624 CKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/501 (32%), Positives = 261/501 (52%), Gaps = 39/501 (7%)

Query: 156 VLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYRE 215
           +LP   ++L+ESYF LFAL ++V  P  FL  DF++L Y+P WFKG       YRL +R 
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGE-LVQSDYRLVHRN 115

Query: 216 ADDGSATSEIVLASGSSD-DLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLK 274
           A  G         +GS   ++QP L+ ++Q LI + N     R FV++ L     +  + 
Sbjct: 116 A--GPLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVS 173

Query: 275 SKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSL 334
             L++ +HL EV P FIK+L  D+++C    D+ T  LF+S ALH PN  EP   T LS+
Sbjct: 174 RALSECDHLSEVFPQFIKNLHNDMDLCLK-DDKSTSKLFLSKALHRPNVLEPFQPTSLSV 232

Query: 335 FHFLPEEYDSNLYKMFNVLLYPEEENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTI 394
            +F PE Y   LY+MFN +L PE+           G G       E EN    +APV TI
Sbjct: 233 LNFSPENYAYTLYEMFNPMLLPED----------SGRG------YEIENAFDFLAPVFTI 276

Query: 395 LFNELETNTESMTLPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEIN 454
           +F++++  TE + L +GV IP+EFYPQLYTK   ++++  V+ +    R  ++  + +++
Sbjct: 277 IFDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMS 336

Query: 455 NLKSYQGKNISTVLESTLAYLQASP---NDANNKAARQIASLKDTLNSTRSAKMEEYKDL 511
           +L+S+QGK IS+ L S++ YL+  P    D + +    +  +K  L++ +   M +Y + 
Sbjct: 337 SLQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTET 396

Query: 512 ASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFL-----RNRNGVWSWV 566
             ++        P   II  AKQ+ +I+ PY+L L   SP  Y +      +        
Sbjct: 397 QRQI-DLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMET 455

Query: 567 QSNALGTEFKIKNCPSPSVVQEAI---------KHGTKYASETPLMFIYCEEGKIPTEEE 617
            +N L     I    S S+ QE +         K  T++ASETP++F+Y ++  I   ++
Sbjct: 456 GNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQD 515

Query: 618 VSKALQNNTGCSKFAKDDENS 638
           +  ++  N   + F K++  +
Sbjct: 516 ILASISENETLTNFLKEEHTT 536

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           Q +K L+++G P +  + AL +TGGN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 7   VKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           +K L+++G P    + AL+RTGGN E A   +F
Sbjct: 429 IKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 5   QAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           Q +K L+++G P +  + AL +T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 5   QAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           Q +K L+++G P +  + AL +T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 3   DNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSN-ELPE 45
           D   V S++ MG     A+ AL+ TG  +E A+N+IF + E PE
Sbjct: 584 DEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPE 627

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 25/33 (75%)

Query: 7   VKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           +K L+++G   + A++AL++TGGN++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 6    AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
            AV+ L  MG   E A +AL R+  +LEAA NF+ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>TBLA0H00570 Chr8 (116301..119630) [3330 bp, 1109 aa] {ON} Anc_8.440
           YLR219W
          Length = 1109

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%)

Query: 421 QLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPN 480
           QLY    K ++    + + K +   S + L+    LKS    N S     T   LQ S N
Sbjct: 535 QLYNNLPKKKITSMRVKETKTSIPSSNSTLRTGKQLKSKARHNDSRTSSFTNNELQLSNN 594

Query: 481 DANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQL 535
             N KAA    ++K T+ ST S +++    + + +        P+  + KT  Q+
Sbjct: 595 KENRKAAPSKKNIKTTMTSTTSQRLKSTSTVPNNISNSQQPGKPKIVVSKTTNQI 649

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 35/58 (60%), Gaps = 6/58 (10%)

Query: 2   MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSN-----ELPEQADTGGEGG 54
           ++ +++ S++ MG+   ++  AL    G++ A++ ++F+N     ELPE+ +T  +G 
Sbjct: 640 INEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEE-NTASQGA 696

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 6    AVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSN 41
            A++ L  MG   E A+ AL +   +LEAA NF+  N
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLLDN 1268

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 7   VKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIF 39
           +K + ++G     A++AL+RTGGN E A   +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>Kpol_1048.5 s1048 complement(22179..27086) [4908 bp, 1635 aa] {ON}
           complement(22179..27086) [4908 nt, 1636 aa]
          Length = 1635

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 210 RLAYREADDGSATSEIVLASGSSDDLQPRLLWQLQKLISVINTRMCERAFVSARLFTLSL 269
           RL     D G      + +S +S+D +   L  L KLIS I   M + ++VS ++     
Sbjct: 86  RLVEVSKDSGRIGKMFIASSSTSNDEEVSKLISLMKLISSIEEEMYKYSWVSGKIMVKDQ 145

Query: 270 EPQLKSKLADSEHLYEV 286
           +  LK +L   ++ YEV
Sbjct: 146 KSILKHRLK--KYKYEV 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,982,431
Number of extensions: 3289209
Number of successful extensions: 10524
Number of sequences better than 10.0: 59
Number of HSP's gapped: 10757
Number of HSP's successfully gapped: 68
Length of query: 678
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 562
Effective length of database: 40,180,143
Effective search space: 22581240366
Effective search space used: 22581240366
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)