Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3015.474ON62562531660.0
YOR137C (SIA1)5.474ON62262525960.0
Smik_15.3175.474ON62662525900.0
Suva_8.1895.474ON62662525150.0
TDEL0A033805.474ON55962613151e-175
NCAS0H022605.474ON57064411481e-150
NDAI0C014005.474ON70564410961e-140
TBLA0A025505.474ON57859710191e-130
SAKL0G03542g5.474ON5746079211e-116
KLTH0F15026g5.474ON5746178721e-108
Kwal_55.212685.474ON5686028251e-101
KLLA0E03147g5.474ON5786025412e-60
Ecym_24554.200ON5723482864e-26
YLR361C (DCR2)4.200ON5783482482e-21
KNAG0B058604.200ON5853592456e-21
SAKL0B05038g4.200ON5903532366e-20
NCAS0J012204.200ON5833512367e-20
ZYRO0B07898g4.200ON5833562296e-19
Skud_12.4454.200ON5813692232e-18
Smik_12.4484.200ON5803432181e-17
KLLA0B13134g4.200ON5653382171e-17
Suva_10.4624.200ON5813402171e-17
TDEL0E017304.200ON5743652125e-17
Kpol_472.154.200ON5293252109e-17
KAFR0A062104.200ON5813552082e-16
TBLA0D020204.200ON6433582082e-16
TPHA0F011004.200ON5583432054e-16
KLTH0E10824g4.200ON5804282045e-16
Kwal_55.203334.200ON5773302021e-15
NDAI0J019704.200ON5893411983e-15
CAGL0B02761g4.200ON5783741922e-14
ABL009W4.200ON5693491885e-14
ZYRO0D13156g5.554ON65083724.3
KLTH0E07062g8.126ON149633716.0
KNAG0F021906.176ON111480707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.301
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {...  1224   0.0  
YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON} ...  1004   0.0  
Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {...  1002   0.0  
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...   973   0.0  
TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {O...   511   e-175
NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {O...   446   e-150
NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474    426   e-140
TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.4...   397   e-130
SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {...   359   e-116
KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} simi...   340   e-108
Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137...   322   e-101
KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {...   213   2e-60
Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}...   114   4e-26
YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON} ...   100   2e-21
KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa] ...    99   6e-21
SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {...    96   6e-20
NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {...    96   7e-20
ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} simila...    93   6e-19
Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {...    91   2e-18
Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {...    89   1e-17
KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} simi...    88   1e-17
Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {...    88   1e-17
TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.2...    86   5e-17
Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON} (43361..4...    86   9e-17
KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON} Anc_4...    85   2e-16
TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.2...    85   2e-16
TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {O...    84   4e-16
KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} simila...    83   5e-16
Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361...    82   1e-15
NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {...    81   3e-15
CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} simila...    79   2e-14
ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic ho...    77   5e-14
ZYRO0D13156g Chr4 complement(1106020..1107972) [1953 bp, 650 aa]...    32   4.3  
KLTH0E07062g Chr5 complement(648999..653489) [4491 bp, 1496 aa] ...    32   6.0  
KNAG0F02190 Chr6 (418793..422137) [3345 bp, 1114 aa] {ON} Anc_6....    32   7.8  

>Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {ON}
           YOR137C (REAL)
          Length = 625

 Score = 1224 bits (3166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/625 (95%), Positives = 595/625 (95%)

Query: 1   MRLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60
           MRLHNRRKVN                SRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC
Sbjct: 1   MRLHNRRKVNFLRRILFILCIFLLYLSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60

Query: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120
           YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH
Sbjct: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120

Query: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180
           MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK
Sbjct: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWK 240
           LLFGISVDSDDIAVFGEEWVYKGSGIWCKF              EIYLGSSFIESRPFWK
Sbjct: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFILNDDDNDPPIINLEIYLGSSFIESRPFWK 240

Query: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300
           EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI
Sbjct: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300

Query: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360
           TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD
Sbjct: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360

Query: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420
           LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI
Sbjct: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420

Query: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480
           ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI
Sbjct: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540
           GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD
Sbjct: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540

Query: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600
           ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD
Sbjct: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600

Query: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625
           EITSWKRNSIIVDEVYDYQYIYKGE
Sbjct: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625

>YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON}
           SIA1Protein of unassigned function involved in
           activation of the Pma1p plasma membrane H+-ATPase by
           glucose
          Length = 622

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/625 (75%), Positives = 541/625 (86%), Gaps = 4/625 (0%)

Query: 1   MRLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60
           MRLH RR+ N                SRDSL+L+ KNV ++  +AEY+GG IDDIQILRC
Sbjct: 1   MRLHYRRRFNFLRRILFILCITSLYLSRDSLKLHAKNVLMDHNVAEYHGGMIDDIQILRC 60

Query: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120
           YHWYRQC SLYAP+LHPS +A+++KDK+S+LW+RVSKNITVE+LYSLQSG FYNSYLYVH
Sbjct: 61  YHWYRQCSSLYAPKLHPSNTAKKIKDKNSILWTRVSKNITVETLYSLQSGPFYNSYLYVH 120

Query: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180
           +K FQ N KN+IKELA+ARDSALIPLQVLRDINK+VKSSDSSVFHNHVY REKPTSSWWK
Sbjct: 121 LKDFQSNPKNTIKELAIARDSALIPLQVLRDINKLVKSSDSSVFHNHVYLREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWK 240
           LLFGISVD+D+IAVFGEEWVYKGSGIWCK+              EIYLGSSFIESRP WK
Sbjct: 181 LLFGISVDTDNIAVFGEEWVYKGSGIWCKYILNDDDNDAPITNLEIYLGSSFIESRPSWK 240

Query: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300
           EVIHEFHRNN+PS+PISITRK ETKN H+K+ N L GSL  P K+ +    +Q D DY+I
Sbjct: 241 EVIHEFHRNNIPSLPISITRKLETKNHHHKFSNGLLGSLRTPSKDIN----IQVDADYKI 296

Query: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360
           TS HIQ+S GQRSFKILQ+TDFHFKCTDNSM++INEI+TVNFIDRVLA E PDLVVITGD
Sbjct: 297 TSPHIQFSRGQRSFKILQITDFHFKCTDNSMTVINEIKTVNFIDRVLASENPDLVVITGD 356

Query: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420
           LLDS N++DYQTCIMK+VQPMISN++PYAISLG SDESN AT +QI+DFI NLPY FNN+
Sbjct: 357 LLDSHNTIDYQTCIMKVVQPMISNKIPYAISLGVSDESNLATSAQIRDFIRNLPYTFNNV 416

Query: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480
           AS+EGHMAI+VSF KKL+KN LLE+ +D  +ET+P+EALFFVFDSF PVN+FL DY+DLI
Sbjct: 417 ASEEGHMAIEVSFKKKLTKNTLLERDIDTEDETNPSEALFFVFDSFAPVNNFLQDYNDLI 476

Query: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540
           GKID+GLAFQYFPLSEYRP GLFPIIGQYNE+STLTV+T R +G+VSMTINGKHY+SFLD
Sbjct: 477 GKIDFGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTPRSRGQVSMTINGKHYKSFLD 536

Query: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600
           ILSLWN+KGV CGHEHNNDCCLQSKN+MWLCYGGSAGI LPRI+GIYP VRLFN+DDI+D
Sbjct: 537 ILSLWNIKGVSCGHEHNNDCCLQSKNEMWLCYGGSAGIGLPRIQGIYPTVRLFNLDDILD 596

Query: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625
           EITSWKRNS +VDEVYDYQYIYKG+
Sbjct: 597 EITSWKRNSNLVDEVYDYQYIYKGK 621

>Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/625 (77%), Positives = 546/625 (87%)

Query: 1   MRLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60
           MRLH RRK N                SRDSL+L+ KN  INP  AEY+ G IDDIQ+LRC
Sbjct: 1   MRLHYRRKFNFLRRVLFILSIISLYLSRDSLKLHAKNALINPNTAEYHEGMIDDIQVLRC 60

Query: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120
           YHWYRQCGSLYAPRLHPS +A +VKDK++VLWSRVSKNIT+E+LYSLQSG FYNSYLYVH
Sbjct: 61  YHWYRQCGSLYAPRLHPSNTASKVKDKNNVLWSRVSKNITIEALYSLQSGAFYNSYLYVH 120

Query: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180
            K FQ NS+NSIKELA+ARDSALIPLQVLRDINKMVKSSDSSVFHNHVY+REKPTSSWWK
Sbjct: 121 PKGFQSNSRNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQREKPTSSWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWK 240
           LLFGISVDSDDIAVFGEEWVYKGSGIWCK+              EIYLGSSFIESRP WK
Sbjct: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKYVLNDDDSDPPIISLEIYLGSSFIESRPSWK 240

Query: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300
           EV+HEFHRNN+PS+PISITRK +TKN  +K   +L G L+AP+K+N+ L LLQ D +Y+I
Sbjct: 241 EVMHEFHRNNIPSLPISITRKLKTKNNLHKASKRLTGPLKAPEKDNNILELLQVDGNYKI 300

Query: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360
           TS HIQ+S GQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALE PDLVVITGD
Sbjct: 301 TSPHIQFSRGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALENPDLVVITGD 360

Query: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420
           LLDSQN++DYQTCIMKLVQPMISN++PYAISLG SDESN AT SQ++D+I NLPY FN++
Sbjct: 361 LLDSQNTIDYQTCIMKLVQPMISNKIPYAISLGVSDESNLATPSQVQDYIRNLPYTFNSV 420

Query: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480
           AS+EGH+AI+VSF KKL KN LL++ ++  +ET+P+EALFFVFDSFNPVNDFLLDYS+LI
Sbjct: 421 ASEEGHIAIRVSFKKKLLKNTLLKRGINAKDETTPSEALFFVFDSFNPVNDFLLDYSNLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540
           GKIDYGLAFQYFPLSEYRP GLFPIIGQYNE+STLTV+TSR KGEVSMTI+GK+Y+SFLD
Sbjct: 481 GKIDYGLAFQYFPLSEYRPHGLFPIIGQYNERSTLTVDTSRSKGEVSMTIDGKNYKSFLD 540

Query: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600
           IL+LWN+KGV CGHEHNNDCCLQS N+MWLCYGGSAGID+ RIEGI+PNVRLFN+DDI D
Sbjct: 541 ILNLWNIKGVSCGHEHNNDCCLQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKD 600

Query: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625
           EITSWKR+S +VDEVYDYQYIYKG+
Sbjct: 601 EITSWKRSSNLVDEVYDYQYIYKGK 625

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/625 (74%), Positives = 529/625 (84%)

Query: 1   MRLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60
           MRLH RRK N                SRDSL LN KN  ++P + EY+GG IDDIQ+LRC
Sbjct: 1   MRLHYRRKFNFLRRILFILCIFSLYLSRDSLSLNAKNTLLSPNLTEYHGGLIDDIQVLRC 60

Query: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120
           Y WYRQCGSLYAPRL PS + ++ K+K +VLW+RVSKNI+VE +YSLQ+G FYNSYLYVH
Sbjct: 61  YCWYRQCGSLYAPRLQPSGAGKKAKEKKNVLWNRVSKNISVEPMYSLQTGIFYNSYLYVH 120

Query: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180
            K+ Q   KNSIKELA+ARDSALIPLQVLRDINKMVKSSDSSVFHNHVY+R+KPTS WWK
Sbjct: 121 AKNIQSKLKNSIKELAIARDSALIPLQVLRDINKMVKSSDSSVFHNHVYQRDKPTSPWWK 180

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWK 240
           LL GI+VDSDDI+VFGEEWVYKG+GIWCK+              EIYLGSSFIESRP WK
Sbjct: 181 LLLGIAVDSDDISVFGEEWVYKGNGIWCKYILNNDGNDLPIVDLEIYLGSSFIESRPNWK 240

Query: 241 EVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRI 300
           EVIHEFHRNN+PS+PISITRK  T    +   N LPG L++P+  N+ LRLLQ DEDYRI
Sbjct: 241 EVIHEFHRNNIPSLPISITRKINTPRTRHGPLNGLPGPLKSPENENNILRLLQVDEDYRI 300

Query: 301 TSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360
           TS HIQ+S GQRSFKILQMTDFHFKCT+N M+IINEIRTVNFIDR+LALE PDLVVITGD
Sbjct: 301 TSPHIQFSKGQRSFKILQMTDFHFKCTENGMTIINEIRTVNFIDRMLALENPDLVVITGD 360

Query: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420
           LLDS NSMDYQTCIM+LVQPMISN++PYAISLGASDES  A+L QIKDFI NLPY+FN++
Sbjct: 361 LLDSANSMDYQTCIMRLVQPMISNKIPYAISLGASDESKLASLPQIKDFISNLPYSFNHV 420

Query: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI 480
           A++EGHMAI+VSF KKL K+AL E+  D   E+SP+EALFF+FDSFNPV DFLLDYS+LI
Sbjct: 421 ATEEGHMAIQVSFKKKLLKHALFERETDAKYESSPSEALFFIFDSFNPVGDFLLDYSNLI 480

Query: 481 GKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLD 540
           GKIDYGL FQYFP+SEYRP GLFPIIGQYNE+STLTV+T+R KGEVSMTI GKHY SFLD
Sbjct: 481 GKIDYGLTFQYFPISEYRPHGLFPIIGQYNERSTLTVDTARSKGEVSMTIGGKHYNSFLD 540

Query: 541 ILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMD 600
           IL+LWN+KGV CGHEHNNDCCLQSKN+MWLCYGGSAG+D+ R+EG+YPNVRLFN+DDIMD
Sbjct: 541 ILNLWNVKGVSCGHEHNNDCCLQSKNEMWLCYGGSAGMDVSRMEGLYPNVRLFNLDDIMD 600

Query: 601 EITSWKRNSIIVDEVYDYQYIYKGE 625
           EITSWKR+S +VDEVYDYQYIYKG+
Sbjct: 601 EITSWKRSSNLVDEVYDYQYIYKGK 625

>TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {ON}
           Anc_5.474 YOR137C
          Length = 559

 Score =  511 bits (1315), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 277/626 (44%), Positives = 379/626 (60%), Gaps = 73/626 (11%)

Query: 2   RLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRCY 61
           RL +RR +                 SR S  ++ +N F  P  +EY GG IDD+Q +RCY
Sbjct: 4   RLRHRRIITILRRLAIASFFLLAYSSRSSFIIHLQNTFNVPTTSEYRGGLIDDVQSIRCY 63

Query: 62  HWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVHM 121
            W+ QC SL A         +R  D   V WSR+SKN+T ESLYS+++  FY +YLYVH 
Sbjct: 64  RWFGQCRSLIA--------KQRSSDDRIVSWSRISKNLTDESLYSIETSFFYKTYLYVH- 114

Query: 122 KSFQGN-SKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPTSSWWK 180
             + G+ +   I ELA++RDS++IP+QV +D+ +++K+SDSSVFHNHV+R  +P   ++ 
Sbjct: 115 -EWDGSVNPGPISELAISRDSSMIPIQVTQDVQRLIKTSDSSVFHNHVHRERRPIIDFFT 173

Query: 181 LLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWK 240
                  DSD I   GE+W YKG GIWCK               ++YLGS F+ESRP WK
Sbjct: 174 RDHS---DSDIIHSLGEDWKYKGGGIWCK----HRSDQDPITNIQLYLGSGFLESRPNWK 226

Query: 241 EVIHEFHRN-NMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYR 299
           EVIHE+ RN    S  IS+TR  E  N H K      G      K++D LR+        
Sbjct: 227 EVIHEYSRNKGHKSQLISVTR--EINNGHEK------GEQSVIIKDDDVLRIS------- 271

Query: 300 ITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITG 359
             S H    +G +S KILQ++D HF+C+++++++++E +T +FI  V++ E+PDLVV+TG
Sbjct: 272 -LSPH----YG-KSLKILQISDIHFRCSEDTIAVLSEFQTKHFISNVISRERPDLVVVTG 325

Query: 360 DLLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNN 419
           D LD  NS+DYQ CIMKLVQPMI ++ PYAI+ G SD S FA +SQI+DFI  LPY+ N 
Sbjct: 326 DFLDGDNSLDYQACIMKLVQPMIKSKTPYAITTGVSDYSRFAAISQIQDFIKGLPYSLNR 385

Query: 420 IASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFLLDYSDL 479
            AS EGH+AI   F+K                     +A  ++ DSF+PV  F     D 
Sbjct: 386 YASPEGHLAISSHFSKG-------------------TDAAIYILDSFHPVKQFFSMQKDY 426

Query: 480 IGKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFL 539
                Y LAF++ P+ EYRP G+FPIIGQYNE+S +           S   + K  +   
Sbjct: 427 -QTYRYALAFRHLPIPEYRPEGVFPIIGQYNEQSIVK----------SKLFDDKILQK-- 473

Query: 540 DILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIM 599
            I+  +N+K + CGHEH+NDCCLQS+ DMWLCYGGSAGI + R+ G+ P+VRLFN+D  +
Sbjct: 474 -IMYSFNVKAMSCGHEHSNDCCLQSRGDMWLCYGGSAGIGIDRMNGMEPSVRLFNIDGDL 532

Query: 600 DEITSWKRNSIIVDEVYDYQYIYKGE 625
           DE+TSWKRN  +++ VYDYQYIY+G+
Sbjct: 533 DEVTSWKRNFRLIESVYDYQYIYQGQ 558

>NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {ON}
           Anc_5.474
          Length = 570

 Score =  446 bits (1148), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/644 (40%), Positives = 359/644 (55%), Gaps = 93/644 (14%)

Query: 1   MRLHNRRKVNXXXXXXXXXXXXXXXXSRDSLRLNTKNVFINPKIAEYNGGTIDDIQILRC 60
           MRL  RR V                 S  SLR + KNVF      EY GG I DIQ + C
Sbjct: 1   MRLKTRRIVKTSQRLLQLLIFFILCNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPC 60

Query: 61  YHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVH 120
           ++WY+ CGS+                 +   W RVSKN++ ESLYS++SG F  S+LYV 
Sbjct: 61  FYWYQTCGSIIW---------------NDQKWLRVSKNLSDESLYSMESGPFSRSFLYVR 105

Query: 121 MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFHNHVYRREKPT--SSW 178
               Q   +  I ++A++ D  +IP+ V +DIN +++SSDSSV+HNH + ++  +  +SW
Sbjct: 106 ----QDTGEKPISDIAISSDPLMIPVHVTQDINNLLQSSDSSVYHNHKFHQKGSSWRASW 161

Query: 179 -WKLLFGISVDS------------DDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXE 225
            W    G  + S            DDI++ GE W YKG GIWCKF              E
Sbjct: 162 SWFWNSGKVLASHDHADDASDSTMDDISLRGENWKYKGYGIWCKFDNTKEIVANI----E 217

Query: 226 IYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKN 285
           I+LGS F+ESRP+W+EVIHEF  ++   +PISIT K  T               E  + N
Sbjct: 218 IFLGSLFLESRPYWREVIHEFKPDDKLPLPISITVKIATNVKE-----------ETGELN 266

Query: 286 NDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDR 345
           +  L++                      FKILQ++D HF+ + NSM ++ E +T+ FI  
Sbjct: 267 DGTLKM-------------------DSKFKILQVSDVHFRSSINSMPMLKEYQTMQFITN 307

Query: 346 VLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQ 405
            +  E P+LV++TGD+LDS NS+DYQTCIM LVQPMI  ++PY I+LG++D S +A+  Q
Sbjct: 308 TITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYASRDQ 367

Query: 406 IKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDS 465
           I +FI  LPY+    ++  GH+ I             L K  D   E S  E + +V DS
Sbjct: 368 IINFISTLPYSLTKFSTDNGHLIIP------------LHKFNDPKGEVSQDELMIYVIDS 415

Query: 466 FNPV-NDFLLDYSDLIGKI---DYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSR 521
           F+ + ND  + + ++  K    +Y LAF+  P+ +YRP GLFPIIGQYNE+++L +  + 
Sbjct: 416 FHSIEND--VKFKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELREN- 472

Query: 522 CKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGIDLP 581
               V   IN        D L    +K + CGHEHNNDCCLQSKN+MWLCYGGS G+   
Sbjct: 473 VGTAVGNVIN------LQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTK 526

Query: 582 RIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKGE 625
           R+EG++ NVRLF++D  + EITSWKRN  ++D VYDYQYIYK E
Sbjct: 527 RMEGLFANVRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKRE 570

>NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474
          Length = 705

 Score =  426 bits (1096), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 256/644 (39%), Positives = 354/644 (54%), Gaps = 104/644 (16%)

Query: 33  LNTKNVFINPKIAEYNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSVLW 92
            +T++  I+P   EY  G I DIQ LRCYHWY  C  L+                  +LW
Sbjct: 111 FSTRDSTIHP---EYEEGPILDIQRLRCYHWYSTCNVLW---------------HDGILW 152

Query: 93  SRVSKNITVESLYSLQSGTFYNSYLYV-----HMKSFQGNSKNS-------IKELAMARD 140
            R+ K+++ E LY+L+S  +Y+SY+YV     +M +   N  N        I E+AM+RD
Sbjct: 153 QRIKKDLSDEKLYALESTQYYDSYIYVKTLSANMDTLSPNIPNGSPHTLKRISEIAMSRD 212

Query: 141 SALIPLQVLRDINKMVKSSDSSVFHNHVYRR----EKPTSS------------------- 177
             +IP+QV+RD+NK+ KSSDSS+FH HV+ +      P  S                   
Sbjct: 213 PTIIPMQVIRDVNKLFKSSDSSMFHTHVFHQSGDEHDPVYSDNHAHNKNKDIDVHDDNSH 272

Query: 178 ---------WWKLLFGIS-VDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXXEIY 227
                     W  L  IS    DD+++ GE+W Y+GSGIWCK+              EIY
Sbjct: 273 MNGYQFLQQIWSWLLAISDSHDDDLSLMGEDWKYRGSGIWCKYENGVEMEPMIVNKLEIY 332

Query: 228 LGSSFIESRPFWKEVIHEFHRNNMP---SMPISITRKHETKNAHYKYPNKLPGSLEAPDK 284
           LGSSF E R  WKE+IHE+         S+PISITR+               G+   PDK
Sbjct: 333 LGSSFQEFRHNWKEIIHEYKTERDERDVSLPISITRQIGR------------GTKTDPDK 380

Query: 285 NNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFID 344
               + L++ + + +     +  ++G   FKILQ++D H+KC+D S+S + E +T NFI 
Sbjct: 381 ----IILIEKETEKKFG---LMTAFG---FKILQVSDLHYKCSDESISNLKEFQTNNFIK 430

Query: 345 RVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLS 404
           +V+  E P+L+VITGD+LD  N +DYQTCIMKLVQP I+ ++PY I LG SD S +A+  
Sbjct: 431 KVILREFPNLIVITGDILDGTNCVDYQTCIMKLVQPFINFEIPYLIMLGTSDYSRYASRE 490

Query: 405 QIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFD 464
            I  FI  LPY  N ++       + +          +  K  D+++   P   ++ V D
Sbjct: 491 SILQFIRTLPYCINKLSQNVNDTNVMI---------PIYNKYNDDDKVNDPYIMIYGV-D 540

Query: 465 SFNPVNDFLLDYSDLIGKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKG 524
           SFNP+++  +     + K DYGLAF+  P+ EYRP G+FPI+GQYNEKS+LT E      
Sbjct: 541 SFNPIDNTKMKNEGSV-KWDYGLAFRSLPIPEYRPEGMFPIVGQYNEKSSLTFEEFANND 599

Query: 525 EVSMTINGKH-----YESFLDILSLWNMKGVGCGHEHNNDCCLQSKNDMWLCYGGSAGID 579
           +     +G            D L   N++ + CGHEH+NDCCLQSKN MWLCY GS+G+D
Sbjct: 600 DSVDADDGGDGRWIGANKLQDFLISENVQVLSCGHEHSNDCCLQSKNKMWLCYDGSSGMD 659

Query: 580 LPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYK 623
           + R+E I+ +VRLF VD    EITSWKRNS  +D VYDYQYIYK
Sbjct: 660 VARLENIHASVRLFEVDTNAGEITSWKRNSNSIDNVYDYQYIYK 703

>TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.474
           YOR137C
          Length = 578

 Score =  397 bits (1019), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 224/597 (37%), Positives = 333/597 (55%), Gaps = 64/597 (10%)

Query: 31  LRLNTKNVFINPKIAEYNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSV 90
           LRL   NV   P   EYNGG IDDI++++CY WY+ C +LYA           V D S V
Sbjct: 30  LRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFV 81

Query: 91  LWSRVSKNITVESLYSLQSGTFYNSYLYVHMKSFQGN---SKNSIKELAMARDSALIPLQ 147
           LW+RVSKN+T  SLY+++S   Y ++ YVH+ +   N    K  + ++A++RD +L+PL 
Sbjct: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141

Query: 148 VLRDINKMVKSSDSSVFHNHVYRREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIW 207
           VL+++   ++SSDS + +  +Y ++   +SWW   +   + +        +W +    +W
Sbjct: 142 VLQEVMPSLRSSDSMMGNKRLYYQK---TSWWYRFWNNPLPTK--MNLMNKWKHNNDILW 196

Query: 208 CKFXXXXXXXXXXXXXXEIYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETK-N 266
            K               ++YLGS+F+ESRPFWKE+IHE H  +  S+PISITRK E   +
Sbjct: 197 SKIQHDSCLITNI----QLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFD 252

Query: 267 AHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKC 326
           A++ +P            N D L+L Q  +                  KILQ++D H K 
Sbjct: 253 ANHTFPKNTIN-------NKDLLQLKQKSD-----------------LKILQLSDIHIKG 288

Query: 327 TDNSMSIINEIRTVNFIDRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQV 386
            + + +I+ E ++  FI R++ +E+PDLVVITGD+LD   S+DYQTCI+ +VQP+I  Q+
Sbjct: 289 NEENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQI 348

Query: 387 PYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKR 446
           P+ IS GA D S +AT  +I DF+  +PY  N  +   GH+ I  +F+   +     + +
Sbjct: 349 PFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPN-----DSK 403

Query: 447 VDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI-GKIDYGLAFQYFPLSEYRPRGLFPI 505
            D +   +  +   F+F+S      F  DY  L        LAFQY P+  YR  G+FPI
Sbjct: 404 DDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPI 463

Query: 506 IGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSK 565
           IGQYNE++ L                  + ++ ++ +   N+K + CG +H+NDCCLQS 
Sbjct: 464 IGQYNERNLLPE-------------GFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSI 510

Query: 566 NDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIY 622
           +D+WLCY G+ G+  P    + P+VRLF VD+I   ITSWKRN   +DEVYDYQYIY
Sbjct: 511 HDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567

>SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {ON}
           similar to uniprot|Q12212 Saccharomyces cerevisiae
           YOR137C SIA1 Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 228/607 (37%), Positives = 319/607 (52%), Gaps = 91/607 (14%)

Query: 37  NVFINPKIAEYNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVS 96
           N F      +Y GG IDD++ ++CY WY  C ++Y          ++  +   + W RV 
Sbjct: 38  NTFKKGHDVQYQGGLIDDVRFIKCYRWYSHCDTIYD---------KQHSNGPLIQWKRVH 88

Query: 97  KNITVESLYSLQSGTFYNSYLYVH-MKSFQGNSKNSIKELAMARDSALIPLQVLRDINKM 155
           K +   +LY++ SG  Y++YLYVH  K     +  +I +LA+AR+  ++PL VL+D+N  
Sbjct: 89  KKMRDSNLYAINSGMLYSTYLYVHSAKKTTFGTTRAITDLAIAREKTVVPLHVLKDVNLQ 148

Query: 156 VKSSDSSVFHNHVYRREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXX 215
           ++SSD+SVFHNH Y +E    SW   +FG    S  ++V  E+W YK  GIWCK+     
Sbjct: 149 IRSSDNSVFHNHEYPQE---FSW--SIFGKG--SPTLSVDDEDWEYKSDGIWCKYSLIQE 201

Query: 216 XX-XXXXXXXEIYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETKNAHYKYPNK 274
                     +IYLG  FIESRP WKE IH   R  + ++  SIT +   KN        
Sbjct: 202 GSDDTALTNLQIYLGDDFIESRPMWKEAIHGKSRGRLAAL--SITSERFNKN-------- 251

Query: 275 LPGSLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSII 334
                E  D  + A  L                S   + FKILQ++D H+    + M + 
Sbjct: 252 -----ELVDNVHIANTL----------------SLKSQGFKILQLSDLHYS---SGMGVC 287

Query: 335 NE------IRTVNFIDRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQVPY 388
           NE       +T NFI  V+  EKPDLVVITGD+LD  N++DY+T ++K VQPM+S++ PY
Sbjct: 288 NEPPCLADFQTRNFISTVIDREKPDLVVITGDILDGVNTLDYETALLKAVQPMVSSRTPY 347

Query: 389 AISLGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVD 448
           AI+ G  D S  AT   I +FIG+LP+  N++ +      I +  +   + N  L   + 
Sbjct: 348 AIAFGLQDFSTQATKRDILEFIGSLPFCMNSVNNDSN--VINLDKHSFYTTNIALP--IH 403

Query: 449 NNEETSPAEALFFVFDSFN--PVNDFLLD--YSDLIGKID---YGLAFQYFPLSEYRPRG 501
             EE S    + +V DS +    + FL +   S L+ K     Y  AFQ+ P  EYRP G
Sbjct: 404 KGEEIS---GMVYVLDSTDVESQDSFLRNAHASALLSKHTKPMYSFAFQHLPTIEYRPTG 460

Query: 502 LFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCC 561
           LF IIG YNEK  L+    R K                D L    ++ + CG+EH NDCC
Sbjct: 461 LFAIIGSYNEKKQLSDVIPRTK--------------LRDTLGELKVQVLSCGYEHGNDCC 506

Query: 562 LQS-----KNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVY 616
           L S       ++WLCYGG +G+   +IEG+ PN+RLF +DD   EITSWKR+    +EVY
Sbjct: 507 LHSTGPEYTGELWLCYGGVSGLSGYQIEGMSPNIRLFGIDDEKGEITSWKRSLANPEEVY 566

Query: 617 DYQYIYK 623
           DYQYIYK
Sbjct: 567 DYQYIYK 573

>KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q12212 Saccharomyces cerevisiae YOR137C SIA1
           Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  340 bits (872), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 222/617 (35%), Positives = 322/617 (52%), Gaps = 104/617 (16%)

Query: 31  LRLNTKNVFINP-KIAEYNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSS 89
           ++ +  N+F  P K+  Y GG IDD++ L+C+ WY+ C  +           +R ++   
Sbjct: 35  VKTHFANIFQPPTKLEGYTGGLIDDVRFLKCFRWYKDCDVILE---------KRGRNGEF 85

Query: 90  VLWSRVSKNITVESLYSLQSGTFYNSYLYVHMKSFQGNSKNSIKELAMARDSALIPLQVL 149
           V W RV K +  E LYS+ SG FY SYLYVH     GN K+ + +LA+A+D + IP+QVL
Sbjct: 86  VPWMRVRKELDEEKLYSVDSGLFYRSYLYVH--PCDGN-KDCVSDLAIAKDRSSIPMQVL 142

Query: 150 RDINKMVKSSDSSVFHNHVYRREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCK 209
           +DIN  ++S DSS+FH H + +     ++W  +FG     + +++ GE+W Y+  GIWCK
Sbjct: 143 QDINAKIQSKDSSMFHGHEHHK-----TFWTRIFGGR--RERLSLQGEDWHYRRHGIWCK 195

Query: 210 FXXXXXXXXXXX-XXXEIYLGSSFIESRPFWKEVIHEF-HRNNMPSMPISITRKHETKNA 267
           +               +I+LGS F++ RP WK  IHE  HRN+    PISI         
Sbjct: 196 YSSSNKIDEGQSITNLQIFLGSGFVDPRPMWKTAIHEMDHRNSESPTPISI--------- 246

Query: 268 HYKYPNKLPGSLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHF--- 324
                     S++  DK+ D+          R  + +   +     FKILQ++D H    
Sbjct: 247 ----------SIQKYDKSMDS----------RFVTENGILNADDGKFKILQVSDLHVSNA 286

Query: 325 --KCTDNSMSIINEIRTVNFIDRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMI 382
             +C   S    NE +T  FI R++ LE PDLVV TGD ++   + DYQT I+K  + +I
Sbjct: 287 IERC--ESHLCTNEWKTQRFISRIIELETPDLVVFTGDFINGPETTDYQTAILKATECVI 344

Query: 383 SNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMA--IKVSFNKKLSKN 440
           S ++P+A++ G  D S +A+   I +FI +LPY  N + +K+   A  I  +F  +L + 
Sbjct: 345 SAKIPWAMTWGTLDYSKYASERDIFNFIKSLPYNLNYLHAKQVQDASLITTTFALQLKR- 403

Query: 441 ALLEKRVDNNEETSPAEALFFVFDSFNPVN--DFL-LDYSDLIGKID----YGLAFQYFP 493
                   +NE       + ++ DS NP N  DFL   Y +     D    Y LAFQ+ P
Sbjct: 404 --------DNE----IFGVVYILDSTNPENAVDFLKTAYENASKNSDRDTLYSLAFQHAP 451

Query: 494 LSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCG 553
           + EYRP G FPIIG YN+KS L V     +                  L  + +    CG
Sbjct: 452 IPEYRPSGSFPIIGSYNDKSPLDVPQVGIRKA----------------LDDFKIHAFSCG 495

Query: 554 HEHNNDCCLQSKN-----DMWLCYGGSAGIDLPRI--EGIYPNVRLFNVDDIMDEITSWK 606
            EH NDCCLQS +     D+WLCYGG AG+ + R   E    +VRLF +DD + EIT+WK
Sbjct: 496 QEHGNDCCLQSSDSNSNKDVWLCYGGHAGV-VGRYSPEDSASSVRLFRIDDSLKEITTWK 554

Query: 607 RNSIIVDEVYDYQYIYK 623
           RNS   D VYDYQ+++K
Sbjct: 555 RNSREPDSVYDYQFLFK 571

>Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137C
           (SIA1) - High-copy suppressor of temperature-sensitive
           tif51A-1 [contig 130] FULL
          Length = 568

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 206/602 (34%), Positives = 307/602 (50%), Gaps = 111/602 (18%)

Query: 47  YNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSVL-WSRVSKNITVESLY 105
           Y GGTIDD++ ++C+ W+  C  ++          ER   +  +L W RV K++  +SLY
Sbjct: 51  YEGGTIDDVKFIKCFRWFGDCNVVF----------ERHSLRDEILPWLRVGKSLNDDSLY 100

Query: 106 SLQSGTFYNSYLYVHMKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFH 165
           ++  G  +++YLYVH       +++SI +LA+ARD + +P+QVL+D+N   K  DSS+FH
Sbjct: 101 AVDRGLLHHTYLYVHPND---GTQDSISDLAIARDESNVPVQVLQDVNSRAKFKDSSMFH 157

Query: 166 NHVYRREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXXXXXXXXX- 224
           +H + +     S W  + G    S  +++ GE+W YKG G+WCK+               
Sbjct: 158 DHDHHK-----SIWSWIRGSGFHS--LSLRGEDWHYKGHGVWCKYSSKSRLDDEAVITDI 210

Query: 225 EIYLGSSFIESRPFWKEVIHE---FHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEA 281
           + ++G  F+E RP WK  IHE   F R+   S+  SI  +   K AH             
Sbjct: 211 QTFIGYGFVEPRPMWKVAIHEMNNFGRDLQQSISFSI--QISDKEAHID----------- 257

Query: 282 PDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHF----------KCTDNSM 331
           P  +N  L+L   +                  FKILQ++D H           KCT    
Sbjct: 258 PSASNIDLQLRDGE------------------FKILQLSDVHVSSDLANCDVEKCT---- 295

Query: 332 SIINEIRTVNFIDRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQVPYAIS 391
              N  +T  F+ RV+ LE+PD+V+ TGD +D  N++DYQT I+K  + +IS ++P+A++
Sbjct: 296 ---NYQKTKMFVSRVIQLERPDMVIFTGDFIDGPNAIDYQTAILKAAETVISAEIPWAVT 352

Query: 392 LGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNE 451
            G+SD S +A+  QI  ++  LP+  N ++  +G    KVS N   +   L       N 
Sbjct: 353 WGSSDYSKYASKRQILQYLETLPFCLNRLSFGKGD---KVSGNTTFNSFPL-------NN 402

Query: 452 ETSPAEALFFVFDSFNPVN--DFLLD-YSDLIGKID----YGLAFQYFPLSEYRPRGLFP 504
            +     L +  DS +  N  +F+   Y D+I   +    Y LAFQ+ P+ EYRP+G FP
Sbjct: 403 GSDSQVGLIYTLDSTSDENAAEFVRSAYKDVIEHTNRKPLYSLAFQHSPIPEYRPKGPFP 462

Query: 505 IIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQS 564
           IIG YN+K  L V     +            E+  D      ++ + C  EH NDCCLQS
Sbjct: 463 IIGSYNDKDPLDVPQLGIR------------EALEDA----EIQAMSCSQEHGNDCCLQS 506

Query: 565 -----KNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQ 619
                K D+WLCYGG  G+    +     NVRLF +DD   EIT+WKRNS+  D VYDYQ
Sbjct: 507 SGPDCKKDVWLCYGGHTGVAGHYVSEKMANVRLFRIDDNAKEITTWKRNSLSPDAVYDYQ 566

Query: 620 YI 621
           Y+
Sbjct: 567 YL 568

>KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|Q12212 Saccharomyces
           cerevisiae YOR137C SIA1 Suppressor of eIF5A High-copy
           suppressor of temperature-sensitive tif51A-1
          Length = 578

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 170/602 (28%), Positives = 273/602 (45%), Gaps = 112/602 (18%)

Query: 49  GGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSVLWSRVSKNITVESLYSLQ 108
           G  + D++I +CY W+  C +++   L              V W R+      ++  S+ 
Sbjct: 54  GIKVRDVRISKCYSWFSNCDAIWDYSLQDDL----------VTWYRIDMGKMQDT--SIG 101

Query: 109 SGTFYNSYLYVHMKSFQGNSKNSIKELAMARDSALIPLQVLRDINKMVKSSDSSVFH--- 165
            G  + SY+Y     +     +++ +LA++R+   +PL +  +    +K++D   +H   
Sbjct: 102 QGFGWTSYVYWQ-PLYPNERGSAVVDLALSRNG--LPLGLANERYNKIKNNDIDGYHVHS 158

Query: 166 ---NHVYRREKPTSSW-----WKLLFGISVDSDDIAVFGEEWVYKGSGIWCKFXXXXXXX 217
              N  Y ++  ++ +     W   FG  +         E+W ++G GIWCK+       
Sbjct: 159 NTDNEFYVKDDSSNRFNPDMKWSAKFGNHL---------EDWFWRGDGIWCKYGRRSNGI 209

Query: 218 XXXXXXXEIYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPG 277
                  + ++G  FIESRP WKE++H  HR    S PISI+ +    +       K   
Sbjct: 210 KEI----KAFIGEDFIESRPMWKEMVHCLHREGY-SKPISISFQKSRLDDFTYGKEKDLS 264

Query: 278 SLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFK---CTDNSMSII 334
            +  P     +L + +AD                  FKILQ++D HF     +D+     
Sbjct: 265 QISEP-----SLVMKRAD------------------FKILQISDLHFGRHIVSDSRKEKP 301

Query: 335 NEI-----RTVNFIDRVLALEKPDLVVITGDLL-DSQNSMDYQTCIMKLVQPMISNQVPY 388
           + I       V FI  V+  E+PDL VITG +  D   ++DY++ I+K+V P+ISN +P+
Sbjct: 302 DSIFRYDWPNVQFIHSVIRNERPDLAVITGHIFKDFNKNLDYESQILKMVSPIISNGIPF 361

Query: 389 AISLGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVD 448
             + G    +    ++ I +FI +LP+  N              F+ K S   +L   + 
Sbjct: 362 LFTWGEPQVTTEFKVN-ILNFIKSLPFCLN-------------KFDLKNSTYLMLPLLLP 407

Query: 449 NNEETSPAE-ALFFVFDSFNPVNDFLLDYSDLIGKIDYGLAFQYFPLSEYRPRGLFPIIG 507
                S  +    F FDS    +   LD      +  Y LAFQ+ PL EYRP+G F +IG
Sbjct: 408 AKTPGSQKQIGTIFAFDSNVTESYNFLDKFPRSPQSVYNLAFQHLPLHEYRPQGSFALIG 467

Query: 508 QYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQS--- 564
            Y +K +L                  H ++F ++L   ++K + CGHEH NDCC+ S   
Sbjct: 468 NYEQKGSLDYIP--------------HTKAFRNLLGEKDIKAISCGHEHGNDCCVLSDGK 513

Query: 565 ----KNDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQY 620
               KN+MWLCYGG  G D    +     VR+F +D   ++ITSWKR+     +V DYQY
Sbjct: 514 QQNLKNNMWLCYGGVTGYD----QAYESKVRIFKIDTEKNDITSWKRSIKDTSKVSDYQY 569

Query: 621 IY 622
           I+
Sbjct: 570 IW 571

>Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL009W
          Length = 572

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 94/348 (27%), Positives = 158/348 (45%), Gaps = 54/348 (15%)

Query: 311 QRSFKILQMTDFHF-----KCTDNSMSIIN---EIRTVNFIDRVLALEKPDLVVITGDLL 362
           + +FK++Q+ D HF     +C D   +  N   + +T+NF++ VL +E PDL+V TGD +
Sbjct: 240 EGNFKVVQLADLHFGVGKGECKDEFPTTENCEADPKTLNFVETVLEIENPDLIVFTGDQI 299

Query: 363 DSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIAS 422
           + +   D +T ++K + P I   +PYA+  G  D+S      ++  ++  LPY+   I  
Sbjct: 300 EGEWEQDSETALLKALGPAIRRGIPYAVIWGNHDDSGSMDRQELSKYVYQLPYSLFKINP 359

Query: 423 KEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVND 471
           ++G   ++  F      N +L+    ++ + SPA   +F           V+  ++ + +
Sbjct: 360 RDG---LRNDFG---FGNYVLQV---DDRDGSPAITFYFLDSHKRSPNPKVYFGYDWIKE 410

Query: 472 FLLDY------SDLIGK-IDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCK- 523
             L+Y       +L  K  D  +AF + PL EY            N +S    E    K 
Sbjct: 411 EQLNYLEEYYTKNLADKHTDLSMAFIHIPLPEY-----------LNFQSVRNDEQQNEKI 459

Query: 524 GEVSMTINGKHYES-FLDILSLWNMKGVGCGHEHNNDCCLQS-----KNDMWLCYGGSAG 577
           G     I    Y S   D+L    +  V  GH+H ND CL++      + +WLCYGG+ G
Sbjct: 460 GSFKEGITAPRYNSGTADVLVKLKVSAVSVGHDHCNDYCLETDFLSHSDSLWLCYGGAVG 519

Query: 578 -IDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKG 624
                   G    +R+F  +     I +WKR     D  +D+Q I+ G
Sbjct: 520 ERGYAGYGGTERRIRIFEFNAKKKVINTWKRLHGSPDRKFDFQIIHDG 567

>YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON}
           DCR2Phosphoesterase involved in downregulation of the
           unfolded protein response, at least in part via
           dephosphorylation of Ire1p; dosage-dependent positive
           regulator of the G1/S phase transition through control
           of the timing of START
          Length = 578

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 154/348 (44%), Gaps = 60/348 (17%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKI+Q+ D H      +C D      +   + +T  F+ +VL +EKP LVV TGD ++  
Sbjct: 248 FKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGD 307

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKE 424
           ++  D +T ++K V P+I+ ++P+A+  G  D+    T  Q+ +    LPY+    +  +
Sbjct: 308 RSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFSPHD 367

Query: 425 GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVND-- 471
            H       +        + +   NN+   P   L+F           ++  ++ + +  
Sbjct: 368 TH-------DNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQ 420

Query: 472 --FLLDYSDLIGKIDYGLAFQYF--PLSEY-------RPRGLFPIIGQYNEKSTLTVETS 520
             ++ DY D+  K   GL+  +F  PL EY        P    P+IG Y E  T      
Sbjct: 421 WKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAP---- 476

Query: 521 RCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQ---SKNDMWLCYGGSAG 577
                       K+    +  L   ++  V CGH+H ND CL+   + N +WLCYGG  G
Sbjct: 477 ------------KYNSEGITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGG 524

Query: 578 IDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKG 624
                  G     +R++ ++   + I +WKR +    E++D+Q +  G
Sbjct: 525 EGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEIFDFQSMLDG 572

>KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa]
           {ON} Anc_4.200 YLR361C
          Length = 585

 Score = 99.0 bits (245), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 83/359 (23%), Positives = 146/359 (40%), Gaps = 74/359 (20%)

Query: 314 FKILQMTDFHF-----KCTD-------NSMSIINEIRTVNFIDRVLALEKPDLVVITGD- 360
           FK++Q+ D H      KC D       +    + + +T+ F++ VL  E P LVV TGD 
Sbjct: 238 FKVVQLADLHMGVGPGKCIDEFPEHSKSEGPCLADPKTLTFVESVLDTESPQLVVFTGDQ 297

Query: 361 LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNI 420
           ++  ++  D +T ++K + P++   +P+ +  G  D+    +  ++  F   LP +   I
Sbjct: 298 IMGDKSRYDSETTLLKALAPVLERHIPWCLVWGNHDDEGSLSRWELSRFAETLPLSLFKI 357

Query: 421 ASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPV 469
           + ++       + +          +   +N E  PA  L+F           ++  ++ +
Sbjct: 358 SPRD-------TGDSSFGVGNYFHQVFSDNGEEKPAITLYFLDSHKYSRTGKLYPGYDWI 410

Query: 470 NDFLLDY----------------SDLIGKIDYGLAFQYFPLSEY-------RPRGLFPII 506
            +   DY                ++   +    +AF + PL EY        P    P++
Sbjct: 411 KEAQWDYVKQLYDKAIAPFADAATETSQERQLSMAFFHIPLPEYGDFQSQSNPAEQNPML 470

Query: 507 GQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQ--- 563
           GQ+ E  T                  K+    L  L    ++   CGH+H ND CLQ   
Sbjct: 471 GQHKEGLTAP----------------KYNSGGLTTLQHMRVQATSCGHDHCNDYCLQDDS 514

Query: 564 SKNDMWLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYI 621
           + + +WLC+GGSAG       G     +R FN D     I +WKR +      +DYQ +
Sbjct: 515 TGDKIWLCFGGSAGEGAYAGYGGTERRIRTFNFDTTSGRIETWKRLNGSPQNAFDYQVL 573

>SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q05924 Saccharomyces cerevisiae
           YLR361C DCR2 Protein involved in cell cycle regulation
          Length = 590

 Score = 95.5 bits (236), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 156/353 (44%), Gaps = 70/353 (19%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKI+Q+ D HF     KC D      S   + +T+ FI+RVL  EKP LVV TGD ++ +
Sbjct: 254 FKIVQLADLHFSVGKGKCRDEFPMHDSCEADPKTLEFINRVLDREKPHLVVFTGDQIMGN 313

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKE 424
           +   D +T ++K+++P+I+ ++P+A+  G  D+    +  ++   +  LPY+   ++  +
Sbjct: 314 ECKQDSETALLKVLEPVITRKIPFAMVWGNHDDEGSLSRWEMSQIVAKLPYSIFRLSQHD 373

Query: 425 GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVNDFL 473
                  + + K      +++      E  PA +L+F           +F  ++ + +  
Sbjct: 374 -------TKDSKFGLGNYIQQIF--TSENQPAISLYFLDSHKYSSNPKIFPGYDWIKEEQ 424

Query: 474 LDY------------SDLIGKIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKST 514
            DY            ++  G     +AF + PL EY        P     +IG Y E  T
Sbjct: 425 WDYMRNYYETNLKKANEAYGGNHLSMAFFHIPLPEYLHFQSQQEPDKQNLVIGNYKEGIT 484

Query: 515 LTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQ----SKND-MW 569
                             K+    L  L    +  V  GH+H ND CL     SK++ +W
Sbjct: 485 AP----------------KYNSGGLKALHDLKVSAVSVGHDHCNDYCLLEDSISKDEKIW 528

Query: 570 LCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYI 621
           LCYGG  G       G     +R+F +D   + I +WKR +   DE++D+Q I
Sbjct: 529 LCYGGGGGEGGYAGYGGTERRIRIFEIDTQGNSIYTWKRLNGTPDEIFDHQTI 581

>NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {ON}
           Anc_4.200
          Length = 583

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 90/351 (25%), Positives = 150/351 (42%), Gaps = 68/351 (19%)

Query: 314 FKILQMTDFHF-----KCTD---NSMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKI+Q+ D H      KC D          + +T+ F+ +VL LE P LVV TGD ++  
Sbjct: 249 FKIVQLADLHMGVGINKCEDEFPKHEHCEADPKTIEFVKKVLELEDPQLVVFTGDQIMGD 308

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKE 424
           ++  D +T ++K + P++  ++P+A+  G  D+    T  ++ +   NLPY+   I +K+
Sbjct: 309 RSIQDSETTLLKAIAPVVKRKIPWAMVWGNHDDEGSLTRWELSELATNLPYSLFQIGTKD 368

Query: 425 GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDS-------FNPVNDFLLD-- 475
               +    N  +   A          ++    A F+  DS        +P  D++ +  
Sbjct: 369 TKNNLFGVGNYYIQAQA---------NDSDDLIATFYFLDSHKYSKTKISPGYDWIKESQ 419

Query: 476 ---YSDLIG-----------KIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKST 514
              + DL             K+   +AF + PL EY       RP     I+G + E  T
Sbjct: 420 WDYFEDLYNNKLKLSIQSSHKLHVSMAFFHIPLPEYLNLDSKRRPNEQNQIVGTFKEGVT 479

Query: 515 LTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSKND---MWLC 571
                             ++    L++L    +    CGH+H ND CLQ  +    +WLC
Sbjct: 480 AP----------------RYNSGGLNVLQKLGVSVTSCGHDHCNDYCLQDDSTPSFIWLC 523

Query: 572 YGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYI 621
           YGG  G       G     +R++ +D     I++WKR +    E++DYQ I
Sbjct: 524 YGGGGGEGGYAGYGGTERRLRIYEIDSNKGTISTWKRLNSSPKEIFDYQII 574

>ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 583

 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 148/356 (41%), Gaps = 68/356 (19%)

Query: 313 SFKILQMTDFHF-----KCTDNSMS---IINEIRTVNFIDRVLALEKPDLVVITGD-LLD 363
           ++KI+Q+ D HF     +C D   +      + +T  F++ VL +E+PD+V+ TGD ++ 
Sbjct: 246 AYKIVQLADLHFGVGKGECLDEFPAHDHCEADPKTTKFVEEVLDIEQPDMVIFTGDQIMG 305

Query: 364 SQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASK 423
           S++  D +T ++K + P+IS  +P+A+  G  D+       ++  F+ +LP +   +  K
Sbjct: 306 SRSKQDSETALLKTLAPVISKGIPWAMVWGNHDDEGTLNRWELSKFVNDLPLSLFMVGPK 365

Query: 424 EGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVNDF 472
           +       + +          + +D  E   P    +F           +F  ++ + + 
Sbjct: 366 D-------TADNTFGVGNYFHQVMD-FENRQPVLTFYFLDSHKYSTTGKIFPGYDWIKED 417

Query: 473 LLDYSDLI------------GKIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKS 513
             DY   I             K    +AF + P  EY       RP    PIIG   E  
Sbjct: 418 QWDYFKRIYDEKLYQHIRNTQKPHLSMAFFHIPTPEYLHEASRERPGESNPIIGNPMEGV 477

Query: 514 TLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCL---QSKNDMWL 570
           T     S+    ++                  N++   CGH+H+ND CL    S   +W 
Sbjct: 478 TAPRYDSKAAAALAHM----------------NVQAASCGHDHSNDYCLLDDSSPQKIWF 521

Query: 571 CYGGSAGIDLP--RIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKG 624
           CYGG+ G        +G    VR+++ +     I +WKR +      +DYQ I  G
Sbjct: 522 CYGGAVGEGGYGDHNDGYERRVRIYHFETKDGNIYTWKRLNSSPINYFDYQLIASG 577

>Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 164/369 (44%), Gaps = 73/369 (19%)

Query: 298 YRITSSHIQYSWGQR-------SFKILQMTDFHF-----KCTDN---SMSIINEIRTVNF 342
           Y+   SH   +  QR        FKI+Q+ D H      +C D          + +T  F
Sbjct: 228 YKFVGSHPVNTEPQRLQETNEGKFKIVQLADLHLGVGESECVDEFPKHEVCKADPKTKTF 287

Query: 343 IDRVLALEKPDLVVITGD-LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFA 401
           I +VL +EKP +VV TGD ++  ++  D +T ++K V P+I+ ++P+A+  G  D+    
Sbjct: 288 IQQVLDIEKPQMVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSL 347

Query: 402 TLSQIKDFIGNLPYAF--NNIA-SKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEA 458
           T  Q+      LPY+   +NI  +++    +    ++  SK        D+ E  +P   
Sbjct: 348 TRWQLSQLASALPYSLFKSNIHDTQDNTFGVGNYVHQVFSK--------DDTE--APVST 397

Query: 459 LFF-----------VFDSFNPVND----FLLDYSD--LIGKIDYGLAFQYFPLSEY---- 497
           L+F           ++  ++ + +    ++ +Y D  L  K    +AF + PL EY    
Sbjct: 398 LYFLDSHKYSTAGKIYPGYDWIKESQWKYIEEYHDKVLKSKTKLSMAFFHIPLPEYLNTA 457

Query: 498 ---RPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGH 554
                    P+IG Y E   +T      +G  ++   G      +D++S        CGH
Sbjct: 458 SKTHAGEKNPLIGTYKE--GVTAPKYNSEGIATLDRLG------VDVIS--------CGH 501

Query: 555 EHNNDCCLQ---SKNDMWLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSI 610
           +H ND CL+   + N  WLCYGG  G       G     +R++ +D   D I +WKR + 
Sbjct: 502 DHCNDYCLRDDSTPNRPWLCYGGGGGEGGYAGYGGTERRIRIYEIDISEDNIHTWKRLNG 561

Query: 611 IVDEVYDYQ 619
             + ++DYQ
Sbjct: 562 SPENLFDYQ 570

>Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {ON}
           YLR361C (REAL)
          Length = 580

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/343 (24%), Positives = 148/343 (43%), Gaps = 60/343 (17%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKI+Q+ D H      +C D      +   + +T  FI++VL  EKP LVV +GD ++  
Sbjct: 250 FKIVQLADLHLGVGESECLDEFPKHEACKADPKTKIFIEQVLDNEKPQLVVFSGDQIMGD 309

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKE 424
           ++  D +T ++K V P+I+ ++P+A+  G  D+    T  Q+ +    LPY+    +  +
Sbjct: 310 RSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSELASELPYSLFKFSPYD 369

Query: 425 GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVND-- 471
                    +        + +   N     P   L+F           ++  ++ + +  
Sbjct: 370 TQ-------DNSFGVGNYIWQVFSNKSTELPVSTLYFLDSHKYSTVGKIYPGYDWIKESQ 422

Query: 472 --FLLDY--SDLIGKIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKSTLTVETS 520
             ++ DY   +L  K    +AF + PL EY        P    P++G Y E  T      
Sbjct: 423 WKYIEDYYHENLKLKTGPSMAFFHIPLPEYLNVESKTHPGERNPLVGTYKEGVTAP---- 478

Query: 521 RCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQ---SKNDMWLCYGGSAG 577
                       K+    L+ L    +  + CGH+H ND CL+   + N +WLCYGG  G
Sbjct: 479 ------------KYNSEGLNTLDKLGVDVISCGHDHCNDYCLRDDSTPNRLWLCYGGGGG 526

Query: 578 IDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQ 619
                  G     +R++ ++   + I +WKR +    E++DYQ
Sbjct: 527 EGGYAGYGGTERRIRIYEINVGENNIHTWKRLNGSPREIFDYQ 569

>KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 565

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 150/338 (44%), Gaps = 42/338 (12%)

Query: 311 QRSFKILQMTDFHFK-----CTD---NSMSIINEIRTVNFIDRVLALEKPDLVVITGD-L 361
           Q  FKI+Q+ D HF      C D      +   + +T+ FID+VL +EKP +VV TGD +
Sbjct: 230 QHKFKIVQLADLHFSVGKGVCRDEFPQHETCEADPKTLQFIDQVLDIEKPQMVVFTGDQI 289

Query: 362 LDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIA 421
           +  +   D +T ++K++ P+IS ++P+A+  G  D+       Q+ +F   LPY+   I 
Sbjct: 290 MGDECKQDSETALLKVLAPVISRKIPWAMVWGNHDDEGSLNRWQLSEFASKLPYSLFEIG 349

Query: 422 SKE--------GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFL 473
            ++        G+   +V      +  AL         ++       +V +      +  
Sbjct: 350 PRDSKDNQFGLGNYVREVKGGDGTTNIALYFLDSHKYSKSKAFPGYDWVKEEQWEYMEEY 409

Query: 474 LDYSDLIGKIDY-----GLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVSM 528
           L+  D I +  +      +AF + PL EYR          + ++S     ++R  G    
Sbjct: 410 LESHDSIKQAKHSGDLISMAFFHIPLPEYR---------NFPQESG----SNRVVGTYKE 456

Query: 529 TINGKHYES-FLDILSLWNMKGVGCGHEHNNDCCL-----QSKNDMWLCYGGSAGIDLPR 582
            I    Y S  +  L    +     GH+H ND CL       ++ +WLCYGG+AG     
Sbjct: 457 GITAPRYNSEGVKTLHKLGVSVTSVGHDHCNDYCLLDDFNDGEDKIWLCYGGAAGEGGYA 516

Query: 583 IEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQ 619
             G     +R++ +D +  +I SWKR +   +  +D+Q
Sbjct: 517 GYGGTERRIRVYEIDALKKDIYSWKRLNGSPENTFDHQ 554

>Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 147/340 (43%), Gaps = 54/340 (15%)

Query: 314 FKILQMTDFHF-----KCTDN---SMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKI+Q+ D H      +C D      +   + +T  F+ +VL +E P LVV TGD ++  
Sbjct: 251 FKIVQLADLHLGVGESECVDEFPKHETCKADPKTEAFVQQVLDIEAPQLVVFTGDQIMGD 310

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYA---FNNIA 421
           ++  D +T ++K V P+IS  +P+A+  G  D+    T  Q+ +    LPY+   F    
Sbjct: 311 RSIQDSETALLKAVAPVISRGIPWAMVWGNHDDEGSLTRWQLSELASTLPYSLFQFGIYD 370

Query: 422 SKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVN 470
           +K+    +    ++  SK          N+   P   L+F           ++  ++ + 
Sbjct: 371 TKDNTFGVGNYVHQVFSK----------NDTEMPVSTLYFLDSHKYSTVGKIYPGYDWIK 420

Query: 471 ----DFLLDYSD--LIGKIDYGLAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKG 524
               +++  Y D  L  K +  +AF + PL EY             E +T   E +   G
Sbjct: 421 ESQWEYMKKYYDETLEFKTELSMAFFHIPLPEYLN----------TESNTHPGEKNALVG 470

Query: 525 EVSMTINGKHYES-FLDILSLWNMKGVGCGHEHNNDCCLQSKND---MWLCYGGSAGIDL 580
                +    Y S  +  L    +  V CGH+H ND CLQ  +    +WLCYGG  G   
Sbjct: 471 TYKEGVTAPKYNSEGMATLEKLGVDVVSCGHDHCNDYCLQDDSTSSLIWLCYGGGGGEGG 530

Query: 581 PRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQ 619
               G     +R++ ++   + I +WKR +    E +DYQ
Sbjct: 531 YAGYGGTERRIRIYEINISENNIYTWKRLNGSPKEFFDYQ 570

>TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.200
           YLR361C
          Length = 574

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 155/365 (42%), Gaps = 54/365 (14%)

Query: 296 EDYRITSSHIQYSWGQRSFKILQMTDFHF-----KCTD---NSMSIINEIRTVNFIDRVL 347
           E+ RI +  ++     R FKILQ+ D HF     +C D      +   + +T+ FI+RVL
Sbjct: 222 EETRIMNEALRLGEEGR-FKILQLADLHFSAGKSECRDEFPKHPTCEADSKTLRFIERVL 280

Query: 348 ALEKPDLVVITGDLLDSQNSM-DYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQI 406
            +E PDLVV TGD +    S+ D +T ++K V P I  ++P+A+  G  D+        +
Sbjct: 281 DIESPDLVVYTGDQIMGDRSIRDSETSLLKAVAPAIRRKIPWAMVWGNHDDEGSLGRWAL 340

Query: 407 KDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF----- 461
             ++ +LPY+   I+ K+       + +          + +D      PA  L+F     
Sbjct: 341 SKYVESLPYSIFQISPKD-------TKDNSFGVGNYFHQIIDPT-TGKPAATLYFLDSHK 392

Query: 462 ------VFDSFNPVNDFLLDY---------SDLIGKID---YGLAFQYFPLSEYRPRGLF 503
                 V+  ++ + +   DY         S  + K       +AF + PL EY     F
Sbjct: 393 YSTTGKVYPGYDWIKEAQWDYLRELYDEKISPSLAKPSQKHLSMAFFHIPLPEYLD---F 449

Query: 504 PIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCL- 562
               + N ++ L   +           NGK     LD L    +    CGH+H ND CL 
Sbjct: 450 DSQKEANNRNPLVGNSKEAVMAPKYNSNGK---KTLDHL---GVSVTSCGHDHCNDYCLL 503

Query: 563 --QSKNDMWLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQ 619
              +    WLCYGG  G       G     VR++ +D    +I +WKR +   +  +DYQ
Sbjct: 504 DDSTSKKTWLCYGGGTGEGGYGGYGGTERRVRIYLLDGKNGDIHTWKRLNGNPNGYFDYQ 563

Query: 620 YIYKG 624
            +  G
Sbjct: 564 LMVSG 568

>Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON}
           (43361..44950) [1590 nt, 530 aa]
          Length = 529

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 143/325 (44%), Gaps = 53/325 (16%)

Query: 314 FKILQMTDFHF-----KCTD---NSMSIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           FKILQ+ D H+     +C D    +     + +T  FI+ +L L++PDLVV TGD ++ S
Sbjct: 206 FKILQLADLHYSTLDGECRDEYPKTEDCNADFKTRTFIESILNLDRPDLVVFTGDQIMGS 265

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAF------- 417
           Q S+D  + + K+V P+I  ++P+ +  G  D+    +  Q+ +   +LPY+        
Sbjct: 266 QCSLDATSALFKVVNPIIRRKIPWTMVWGNHDDEGSLSRVQLSNLAMSLPYSMFRYNPNF 325

Query: 418 ----NNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVNDFL 473
               N   +      I+ S    L+    L+       +T   +        ++ + +  
Sbjct: 326 DTSDNTFGTGNYIHKIRASDGSPLASLIFLDSHKKATTKTGKVKL------GYDWIKESQ 379

Query: 474 LDYSDLIGKIDYG------LAFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVS 527
           L+Y     K +YG      +AF + PL E+            N KS   V+     G   
Sbjct: 380 LNYV----KENYGTETPLNMAFFHIPLPEF-----------LNTKSDEGVKNVIV-GLFK 423

Query: 528 MTINGKHYES-FLDILSLWNMKGVGCGHEHNNDCCLQSKND---MWLCYGGSAGIDLPRI 583
             +    Y S  LD+L    ++ VG GH+H ND CL  K+     WLC+GG+AG      
Sbjct: 424 EGVTAPRYNSGALDVLKSLKVQVVGVGHDHCNDYCLLEKSKKYGTWLCFGGAAGEGGYGG 483

Query: 584 EGIYP-NVRLFNVDDIMDEITSWKR 607
            G     VRL+ ++     I +WKR
Sbjct: 484 YGGTERRVRLYEINGKDLSIKTWKR 508

>KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON}
           Anc_4.200 YLR361C
          Length = 581

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 151/355 (42%), Gaps = 80/355 (22%)

Query: 265 KNAHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHF 324
           K   +KYP+ +  S ++ DK +D  + +Q       T+S        + FKI+Q+ D H 
Sbjct: 215 KFTEFKYPSYI--SYKSVDKFDD--QSIQLSPKLLTTTS--------QDFKIVQLADLHM 262

Query: 325 -----KCTDNSMSIINEI-----RTVNFIDRVLALEKPDLVVITGD-LLDSQNSMDYQTC 373
                +C D      + +     +T+ FI++VL  E P LVV TGD ++  ++  D +T 
Sbjct: 263 GVGTNECRDEFPESSDGVCKADPKTLEFIEKVLDNESPQLVVFTGDQIMGDRSIQDSETT 322

Query: 374 IMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYA----------------- 416
           ++K + P+I  ++P+A+  G  D+    +  Q+ +    LPY+                 
Sbjct: 323 LLKALDPVIRRKLPWAMVWGNHDDEGSLSRWQLSELAAKLPYSLFEMSKYDTKNNKFGVG 382

Query: 417 ------FNNIASKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFVFDSFNPVN 470
                 FN    +EG + +    + K S+   +    D  +E    E L ++   +N   
Sbjct: 383 NYAKQVFNGDNEEEGLITLYFLDSHKYSQMGKIYPGYDWIKE----EQLNYIEHEYN--T 436

Query: 471 DFLLDYSDLIGKIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKSTLTVETSRCK 523
             LL  S    K    +AF + PL EY       R     P++G++ E  T         
Sbjct: 437 KLLLKQSK--QKKQLSMAFFHIPLPEYLNLNSAKRAGENNPLVGEFKEGVTAP------- 487

Query: 524 GEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCL---QSKNDMWLCYGGS 575
                    K+    L+ L    ++   CGH+H ND CL    + +D+WLC+GGS
Sbjct: 488 ---------KYNSGALEKLQSLGVQVTSCGHDHCNDYCLLDDSTSSDIWLCFGGS 533

>TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.200
           YLR361C
          Length = 643

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 95/358 (26%), Positives = 149/358 (41%), Gaps = 68/358 (18%)

Query: 314 FKILQMTDFHFK-----CTD--------NSMSIINEIRTVNFIDRVLALEKPDLVVITGD 360
           FKI+Q+ D H       C D        +  S   +  T+ F+ +VL  E+P LVV +GD
Sbjct: 285 FKIVQLADLHLSTGYGVCRDPFPANLIADDGSCHADPLTLQFVSQVLDEEQPQLVVFSGD 344

Query: 361 -LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNN 419
            ++  +   D +T ++K V P+I   +P+A+  G  D+       +I +F   LP     
Sbjct: 345 QIMGDRCKADSKTALLKAVAPVIQRGIPWAMIWGNHDDEGSMDRIEISEFAAALP----- 399

Query: 420 IASKEGHMAIKVSFNKKLSKNALLEK-RVDNNEETSPAEALFFV--------------FD 464
             S+        S N     N LL      +  + +PA  L+F+              +D
Sbjct: 400 -GSQFQFTPFDTSDNTFGVGNYLLNVYDTQDVTQVTPAFTLYFLDSHKYATTGRFSAGYD 458

Query: 465 SFNPVNDFLLDYS-DLIGKID---YGLAFQYFPLSEYR--------PRG-LFPIIGQYNE 511
              P       Y  D +   +     +AF + P+ EYR         RG L P +G + E
Sbjct: 459 WVKPKQLHYFQYQHDQLPPTEPQHISMAFLHIPVPEYRNLQSNRPETRGELNPFVGNHKE 518

Query: 512 KSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQ---SKNDM 568
             T     +R  G +SM             L    +  V CGH+H ND CL+   + +D+
Sbjct: 519 PVT---APARDSGTLSM-------------LQQLGISVVSCGHDHCNDYCLEDDSTGSDV 562

Query: 569 WLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKGE 625
           WLCYGG+AG       G     +R++ +D     + +WKR    ++E  DYQ +   E
Sbjct: 563 WLCYGGAAGEGGYSGYGGTERRIRIYELDAKAGRVVTWKRRRGSMNEARDYQVLVDRE 620

>TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {ON}
           Anc_4.200 YLR361C
          Length = 558

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/343 (26%), Positives = 151/343 (44%), Gaps = 49/343 (14%)

Query: 314 FKILQMTDFHFKCTDNSM--------SIINEIRTVNFIDRVLALEKPDLVVITGD-LLDS 364
           +KI+Q+ D HF  TD               + +T  FID+VL LE+PDLV+ TGD ++  
Sbjct: 229 YKIVQLADMHFSITDGECHDEFPPTDDCKADRKTQVFIDKVLDLEQPDLVIFTGDQIMGD 288

Query: 365 QNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKE 424
           Q   D ++ ++K+V P+I+ ++ +A+  G  D+       ++     +LPY+   I +  
Sbjct: 289 QCKKDSKSALLKVVGPIIARKIKWAMVWGNHDDEGSLDRFELSQLAASLPYSTFRINA-- 346

Query: 425 GHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFV-----------FDSFNPVNDFL 473
           G   +  +F        + ++  +  +   P  +L F+           F  ++ +    
Sbjct: 347 GIDTLDTTFGIGNYVQKIYKEEKNKPDSYIPIGSLIFMDSHKYSKSPKSFPGYDWIKPSQ 406

Query: 474 LDYSDLIGKIDYGL------AFQYFPLSEYRPRGLFPIIGQYNEKSTLTVETSRCKGEVS 527
            +Y   IGK  YGL      AF + PL EY            N KS  T + ++  G   
Sbjct: 407 YNY---IGK-HYGLKTPLNMAFFHIPLPEY-----------LNIKSESTGKENKIVGSGR 451

Query: 528 MTINGKHYES-FLDILSL-WNMKGVGCGHEHNNDCCLQSKN---DMWLCYGGSAGIDLPR 582
             +    Y S  L+ L    N++ +  GH+H ND CL + +     WLCYGG AG     
Sbjct: 452 EGVTAPKYNSGTLEFLKKELNVQLISVGHDHCNDYCLSNDDYGSKSWLCYGGGAGEGGYS 511

Query: 583 IEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIYKG 624
             G     +R+F +D     I +WKR      + +D+Q +  G
Sbjct: 512 GYGGTERRIRVFEIDFDKLSIETWKRKQTNSQDTFDHQELVSG 554

>KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 580

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 100/428 (23%), Positives = 168/428 (39%), Gaps = 81/428 (18%)

Query: 226 IYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETKNAHYKYPNKLPGSLEAPDKN 285
           +  G   ++ RP W+  + +  R     +P  +T +    + H K    L  SLE P   
Sbjct: 193 VLFGEDCVDPRPAWR--LSKEWRLEHSKVPCYLTLRTRDSDPHGKKFPTLSASLENP--- 247

Query: 286 NDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHF-----KCTD---NSMSIINEI 337
                                       FKI+Q+ D H+     +C D      + I + 
Sbjct: 248 ----------------------------FKIVQLADLHYSVGEGRCRDEFPKHENCIADP 279

Query: 338 RTVNFIDRVLALEKPDLVVITGD-LLDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASD 396
           +T+ F+++VL  EKP LVV TGD ++ S+   D  T ++K+V P+I  Q+PYA+  G  D
Sbjct: 280 KTLAFVEKVLDTEKPQLVVFTGDQIMGSECVQDSVTALLKVVDPIIKRQIPYAMVWGNHD 339

Query: 397 ESNFATLSQIKDFIGNLPYAFNNIASKEGH-----MAIKVSFNKKLSKNALLEKRVDNNE 451
           +       +I   + +LP +   I   + +     +   V +      N L      +  
Sbjct: 340 DEGSLDRWEISKLVQSLPLSLFKIGDHDTNDNSFGVGNYVHYIYGEDGNPLSALYFLDAH 399

Query: 452 ETSPAEALFFVFDSFNPVN-DFLLDYSDLI--GKIDYGLAFQYFPLSEY-------RPRG 501
           + SP    +  +D       +F   Y D     K    +AF + PL EY        P  
Sbjct: 400 KYSPNAKAYPGYDWIKEEQWNFFDGYKDAFVDQKASLSMAFFHIPLPEYLNVDSSSSPGT 459

Query: 502 LFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCC 561
             P+IG + E            G  +   N K   +  ++     +K    GH+H ND C
Sbjct: 460 QNPLIGNFKE------------GVTAPKYNSKGIATLREL----GVKVTSVGHDHCNDYC 503

Query: 562 LQSKND-------MWLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVD 613
           L   +        +WLC+GG+AG       G     +R++ +D     I +WK  +   +
Sbjct: 504 LLEDSQSPAINERIWLCFGGAAGEGGYGGYGGTERRIRVYQLDFSKRSIVTWKVLNSSPE 563

Query: 614 EVYDYQYI 621
             +D+Q +
Sbjct: 564 APFDHQTL 571

>Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361C -
           Hypothetical ORF [contig 150] FULL
          Length = 577

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/330 (26%), Positives = 143/330 (43%), Gaps = 52/330 (15%)

Query: 311 QRSFKILQMTDFHF-----KCTDNS---MSIINEIRTVNFIDRVLALEKPDLVVITGD-L 361
           + +FKI+Q+ D HF     +C D      +   + +T  FI+RVL LEKP LVV TGD +
Sbjct: 242 ENNFKIVQLADLHFSVDEGRCRDEHPVHETCKADPKTSKFIERVLDLEKPQLVVFTGDQI 301

Query: 362 LDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIA 421
           +  +   D  T ++K+V P+I  ++PYA+  G  D+       ++ + + + PY+   I+
Sbjct: 302 MGDECRQDSLTALLKVVAPVIERKIPYAMVWGNHDDEGSLNRWELSELVKSFPYSLFKIS 361

Query: 422 ---SKEGHMAIKVSFNKKLSK--NALLEKRVDNNEETSPAEALFFVFD-----SFNPVND 471
              +++    +    +    K  N +      ++ + SP    +  +D      +  +  
Sbjct: 362 EHDTQDNSFGVGNYMHYIYGKDGNPVSSLYFLDSHKYSPNAKAYPGYDWIKEEQWKYLET 421

Query: 472 FLLDYSDLIGKIDYGLAFQYFPLSEY-------RPRGLFPIIGQYNEKSTLTVETSRCKG 524
           F   +SD   K    +AF + PL EY        P  + P IG + E  T     S    
Sbjct: 422 FEDSFSD--QKRSLSMAFFHIPLPEYANFQSTQSPDYMNPSIGSFKEGLTAPKFNS---- 475

Query: 525 EVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCL------QSKND-MWLCYGGSAG 577
                 NG      +  L    +K    GH+H ND CL      Q+  D +WLC+GG+AG
Sbjct: 476 ------NG------IPTLRKLGVKATSVGHDHCNDYCLLDDSQSQANEDKIWLCFGGAAG 523

Query: 578 IDLPRIEGIYP-NVRLFNVDDIMDEITSWK 606
                  G     +R F +D     I SWK
Sbjct: 524 EGGYAGYGGTERRIRTFQLDFEAQSIQSWK 553

>NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {ON}
           Anc_4.200
          Length = 589

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 141/341 (41%), Gaps = 62/341 (18%)

Query: 314 FKILQMTDFHFKCTDNSM---------SIINEIRTVNFIDRVLALEKPDLVVITGD-LLD 363
           FKI+Q+ D H    +N+              + +T+ FI+ VL +E P LV+ TGD ++ 
Sbjct: 269 FKIVQLADLHMAVGENTCRDEFPKTDEDCKADPKTLKFIESVLDIESPQLVIYTGDQIMG 328

Query: 364 SQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASK 423
             +  D +T ++K + P+IS ++ +A+  G  D+    +  Q+ +    LP++    + K
Sbjct: 329 DLSIQDSETTLLKALSPVISRRLSWAMVWGNHDDEGSLSRWQLSELASILPFSLFQFSPK 388

Query: 424 EGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFF-----------VFDSFNPVNDF 472
           + +       +        +E   D + E      L+F           +F  ++ + + 
Sbjct: 389 DTN-------DNSFGVGNYVENIYDYSNELKIT--LYFLDSHKYSKNGKIFPGYDWIKED 439

Query: 473 LLDY-----SDLIGKIDYGLAFQYFPLSEYR-------PRGLFPIIGQYNEKSTLTVETS 520
             +Y     S         +AF + PL EY        P     I+GQ+ E  T      
Sbjct: 440 QWEYMKSLHSSTPENKGISMAFFHIPLPEYLDLDSKKVPSQQNEIVGQFKEGVTAP---- 495

Query: 521 RCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSKND---MWLCYGGSAG 577
                       K+    L  L    +    CGH+H ND CL+  +    +WLCYGGSAG
Sbjct: 496 ------------KYNSGGLSTLQELGVTVTSCGHDHCNDYCLRDDSTPSMIWLCYGGSAG 543

Query: 578 IDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYD 617
                  G     +R+F +D   + + +WKR +    E++D
Sbjct: 544 EGAYAGYGGTERRIRVFEIDTTDNSVYTWKRLNGSPSEIFD 584

>CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361c
          Length = 578

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/374 (23%), Positives = 163/374 (43%), Gaps = 61/374 (16%)

Query: 289 LRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHF-----KCTD---NSMSIINEIRTV 340
           ++L   + +Y  +   ++       FKI+Q+ D H      +C D   +      + +T+
Sbjct: 223 MKLGSQEPEYTKSKVLVKKEHEDDGFKIVQLADLHLGVGKNRCLDEYPHHDKCEADSKTL 282

Query: 341 NFIDRVLALEKPDLVVITGDLLDSQNSM-DYQTCIMKLVQPMISNQVPYAISLGASDESN 399
            F++ VL +EKP  VV +GD +    S+ D ++ + K V P+I  ++P+A+  G  D+  
Sbjct: 283 KFVEEVLDIEKPGFVVFSGDQIMGDRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDDEG 342

Query: 400 FATLSQIKDFIGNLPYAFNNIASKE--------GHMAIKVSFNKKLSKNALLEKRVDNNE 451
             +  ++      LPY+   I+  +        G+ A ++ +       AL    +D+++
Sbjct: 343 SLSRWELSKLAMKLPYSRFQISPHDTKDNTFGVGNYAHQIFYENDPEVAALSLYFMDSHK 402

Query: 452 ETSPAEALFFVFDSFNPVNDFLLDY----------SDLIGKID--YGLAFQYFPLSEY-- 497
            +   +    ++  ++ + +  L+Y          S +   I     + F + PL EY  
Sbjct: 403 YSKTGK----IYLGYDWLKEEQLEYIQSLYERGMKSHIKENIHRHAAMTFIHIPLPEYLN 458

Query: 498 -----RPRGLFPIIGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGC 552
                RP     +IG + E   +T       G V++   G      +D+        VGC
Sbjct: 459 LDSKKRPGESNELIGTFKE--GVTAPRYNSGGLVALDKIG------VDV--------VGC 502

Query: 553 GHEHNNDCCLQ----SKNDMWLCYGGSAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKR 607
           GH+H ND CL     S  ++WLCYGG AG       G     +R +  D    +IT+WKR
Sbjct: 503 GHDHCNDYCLHDDSTSNKNIWLCYGGGAGEGGYAGYGGTERRIRTYKFDPQTGKITTWKR 562

Query: 608 NSIIVDEVYDYQYI 621
            +    E++D+Q +
Sbjct: 563 LNSKPSEIFDFQIV 576

>ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR361C
          Length = 569

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 148/349 (42%), Gaps = 70/349 (20%)

Query: 315 KILQMTDFHF-----KCTDNSMSIIN---EIRTVNFIDRVLALEKPDLVV-----ITGDL 361
           K++ + D H      +C D   +  N   +++T+ F++ VL +E+PD+ V     ITGDL
Sbjct: 249 KVVHLADLHLVPGKGECRDEFPTTENCEADVKTMKFVNDVLDIERPDMAVYTGDQITGDL 308

Query: 362 LDSQNSMDYQTCIMKLVQPMISNQVPYAISLGASDESNFATLSQIKDFIGNLPYAFNNIA 421
            D+    D +T ++K   P     +P+A+  G  D++      Q+  ++  LP++   I 
Sbjct: 309 CDN----DAETPLLKAFAPANQRWIPFAVIWGNHDDAGSLNRLQLSQYVEALPFSLFKIG 364

Query: 422 SKEGHMAIKVSFNKKLSKNALLEKRVDNNEETSPAEALFFV-FDSFNP------VNDFLL 474
            ++    +  SF      + +L       E   P    +FV   S+ P      V D++ 
Sbjct: 365 PRD---TMDRSFGMGNYVHQVL------GENGHPEITFYFVDTHSYAPNPRGRRVYDWVK 415

Query: 475 D-----YSDLIGKIDY---GLAFQYFPLSEY-------RPRGLFPIIGQYNEKSTLTVET 519
           +     + D   K+++    LAF + PL EY        P+     +G + E  T     
Sbjct: 416 EEQWQYFEDCHAKLEHTELSLAFLHIPLPEYLDVKSKKDPQKYNQFLGTFREGVTAP--- 472

Query: 520 SRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQS-----KNDMWLCYGG 574
                        +H     + L+   +  V  GH+H ND CLQ+        +W+CYGG
Sbjct: 473 -------------RHNSGGAERLARLGVSAVTAGHDHCNDYCLQTDFRDIDPKIWMCYGG 519

Query: 575 SAGIDLPRIEGIYP-NVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIY 622
           +AG       G     +R+F +D     I +WKR +   ++ +D   IY
Sbjct: 520 AAGEGGYGGYGGTERRIRIFEIDTREKRIETWKRLNSSPNDKFDAHLIY 568

>ZYRO0D13156g Chr4 complement(1106020..1107972) [1953 bp, 650 aa]
           {ON} similar to uniprot|Q03722 YML020W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 650

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 83  RVKDKSSVLWSRVSKNITVESLYSLQSGTFYNSYLYVHMKSFQGNSKNSIKEL-AMARDS 141
           R  ++  V +S   K I++ ++  + +G FY +   + ++++Q   K S++EL    R  
Sbjct: 394 RFFNEGDVPFSTNKKIISILAMAGINNGPFYGADQTLFVRAYQTIEKESLRELFQFQRPD 453

Query: 142 ALIPLQVLRDINKMVKSSDSSVF 164
           +L+  +++R I  +V S+   VF
Sbjct: 454 SLVSQKLIRSIRIIVGSNVKIVF 476

>KLTH0E07062g Chr5 complement(648999..653489) [4491 bp, 1496 aa] {ON}
            similar to uniprot|P22147 Saccharomyces cerevisiae
            YGL173C KEM1 5'-3' exonuclease involved in mRNA decay
            evolutionarily conserved component of cytoplasmic
            processing (P) bodies plays a role in
            microtubule-mediated processes filamentous growth and
            ribosomal RNA maturation
          Length = 1496

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 576  AGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRN 608
            AG D+P I  +YP V   ++  ++D+++SW +N
Sbjct: 1070 AGRDVPSISKLYPGVDANDLRKLIDDVSSWLKN 1102

>KNAG0F02190 Chr6 (418793..422137) [3345 bp, 1114 aa] {ON} Anc_6.176
           YGL094C
          Length = 1114

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 288 ALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKCTDNSMSIINEIRTVNFIDRVL 347
            L  LQA     I S H+ Y  G  +   L   D + +   N M   +E+R +   ++V+
Sbjct: 113 GLSGLQAMTSVSIDSQHLIYCGGNNTAAGLSCFDLNKRQISNVMPYNHEVRFLKSNNKVI 172

Query: 348 ALEKPDLVVITGDLLDSQNS 367
           A+ K D  V   DLLD +++
Sbjct: 173 AIGKGDGTV---DLLDPRSN 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,655,902
Number of extensions: 2990844
Number of successful extensions: 8263
Number of sequences better than 10.0: 44
Number of HSP's gapped: 8370
Number of HSP's successfully gapped: 52
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)