Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.3005.473ON36936918320.0
YOR136W (IDH2)5.473ON36936917760.0
Smik_15.3165.473ON36936917680.0
Suva_8.1885.473ON36936917280.0
NDAI0C014105.473ON36936916000.0
SAKL0G03520g5.473ON36936915920.0
NCAS0H022505.473ON42236915810.0
CAGL0I07227g5.473ON36836915680.0
Ecym_23135.473ON37037115360.0
KNAG0B040705.473ON37337315360.0
KLLA0E03125g5.473ON36836915250.0
Kpol_440.125.473ON36836915230.0
KLTH0F15048g5.473ON36836915180.0
Kwal_55.212735.473ON36836915120.0
TDEL0A033705.473ON37137114970.0
AFR137C5.473ON36736914950.0
KAFR0B063705.473ON37836314440.0
Kpol_543.85.473ON36836914350.0
TBLA0B022405.473ON37337314350.0
ZYRO0D11220g5.473ON36836914280.0
TPHA0J027705.473ON37635014190.0
TPHA0E014805.473ON37735812811e-177
ADL223W2.278ON3623677134e-91
Ecym_33162.278ON3623726987e-89
SAKL0E07876g2.278ON3613706911e-87
ZYRO0D02838g2.278ON3613716882e-87
KLLA0F04103g2.278ON3613456866e-87
Smik_14.2902.278ON3603686812e-86
KLTH0G10186g2.278ON3603746804e-86
TBLA0B069102.278ON3653676804e-86
Kwal_23.50122.278ON3613746786e-86
YNL037C (IDH1)2.278ON3603686771e-85
NDAI0B035902.278ON3593686752e-85
KNAG0A052802.278ON3613696701e-84
Skud_14.2932.278ON3613686665e-84
CAGL0G02673g2.278ON3583696657e-84
TPHA0D015602.278ON3603596456e-81
NCAS0B062902.278ON3593686456e-81
Kpol_1039.352.278ON3593696422e-80
TDEL0C038402.278ON3613496403e-80
KAFR0J014102.278ON3503716133e-76
Suva_14.3022.278ON3003105414e-66
Kpol_1003.392.287ON3703904133e-46
NCAS0B062502.287ON3733554054e-45
TBLA0B059402.287ON3693854011e-44
KNAG0A054202.287ON3723903993e-44
NDAI0B035502.287ON3723543993e-44
Smik_9.852.287ON3713903976e-44
TPHA0C034102.287ON3713963941e-43
SAKL0E07656g2.287ON3683963932e-43
KLLA0E08339g2.287ON3693593923e-43
ADL214C2.287ON3673533871e-42
CAGL0G02585g2.287ON3723593853e-42
Suva_9.1052.287ON3713903836e-42
YIL094C (LYS12)2.287ON3713903811e-41
ZYRO0A01914g2.287ON3683963783e-41
Skud_9.792.287ON3713903766e-41
Ecym_33262.287ON3663743741e-40
TDEL0G021802.287ON3693903732e-40
Kwal_27.115282.287ON3673643512e-37
KLTH0G10384g2.287ON3673593503e-37
KAFR0J013602.287ON3733543443e-36
AAL012C1.402ON3723522231e-19
NDAI0G042301.402ON3633572204e-19
KAFR0I022001.402ON3653562171e-18
Ecym_12961.402ON3632762161e-18
Skud_3.431.402ON3643582081e-17
Smik_3.661.402ON3643592062e-17
Kwal_0.2251.402ON3643552045e-17
YCL018W (LEU2)1.402ON3643552029e-17
KNAG0I012801.402ON4473952021e-16
TBLA0C015001.402ON3653072011e-16
KLLA0D04906g1.402ON3623562002e-16
ZYRO0E04796g1.402ON3622682002e-16
TDEL0B060001.402ON3623531983e-16
CAGL0H03795g1.402ON3653611974e-16
Suva_3.31.402ON3643591958e-16
KLTH0H12188g1.402ON3643511894e-15
Kpol_1048.631.402ON3643541851e-14
NCAS0C048701.402ON3652681851e-14
SAKL0D08690g1.402ON3642681806e-14
TPHA0B037301.402ON3652681593e-11
Suva_14.303singletonON53511002e-05
ADR028W3.425ON83258741.4
TDEL0A042205.559ON1334173712.9
ZYRO0C02266g3.61ON162135695.2
TPHA0A014408.352ON88381686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.300
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   710   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   688   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   685   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   670   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   620   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   617   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    613   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   608   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   596   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   596   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   592   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   591   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   589   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   587   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   581   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   580   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   560   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   557   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   557   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   554   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   551   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   498   e-177
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   279   4e-91
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   273   7e-89
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   270   1e-87
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   269   2e-87
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   268   6e-87
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   266   2e-86
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   266   4e-86
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            266   4e-86
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   265   6e-86
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   265   1e-85
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   264   2e-85
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              262   1e-84
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   261   5e-84
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   260   7e-84
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   253   6e-81
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   253   6e-81
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   251   2e-80
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   251   3e-80
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   240   3e-76
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   213   4e-66
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   163   3e-46
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   160   4e-45
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   159   1e-44
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              158   3e-44
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   158   3e-44
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   157   6e-44
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   156   1e-43
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   155   2e-43
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   155   3e-43
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   153   1e-42
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   152   3e-42
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   152   6e-42
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   151   1e-41
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   150   3e-41
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   149   6e-41
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   148   1e-40
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   148   2e-40
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   139   2e-37
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   139   3e-37
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   137   3e-36
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    91   1e-19
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    89   4e-19
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    88   1e-18
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    88   1e-18
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    85   1e-17
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    84   2e-17
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    83   5e-17
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    82   9e-17
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    82   1e-16
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    82   1e-16
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    82   2e-16
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    82   2e-16
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    81   3e-16
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              80   4e-16
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       80   8e-16
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    77   4e-15
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    76   1e-14
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    76   1e-14
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    74   6e-14
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    66   3e-11
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    43   2e-05
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    33   1.4  
TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {...    32   2.9  
ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} simil...    31   5.2  
TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.3...    31   6.2  

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/369 (95%), Positives = 351/369 (95%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           LKVVTNPSAYTNAVSVCPNLYGDI                  ANIGHKISIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/369 (91%), Positives = 346/369 (93%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+  FRNTSRRFLATVKQPSIGR+TGKPNPSTG+YTVSFIEGDGIGPEISKSVKKIF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AANVPIEWESCDV+PIFVNGLTTIPD AVQSIT NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD+ LETELIDNSV
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           LKVVTNPSAYT+AVSVCPNLYGDI                  ANIGHKISIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/369 (91%), Positives = 344/369 (93%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+  FRNTSRRFLATVKQPSIG++TGKPNPSTG+YTVSFIEGDGIGPEISKSVKKIF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AANVPIEWE CDVNPIFVNGLTTIPD AVQSIT NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDI LETELIDNSV
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           LKVVTNPSAYTNAVSVCPNLYGDI                  ANIGHKISIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQDKANPTALLLSSVMMLNHMGLTN+ADQIQNAVLSTIASGPENRTGDLAG ATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/369 (88%), Positives = 340/369 (92%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+   RNTSRRFL+TVKQPSIGR+TGKP+PSTGRYTVSFIEGDGIGPEISKSVKKIF+
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPI WE CDVNPIFVNGLTTIPD AVQSIT NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARAIGRPR+IVVHKSTIQRLADGLFVNVAKELSKEYPDI  ETELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VVTNPSAYTNAVSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+DKANPTALLLSSVMMLNHMGLT+HADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 331/369 (89%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M R+ + RNT+RRFL+   QPSIG+FTGKPNPSTG++TVSFIEGDGIGPEIS+SVK+IF+
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDV+P+F+NGLTTIP+ AVQSI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYA+EYARAIGRPRVIVVHKSTIQRLADGLFV+VAKELS+EYPDI LETELIDN+V
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VV+NPS+Y+NAVSVCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL NHAD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 361 FTEAVIKRL 369
           FT+AVI RL
Sbjct: 361 FTDAVIGRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 322/369 (87%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRS + R   RRFL++ KQPSIGRFTGKPNPSTG+YTVSFIEGDG+GPEISKSVK IF 
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+EWESCDV P+F+NGLTTIP  AV SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARA+GRP+V+VVHKSTIQRLADGLFV+VAKELS EYPDI L+ +L+DN+V
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VV+NP AY + VSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/369 (79%), Positives = 330/369 (89%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M RS++ R T+RR L+   QPSIG++TGKPNPSTG+YTVSFIEGDGIGPEIS SVK+IF+
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPIEWE+CDV P+F++GLTTIP+ AVQSI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPA+SV+GFKTTY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEY RAIGRPR++VVHKSTIQRL+DGLFVNVAKELSKEYPDI  ETELIDN+V
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           LKVV+NPS+YT+AVSVCPNLYGDI                   NIG++ISIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++ ANPTALLLSSVMMLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 361 FTEAVIKRL 369
           FT+AVIK+L
Sbjct: 414 FTDAVIKKL 422

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/369 (80%), Positives = 324/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           ML    FR  +RRFLAT  QPSIGRFTGKPNPSTG++TVSFIEGDGIGPEIS SVK+IF 
Sbjct: 1   MLGIRSFRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQ 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EWE+CDV PIFVNGLTTIPD AVQSI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TF LFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 120 TFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYA+EYARAIGRPR+IVVHKSTIQRLADGLFVNVAKEL+ EYPDI LETELIDN+ 
Sbjct: 180 ERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTC 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VV+NPS+YT+AVSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 240 LNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMG+T HAD+I+ AVL TIA G E RTGDL G+A+T+S
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTS 359

Query: 361 FTEAVIKRL 369
           FT+A+IK+L
Sbjct: 360 FTDAIIKKL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 323/371 (87%), Gaps = 3/371 (0%)

Query: 1   MLRSNLFRNTSRRFLATV--KQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI 58
           M + ++F+  SRR+LA+   KQPSIGRFTGKPNP TG+YTVSFIEGDGIGPEIS+SVK I
Sbjct: 1   MFKQSIFKG-SRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDI 59

Query: 59  FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTL 118
           F+AA VP+EWE CDV PIF+NGLTTIPD AVQSI  NL+ALKGPLATPIGKGHRSLNLTL
Sbjct: 60  FSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 119

Query: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178
           RKTFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRD
Sbjct: 120 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 179

Query: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDN 238
           ASERVIRYAFEYARA+GRP+V+VVHKSTIQRLADGLFVNVA+E+ KEYPDI L+ ELIDN
Sbjct: 180 ASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDN 239

Query: 239 SVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGS 298
           +VL VV+ P  Y+++V+VCPNLYGDI                  ANIGH +SIFEAVHGS
Sbjct: 240 TVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGS 299

Query: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358
           APDIAGQ+ ANPTALLLSSVMMLNHMGL  HADQI++AVL+T+AS  +NRT DLAGTATT
Sbjct: 300 APDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATT 359

Query: 359 SSFTEAVIKRL 369
           SSFT+AVI+RL
Sbjct: 360 SSFTKAVIERL 370

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/373 (79%), Positives = 325/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRSNLFRN--TSRRFLAT-VK-QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVK 56
           MLR++L RN  T+RRFLAT VK QPSIGRFTGKPNP+TG++ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 57  KIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNL 116
            IF AA VPI WE CDV PIFVNGLTTIPD AV SI  NLIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176
           TLRKTF LFANVRPAKS+EGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELI 236
           RDASERVIRYAFEYA+AIGRPRV+VVHKSTIQRLADGLFVNVAKELSKEYP+I LETELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVH 296
           DN+VL VV+NP+ YT+AVSVCPNLYGDI                  ANIG++ISIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356
           GSAPDIAGQ+KANPTALLLSSVMMLNHMGL + A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 357 TTSSFTEAVIKRL 369
           TTSSFT+AVIK L
Sbjct: 361 TTSSFTDAVIKNL 373

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/369 (77%), Positives = 320/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M R ++ +  S RFLAT KQPSIGR+TGKPNP TG+YTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPIEWESCDV+PIFVNGLTTIPD AV SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARA+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYPDI L+TEL+DN+V
Sbjct: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           LK V +P AY + V VCPNLYGDI                  ANIGH +SIFEAVHGSAP
Sbjct: 240 LKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           FT+AVI+RL
Sbjct: 360 FTDAVIERL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/369 (77%), Positives = 319/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+ ++R +  R + T  QP+IGRFTGKPNP TG+YTV FIEGDG+GPEISKSVK IF 
Sbjct: 1   MLRNTIYRGSFARMM-TTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPIEWE CDV PIFVNGLTTIPDAAVQSI  +L+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TF LFANVRPA+SV  +KTTY+NVDLVLIRENTEGEYSGIEH++ PGV+QSIKLIT+DAS
Sbjct: 120 TFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEY RAIGRPR++VVHKSTIQR+ADGLFVNVAKEL+ EYPDI L+TELIDN++
Sbjct: 180 ERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTI 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VVT+P +YT+AVSVCPNLYGDI                  ANIG K+SIFEAVHGSAP
Sbjct: 240 LNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL  HA +I+NA+LSTIASG ENRTGDLAGTATTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVI +L
Sbjct: 360 FTEAVINKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/369 (76%), Positives = 319/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M +S+  RN S RFLAT KQPSIGR+TGKP+P+TG+YTVSFIEGDG+GPEISK+VK IF 
Sbjct: 1   MFKSSFVRN-SARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA  PI+WESCDV+P+F+NGLTTIP  A  SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSV+G+KT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARA+ RP+V+VVHKSTIQRLADGLFV+VA++LSKEYPDI L+TELIDN+V
Sbjct: 180 ERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTV 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L  V +P+ Y++ V VCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 240 LHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AV +TIA+GPE+RTGDL G+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/369 (76%), Positives = 316/369 (85%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M RS   RNT  RF AT KQPSIGR+TGKP+P+TG+YTVSFIEGDG+GPEISK+VK IF 
Sbjct: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA  PI+WE+CDV P+F+NGLTTIP  A  SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS++GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYARA+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYPDI L+TELIDN+V
Sbjct: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L  V +P  Y++ V VCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 318/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSNLFRNTSRRFLA--TVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI 58
           MLRS + R T  R LA  T KQPSIG++TGKP+P TG+YTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 59  FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTL 118
           F AA VPI WESC V P+ VNG+TTIP+ A +SI  NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178
           RKTFGLFANVRPAKSVEGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDN 238
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDI L+TELIDN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 239 SVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGS 298
           +VL VV+NPS Y++ V VCPNLYGDI                   NIGHK+SIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358
           APDIAGQ+KANPTALLLSSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 359 SSFTEAVIKRL 369
           SSFTEAVI RL
Sbjct: 361 SSFTEAVISRL 371

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/369 (75%), Positives = 318/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR  LF+  SRR+LA+V+QPSIGR+ GKPN + G+YTVSFIEGDG+GPEIS+SVK IF+
Sbjct: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+EWE CDV P+ VNGLTTIP+ AV SI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIRYAFEYAR +GRP+V+VVHKSTIQRLADGLFVNVA+EL +EYPDI L+TEL+DN+V
Sbjct: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VVT P AY + V+VCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 239 LNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAP 298

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ++ANPTALLLSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSS
Sbjct: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358

Query: 361 FTEAVIKRL 369
           FT AVI+RL
Sbjct: 359 FTNAVIERL 367

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/363 (76%), Positives = 310/363 (85%), Gaps = 4/363 (1%)

Query: 11  SRRFLATV--KQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEW 68
           ++RFL+    +QPSIGRFTGKP+ +TG+YTVSFIEGDGIGPEIS+SVK IF AA+VPI W
Sbjct: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75

Query: 69  ESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 128
           E+CDV+PI V+GLTTIPD AV+SI  NL+ LKGPLATPIGKGHRSLNLTLRKTF LFANV
Sbjct: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANV 135

Query: 129 RPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAF 188
           RPAKSV GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITRDASERVIRYAF
Sbjct: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195

Query: 189 EYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--YPDIILETELIDNSVLKVVTN 246
           EYA+AIGRP+VIVVHKSTIQRL+DGLFVNVAKEL KE  + +I L+TELIDN+VL VV N
Sbjct: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255

Query: 247 PSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQD 306
           PS Y++AV VCPNLYGDI                  ANIG KISIFEAVHGSAPDIAGQ+
Sbjct: 256 PSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQN 315

Query: 307 KANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366
           KANPTALLLSSVMML+HMGL  + D+I+NAVL TIA+  +NRTGDL GTATT+SFTEAVI
Sbjct: 316 KANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVI 375

Query: 367 KRL 369
             L
Sbjct: 376 DNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/369 (72%), Positives = 311/369 (84%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M  S L   T  RFL+T  QPSIGRFTGKP+P+TG++TV FIEGDG+GPEIS+SVKKIF+
Sbjct: 1   MFNSRLQLRTVSRFLST-GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFS 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VPIEW  CDV PIFVNG TTIP+ AV+ I  +LIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TF LFANVRPA+S+  +K+TYENVDLVLIRENTEGEYSGIEH++ PGV+QSIKLITR+A+
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREAT 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERV+RYAFEY +AIGRPR++V+HKSTIQR+ADGLFV VA+EL+ EYPDI LETE+ID S+
Sbjct: 180 ERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSI 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L VV+ P  Y++AVSVCPNLYGDI                  ANIG K+SIFEAVHGSAP
Sbjct: 240 LNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGQ+KANPTALLLSSVMML HMGL  HA++I+NAVL+TIASG ENRT DL+GTA+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSS 359

Query: 361 FTEAVIKRL 369
           FTE VI+RL
Sbjct: 360 FTEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/373 (71%), Positives = 316/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRSNLFRNTSRRFLATVK----QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVK 56
           MLR+   + ++RR  +T         +G++ G PNPSTGR+TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 57  KIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNL 116
            IF AA VP++WE CDV+P+ +NGLTTIP+ AVQ I  + IALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176
           TLRKTFGLFANVRPA+S+ G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELI 236
           RDASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PDI LETELI
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVH 296
           DN+VL VV +P +YT+AV+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356
           GSAPDIAGQ+KANPTALLLSS MMLN+MGL +++++I+NA+L+TIASG ENRTGDLAGTA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 357 TTSSFTEAVIKRL 369
           TTSSFTE+VIK L
Sbjct: 361 TTSSFTESVIKNL 373

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/369 (72%), Positives = 310/369 (84%), Gaps = 1/369 (0%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M +S + R    R  ++ KQPSIG+FTGKP+P TG Y VSFIEGDGIGPEISKSVK IF 
Sbjct: 1   MFKSQVCRRAVARMFSS-KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA 59

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+++ES  V PI VNG+T+IP+ A +SI  NL+ALKGPLATP+GKGHRS+NLTLRK
Sbjct: 60  AAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRK 119

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
           TFGLFAN+RPAKSVEGFKT Y+NV+LVLIRENTEGEY+GIEH + PGVVQSIKLITR+AS
Sbjct: 120 TFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREAS 179

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240
           ERVIR+A+EYARA  RPR+IVVHKSTIQRL+DGLFV+VAKEL  E+PDI LETELIDN+V
Sbjct: 180 ERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAV 239

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAP 300
           L  VT+P+ Y++AVSVCPNLYGDI                   NIGHK+SIFEAVHGSAP
Sbjct: 240 LNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+DKANPTALLLSSVMML+HMGL  HA QI+ AVL+TIA+GPE+RTGDL G+A+TSS
Sbjct: 300 DIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVIK+L
Sbjct: 360 FTEAVIKKL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/350 (76%), Positives = 301/350 (86%), Gaps = 1/350 (0%)

Query: 20  QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVN 79
           QP+IGRFTGK N S+G YTV FIEGDG+GPEISKSVK IF+AANVPI+W+ CDV PIFVN
Sbjct: 28  QPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 80  GLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGFKT 139
           GLTTIP+ AV++I  +L+ALKGPLATP+GKGHRSLNLTLRKTF LFANVRPAKSV  +K+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRV 199
           TYENVDLVLIRENTEGEYSGIEHIV PGVVQSIKLITR+ASE+VIRYA+EYA A+GRPR+
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPN 259
           IVVHKSTIQRL DGLFV +A EL  EYP I LET+++DN+VL VV+NP+ Y +AVSVCPN
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPN 266

Query: 260 LYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVM 319
           LYGDI                  ANIG K+SIFEAVHGSAPDIAGQ+KANPTALLLSSVM
Sbjct: 267 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 326

Query: 320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           MLNHMGL  HA +I+NAVLSTIASGPE+RTGDL G+ATTSSFTE VIK+L
Sbjct: 327 MLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  498 bits (1281), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/358 (66%), Positives = 281/358 (78%), Gaps = 1/358 (0%)

Query: 12  RRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESC 71
           R F+    + SIG F GKPNP TG YTV FIEGDG+GPEISKSV+ IF AA VPI+W +C
Sbjct: 20  RYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNC 79

Query: 72  DVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA 131
           D+ P+ +NG TTIP  AV  I N+LIALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA
Sbjct: 80  DIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPA 139

Query: 132 KSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA 191
           KS+    +TYENVDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+YAFEY 
Sbjct: 140 KSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT 199

Query: 192 RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYT 251
           R+IGR  +IVVHK+TIQR  DGLFV  A+E++ +YPD+ L+ ELIDN+VL  + NP  Y 
Sbjct: 200 RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYA 259

Query: 252 NAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPT 311
           ++VSVCPNLYGDI                  ANIG  + ++EAVHGSAPDIAGQDKANPT
Sbjct: 260 DSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPT 318

Query: 312 ALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           ALLLSSVMMLNHMGL  +AD I+ AVL+TI SG E RT DL G+ATT+SFT+AVI+ L
Sbjct: 319 ALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  279 bits (713), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 161/367 (43%), Positives = 220/367 (59%), Gaps = 11/367 (2%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           +FRNT      T +  + GR    P    GRYTV+ I GDGIG E++ SV +IF A NVP
Sbjct: 1   MFRNTLSHI--TKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVP 58

Query: 66  IEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFGL 124
           ++WES +++ +  N        AV+S+  N + LKG   TP  + GH SLN+  RK   +
Sbjct: 59  VDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDI 116

Query: 125 FANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVI 184
           FANV   KS  G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ 
Sbjct: 117 FANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIA 176

Query: 185 RYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLKV 243
           R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYP++ + + ++DN+ ++ 
Sbjct: 177 RFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQA 236

Query: 244 VTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDI 302
           V  P  +   V V PNLYG I                  AN G + ++FE        DI
Sbjct: 237 VAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDI 293

Query: 303 AGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFT 362
            GQD ANPTA++LSS +ML H+GL  +AD+I  A   TIA G +  T D+ GTATT+ FT
Sbjct: 294 KGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEG-KRTTKDIGGTATTTEFT 352

Query: 363 EAVIKRL 369
            AVI +L
Sbjct: 353 NAVIDKL 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  273 bits (698), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 222/372 (59%), Gaps = 16/372 (4%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+   + + RRF     Q         P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRNTFVQISKRRFALASGQLL-------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE 53

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLR 119
           A NVPI+WES +++ +  N        AV+S+  N + LKG  +TP  + GH SLN+  R
Sbjct: 54  AENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDA 179
           K   +FANV   KS  G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDN 238
           SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYP++ +++ ++DN
Sbjct: 172 SERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDN 231

Query: 239 SVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHG 297
           + ++ V  P  +   V V PNLYG I                  AN G + ++FE     
Sbjct: 232 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRH 288

Query: 298 SAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTAT 357
              DI GQD ANPTA++LSS +ML H+GL ++AD+I  A    IA G ++ T D+ G A+
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEG-KHTTKDIGGHAS 347

Query: 358 TSSFTEAVIKRL 369
           T+ FT+A++ +L
Sbjct: 348 TTQFTKAIVDKL 359

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  270 bits (691), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 222/370 (60%), Gaps = 18/370 (4%)

Query: 6   LFRNT---SRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAA 62
           +FRNT   S+R LATV    +      P    GRYTV+ I GDG+G E++ SV  IF A 
Sbjct: 1   MFRNTFAVSKRSLATVATEQL-----LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAE 55

Query: 63  NVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKT 121
           NVPI+WE+  +N   V+    +   AV+S+  N I LKG   TP  + GH SLN+  RK 
Sbjct: 56  NVPIDWET--INITGVDSEEGV-QKAVESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQ 112

Query: 122 FGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASE 181
             +FANV   K+V G KT   N+DLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SE
Sbjct: 113 LDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSE 172

Query: 182 RVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSV 240
           R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ + EYP+I ++  ++DN+ 
Sbjct: 173 RIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDNAS 232

Query: 241 LKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSA 299
           ++ V  P  +   V V PNLYG I                  AN G + ++FE       
Sbjct: 233 MQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVG 289

Query: 300 PDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTS 359
            DI G+D ANPTA++LSS +ML H+GL  +AD+I  A    IA G ++ T D+ G+++T+
Sbjct: 290 LDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEG-KHTTKDIGGSSSTT 348

Query: 360 SFTEAVIKRL 369
            FT++VI +L
Sbjct: 349 EFTKSVIDKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  269 bits (688), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 230/371 (61%), Gaps = 20/371 (5%)

Query: 6   LFRNT-SRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANV 64
           +FR++ ++R LATV           P    GRYTV+ I GDG+G E++ SV  IF A NV
Sbjct: 1   MFRHSLTKRTLATVATTE----KMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENV 56

Query: 65  PIEWESCDVNPIFVNGLTTIPD--AAVQSITNNLIALKGPLAT-PIGK-GHRSLNLTLRK 120
           P++W+  D++     G+    D  +AV+S+  N I LKG   T P  + GH SLN+ LRK
Sbjct: 57  PVDWDRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVALRK 111

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
              ++ANV   KS+ G +    +VDLV+IRENTEGE+SG+EH   PGVV+S+K++T+D  
Sbjct: 112 ELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQDNI 171

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNS 239
           ER+ R+AF+YA+   R +V+ VHK+ I ++ DGLF N+ +E+  KEYP++ +   ++DN+
Sbjct: 172 ERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNA 231

Query: 240 VLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGS 298
            ++ V NP  +   V V P++YG I                  AN G  +++FE      
Sbjct: 232 SMQTVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGSRHV 288

Query: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358
             DI GQ+ ANPTA++LSSV++LNH+GL   AD+I  AV + IA G ++ T D+ GTA+T
Sbjct: 289 GLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG-KSVTRDIGGTAST 347

Query: 359 SSFTEAVIKRL 369
           + FTEAVI +L
Sbjct: 348 TEFTEAVINKL 358

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  268 bits (686), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 211/345 (61%), Gaps = 14/345 (4%)

Query: 30  PNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVNGLTTIPDA-- 87
           P    GRYTV+ I GDG+G E++ SV KIF   N+PI+WE+ D++     GL    +   
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDIS-----GLENTENVQR 77

Query: 88  AVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDL 146
           AV+S+  N + LKG   TP  + GH SLN+ LRK   +FANV   KS+ G KT   N+D+
Sbjct: 78  AVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDM 137

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIX 265
           I +L DGLF N   E+ + EYP++ ++  ++DN+ ++ V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI GQ+ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHL 314

Query: 325 GLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GL  +AD+I  A    I+ G ++ T D+ G+A+TS FT AVI++L
Sbjct: 315 GLNAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  266 bits (681), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 221/368 (60%), Gaps = 16/368 (4%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           L R  ++R LAT  Q         P    GR+TV+ I GDG+G EI+ SVK IF A  +P
Sbjct: 2   LNRTIAKRTLATAAQAE----RALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIP 57

Query: 66  IEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFG 123
           ++WE+ ++       G+      AV+S+  N I LKG   TP  + GH SLN+ LRK   
Sbjct: 58  VDWETVNIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLD 113

Query: 124 LFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERV 183
           ++ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERI 173

Query: 184 IRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLK 242
            R+AF++A+   R  V  VHK+ I +L DGLF N+  E+  KEYPDI + + ++DN+ ++
Sbjct: 174 ARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQ 233

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                  AN G   ++FE        D
Sbjct: 234 AVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLD 290

Query: 302 IAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
           I GQ+ ANPTA++LSSV+MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ F
Sbjct: 291 IKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDF 349

Query: 362 TEAVIKRL 369
           T  +I +L
Sbjct: 350 TNEIINKL 357

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  266 bits (680), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 224/374 (59%), Gaps = 22/374 (5%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+      S+R LATV +  +      P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRNGF--GISKRSLATVAEQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 52

Query: 61  AANVPIEWESCDVNPIFVNGLTTIP--DAAVQSITNNLIALKGPLATPIGK-GHRSLNLT 117
           + NVPI+WE+ +++     GL        AV S+  N + LKG   TP  + GH SLN+ 
Sbjct: 53  SENVPIDWETVEIS-----GLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVA 107

Query: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR 177
           LRK   +FANV   K+V G  + + NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+
Sbjct: 108 LRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTK 167

Query: 178 DASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELI 236
             S+R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYP+I ++  ++
Sbjct: 168 AKSDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIV 227

Query: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AV 295
           DN+ ++ V  P  +   V V PNLYG I                  AN G + ++FE   
Sbjct: 228 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREFAVFEPGS 284

Query: 296 HGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGT 355
                DI GQ+ ANPTA++LSS +ML H+GL ++AD+I  A    IA   +N T D+ G+
Sbjct: 285 RHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEA-KNTTKDIGGS 343

Query: 356 ATTSSFTEAVIKRL 369
           A+T+ FT+A+I++L
Sbjct: 344 ASTTDFTQAIIEKL 357

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  266 bits (680), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 226/367 (61%), Gaps = 19/367 (5%)

Query: 11  SRRFLATVKQPSIGRFTGKPNP----STGRYTVSFIEGDGIGPEISKSVKKIFNAANVPI 66
           ++R LATV  P+ G F G  NP      GRYTV+ I GDG+G E++ SV  IFNA N+PI
Sbjct: 7   AKRGLATV--PATG-FRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPI 63

Query: 67  EWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGKG-HRSLNLTLRKTFGL 124
           +WE  D++ +    G+    +AAV S+  N I LKG   T  G+  H SLN+ LRK   +
Sbjct: 64  DWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDI 119

Query: 125 FANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVI 184
           +ANV   K++ G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT++ SER+ 
Sbjct: 120 YANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIA 179

Query: 185 RYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSK-EYPDIILETELIDNSVLKV 243
           R+AF++A+   R  V  VHK+ I +L DGLF N    + + EYPDI + + ++DN+ ++ 
Sbjct: 180 RFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQS 239

Query: 244 VTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDI 302
           V  P  +   V V P++YG I                  AN G + ++FE        DI
Sbjct: 240 VAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDI 296

Query: 303 AGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFT 362
            GQ+ ANPTA++LSS ++L H+GL N A +I++AV  TIA G +  T D+ G+A+T+ FT
Sbjct: 297 KGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFT 355

Query: 363 EAVIKRL 369
             +IK+L
Sbjct: 356 NEIIKKL 362

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  265 bits (678), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 222/374 (59%), Gaps = 21/374 (5%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRS L    S+R LAT+    +      P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRSGL--GVSKRSLATMAAEQL-----LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 61  AANVPIEWESCDVNPIFVNGLTTIP--DAAVQSITNNLIALKGPLATPIGK-GHRSLNLT 117
           + N+PI+WE+ +++     GL        AV+S+  N + LKG   TP  + GH SLN+ 
Sbjct: 54  SENIPIDWETVEIS-----GLDNQEGVQKAVESLKRNKVGLKGIWHTPSDQTGHGSLNVA 108

Query: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR 177
           LRK   +FANV   KSV G  + + NVD+V+IRENTEGEYSG+EH   PGVV+S+K++T+
Sbjct: 109 LRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPGVVESLKIMTK 168

Query: 178 DASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELI 236
             SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+ +KEYP+I ++  ++
Sbjct: 169 AKSERIGRFAFDFAVKNNRKSVCAVHKANIMKLGDGLFRNCINEVGAKEYPEIDVKNIIV 228

Query: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AV 295
           DN+ ++ V  P  +   V V PNLYG I                  AN G + ++FE   
Sbjct: 229 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGS 285

Query: 296 HGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGT 355
                DI GQ+ ANPTA++LSS +ML H+GL  +AD+I  A    IA   +  T D+ G+
Sbjct: 286 RHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEA-KTTTQDIGGS 344

Query: 356 ATTSSFTEAVIKRL 369
           A+T+ FTEA+I +L
Sbjct: 345 ASTTEFTEAIISKL 358

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  265 bits (677), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 221/368 (60%), Gaps = 16/368 (4%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           L R  ++R LAT  Q         P    GR+TV+ I GDG+G EI+ SV+ IF A N+P
Sbjct: 2   LNRTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIP 57

Query: 66  IEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFG 123
           I+WE+ ++       G+      AV+S+  N I LKG   TP  + GH SLN+ LRK   
Sbjct: 58  IDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLD 113

Query: 124 LFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERV 183
           ++ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERI 173

Query: 184 IRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLK 242
            R+AF++A+   R  V  VHK+ I +L DGLF N+  E+  KEYPDI + + ++DN+ ++
Sbjct: 174 ARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQ 233

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                  AN G   ++FE        D
Sbjct: 234 AVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLD 290

Query: 302 IAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
           I GQ+ ANPTA++LSS +MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ F
Sbjct: 291 IKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDF 349

Query: 362 TEAVIKRL 369
           T  +I +L
Sbjct: 350 TNEIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  264 bits (675), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/368 (41%), Positives = 225/368 (61%), Gaps = 16/368 (4%)

Query: 6   LFRNT-SRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANV 64
           +F+++ ++R L T+ + +I      P    GR+TV+ + GDG+G EI+ SV  IF + NV
Sbjct: 1   MFKHSVTKRSLVTLAKETI-----IPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENV 55

Query: 65  PIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFG 123
           PI+WE+ D++ +     T    AAV S+  N I LKG   TP  + GH SLN+  RK   
Sbjct: 56  PIDWETVDISGL---DHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLD 112

Query: 124 LFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERV 183
           ++ANV   KS+EG KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+
Sbjct: 113 IYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERI 172

Query: 184 IRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVN-VAKELSKEYPDIILETELIDNSVLK 242
            R+AF++A+   R  V  VHK+ I +L+DGLF N V+K   +EYP+I   + ++DN+ ++
Sbjct: 173 ARFAFDFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQ 232

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                   N G   ++FE        D
Sbjct: 233 AVAKPHQFD--VMVTPSMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLD 289

Query: 302 IAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
           I GQ+ ANPTA+LLS+ ++L+H+GL   A++I++AV   IA G    T D+ G+A+T+ F
Sbjct: 290 IKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEF 348

Query: 362 TEAVIKRL 369
           T+AVI +L
Sbjct: 349 TQAVINKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 218/369 (59%), Gaps = 19/369 (5%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           L R  S+R LAT+ +      T  PN   GRYTV+ + GDG+G E + SV  +FNA N+P
Sbjct: 2   LRRLVSKRSLATLPE------TLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP 55

Query: 66  IEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIG--KGHRSLNLTLRKTF 122
           I+WE  +++ +    G+     AAVQS+  N I LKG   T      GH SLN+  RK  
Sbjct: 56  IDWEIVNISGLDHKEGVA----AAVQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQL 111

Query: 123 GLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASER 182
            ++ANV   KS++G KT   +VDLV+IRENTEGE+SG+EH    GVV+S+K+ T   +ER
Sbjct: 112 DIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTER 171

Query: 183 VIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVL 241
           + R+AF YA+  GR  V  VHK+ I +L DGLF N    +  KEYPDI   + ++DN+ +
Sbjct: 172 IARFAFNYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASM 231

Query: 242 KVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAP 300
           + V  P  +   V V P++YG I                  AN G + ++FE        
Sbjct: 232 QAVAKPHQFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGL 288

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DI GQ+ ANPTA+LLSS +MLNH+GLT    +I +AV   IA G + RT D+ G ATT+ 
Sbjct: 289 DIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTE 347

Query: 361 FTEAVIKRL 369
           FT+AVI++L
Sbjct: 348 FTQAVIEKL 356

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  261 bits (666), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 221/368 (60%), Gaps = 16/368 (4%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           L R  ++R LAT  Q         P    GR+TV+ I GDG+G EI+ SV+ IF A  +P
Sbjct: 2   LNRTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIP 57

Query: 66  IEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFG 123
           ++WE+ ++       G+      AV+S+  N I LKG   TP  + GH SLN+ LRK   
Sbjct: 58  VDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLD 113

Query: 124 LFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERV 183
           ++ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERI 173

Query: 184 IRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSK-EYPDIILETELIDNSVLK 242
            R+AF++A+   R  V  VHK+ I +L DGLF N+  E+ + EYPDI + + ++DN+ ++
Sbjct: 174 ARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQ 233

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                  AN G   ++FE        D
Sbjct: 234 AVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLD 290

Query: 302 IAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
           I GQ+ ANPTA++LSSV+MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ F
Sbjct: 291 IKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDF 349

Query: 362 TEAVIKRL 369
           T  VI +L
Sbjct: 350 TNEVINKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  260 bits (665), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 215/369 (58%), Gaps = 19/369 (5%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           +FR   RR +A++ +  +      P    GRYTV+ I GDG+G EI+ SV  IF A N+P
Sbjct: 1   MFRTVQRRGMASMAKELV-----LPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP 55

Query: 66  IEWESCDVNPIFVNGLTTIPDA--AVQSITNNLIALKGPLATPIG-KGHRSLNLTLRKTF 122
           ++WE  D++         I D   AV+S+  N I LKG   T      H S N+ LRK  
Sbjct: 56  VDWERVDIST-----SDNIQDVSQAVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQL 110

Query: 123 GLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASER 182
            +FA+V   KSV G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER
Sbjct: 111 DMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSER 170

Query: 183 VIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVL 241
           + R+AF++A+   R  V  VHK+ I ++ DGLF N   E+ + EYPDI   + ++DN+ +
Sbjct: 171 IARFAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASM 230

Query: 242 KVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAP 300
           + V  P  +   V V P++YG I                  A+ G + ++FE        
Sbjct: 231 QAVAKPHQFD--VMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGL 287

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DI G++ ANPTA++LSS +ML H+GLT  A +I  A    I+ G +  T D+ G+A+T+ 
Sbjct: 288 DIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTE 346

Query: 361 FTEAVIKRL 369
           FTEA+IKRL
Sbjct: 347 FTEAIIKRL 355

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  253 bits (645), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/359 (42%), Positives = 212/359 (59%), Gaps = 14/359 (3%)

Query: 18  VKQPSIGRFTGK----PNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDV 73
           V + SI  FT      P    GRYTV+ I GDGIG E++ SV KIF +  +PI+WE  DV
Sbjct: 6   VSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV 65

Query: 74  NPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAK 132
            P   N        AV+S+  N I LKG   T   + G+ SLN+ LRK   +FANV   K
Sbjct: 66  -PGMSN--ENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFK 122

Query: 133 SVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYAR 192
           S++G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++A 
Sbjct: 123 SLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFAL 182

Query: 193 AIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLKVVTNPSAYT 251
              R  V  VHK+ I +L+DGLF N   E+  KEYPDI + T ++DN+ ++ V  P  + 
Sbjct: 183 ENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQFD 242

Query: 252 NAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPDIAGQDKANP 310
             V V P++YG I                  AN G + ++FE        DI  Q+ ANP
Sbjct: 243 --VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANP 299

Query: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           TA++LS+ +MLN +GL   + +I NAV + I  G +  T D+ G A+T+ FT+AVI +L
Sbjct: 300 TAMILSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  253 bits (645), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 151/368 (41%), Positives = 217/368 (58%), Gaps = 16/368 (4%)

Query: 6   LFRNT-SRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANV 64
           +FR T ++R LAT     I + T  P    GR TV+ + GDG+G EI+ SV  IF A NV
Sbjct: 1   MFRQTIAKRTLATF----IPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENV 56

Query: 65  PIEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTF 122
           PI+WE+ D++ +   +G+    +AAV+S+  N I LKG   T   + GH SLN+  RK  
Sbjct: 57  PIDWETVDISQLDHEDGV----NAAVESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQL 112

Query: 123 GLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASER 182
            ++ANV   KS+ G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER
Sbjct: 113 DIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVNSER 172

Query: 183 VIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLK 242
           + ++AF++A    R  V  VHK+ I +L+DGLF N    + + YP I  ++ ++DN+ ++
Sbjct: 173 IAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQ 232

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                   N G + ++FE        D
Sbjct: 233 AVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLD 289

Query: 302 IAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSF 361
           I GQ+ ANPTA++LSS ++L H+GL + A +I  AV   I  G    T D+ G A+T+ F
Sbjct: 290 IKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEF 348

Query: 362 TEAVIKRL 369
           T+AVI +L
Sbjct: 349 TKAVIDKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  251 bits (642), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 214/369 (57%), Gaps = 18/369 (4%)

Query: 6   LFRN--TSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAAN 63
           +FRN  + R F +   + +I      P    GRYTV+ + GDG+G EI+ SV  IF A N
Sbjct: 1   MFRNLISKRAFTSIASRENI-----IPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAEN 55

Query: 64  VPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTF 122
           +PI+WE  +++ +    + T    AV+S+  N I LKG   T     GH S N+ LRK  
Sbjct: 56  LPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKEL 111

Query: 123 GLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASER 182
            ++ANV   KS +G  T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T   +ER
Sbjct: 112 DIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTER 171

Query: 183 VIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVL 241
           + R+AF+YA    R  V  VHK+ I +L DGLF N+  E+ +KEYP++ + + ++DN+ +
Sbjct: 172 IARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASM 231

Query: 242 KVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAP 300
           + V  P  +   V V P++YG I                  AN G   ++FE        
Sbjct: 232 QAVAKPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGL 288

Query: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DI  Q+ ANPTA++LS+ +MLNH+G  N A +I  AV   IA G +  T D+ G+ATT+ 
Sbjct: 289 DIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEG-KTTTRDIGGSATTTE 347

Query: 361 FTEAVIKRL 369
           FT AVI +L
Sbjct: 348 FTNAVIAKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  251 bits (640), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 213/349 (61%), Gaps = 21/349 (6%)

Query: 30  PNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPI-FVNGLTTIPDAA 88
           P    GR+ V+ I GDG+G E++ SV  IF A N+PI+W+  D++ +    G+     AA
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGV----QAA 77

Query: 89  VQSITNNLIALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENV 144
           V S+  N I LKG      A   GKG  SLN+ LRK   ++ANV   KSV G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 145 DLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHK 204
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T D +ER+ R+AF++A+   R  V  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 205 STIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGD 263
           + I +L DGLF NV   +  +EYPD+ + + ++DN+ ++ V  P  +   V V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 264 IXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGS---APDIAGQDKANPTALLLSSVMM 320
           I                  AN G + ++FE   GS     DI  ++ ANPTA++LS+ +M
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEP--GSRHVGLDIKDKNIANPTAMILSASLM 310

Query: 321 LNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           L+H+GL+  A +I NAV   IA G ++ T D+ G+A+T+ FT+AVI++L
Sbjct: 311 LDHLGLSTSATKISNAVHQVIAEG-KSTTPDIGGSASTTEFTQAVIEKL 358

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  240 bits (613), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 214/371 (57%), Gaps = 27/371 (7%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+ L R    R ++T+           P    GR+ ++ I G+GIG E++ SV+ IF 
Sbjct: 1   MLRNTLLR----RSISTIS----------PKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ 46

Query: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120
           A N+PI+WE  ++     +G+ T    AV SI  N IALKG  ++    G  SLN+ LRK
Sbjct: 47  AENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVALRK 99

Query: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180
              +FANV   KS +   T   NVDLV+IRENTEGE+SG+EH    GVV+S+K++T+  +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKT 159

Query: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNS 239
           ER+ R+AF++A+   R  V  VHK+ I +L DGLF N+   + + EYP+I   + ++DN+
Sbjct: 160 ERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNA 219

Query: 240 VLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGS 298
            ++ V  P  +   V V P++YG I                  AN G   ++FE      
Sbjct: 220 SMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHV 276

Query: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358
             DI GQ+ ANPTA++LS+  ML H+GLT+ A++I NAV   IA G    T D+ GTA+T
Sbjct: 277 GLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG-TTVTKDIGGTAST 335

Query: 359 SSFTEAVIKRL 369
           + FT+AVI  L
Sbjct: 336 TEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  213 bits (541), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 181/310 (58%), Gaps = 15/310 (4%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           L R  ++R LAT  Q         P    GR+TV+ I GDG+G E++ SVK IF A N+P
Sbjct: 2   LNRTIAKRSLATAAQVE----HILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIP 57

Query: 66  IEWESCDVNPI-FVNGLTTIPDAAVQSITNNLIALKGPLATPIGK-GHRSLNLTLRKTFG 123
           I+WE+ ++       G+    + AV+S+  N I LKG   TP  + GH SLN+ LRK   
Sbjct: 58  IDWETINIKQTDHKEGV----NEAVESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLD 113

Query: 124 LFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERV 183
           ++ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERI 173

Query: 184 IRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKEL-SKEYPDIILETELIDNSVLK 242
            R+AF++A+   R  V  VHK+ I +L DGLF N+  E+  KEYPDI + + ++DN+ ++
Sbjct: 174 ARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQ 233

Query: 243 VVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFE-AVHGSAPD 301
            V  P  +   V V P++YG I                  AN G   ++FE        D
Sbjct: 234 AVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLD 290

Query: 302 IAGQDKANPT 311
           I GQ+ ANPT
Sbjct: 291 IKGQNVANPT 300

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  163 bits (413), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 194/390 (49%), Gaps = 41/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLR+ ++R  +RR +               N +    T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46

Query: 61  --AANVPIEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
                  I+++  D++     F++    +PD  V  +      AL G + +P  K  G+ 
Sbjct: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167
           S  + LRK  GL+AN+RP KSV G  T    VD+V++RENTE  Y     + I+      
Sbjct: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224

Query: 224 KE----YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           ++    Y ++    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 282

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G  I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 283 PS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  160 bits (405), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 123/355 (34%), Positives = 178/355 (50%), Gaps = 31/355 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFNAANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSI 92
           T+  I GDGIG E+  + K++    N    ++++  D+   F   L T   +PD  VQ +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256
           V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
            PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G  + A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/385 (31%), Positives = 186/385 (48%), Gaps = 37/385 (9%)

Query: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65
           + R + R+F  + +  S          S    T+  I GDGIG E+  + K++    N  
Sbjct: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50

Query: 66  --IEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLT 117
             + +E  D+      F++    +P   V  + N    AL G + +P  K  G+ S  + 
Sbjct: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQ 110

Query: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQSI 172
           LRK  GLFANVRP K+VEG  T  + +DLV++RENTE  Y  IE           + ++ 
Sbjct: 111 LRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEAT 168

Query: 173 KLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--- 225
           K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +    
Sbjct: 169 KRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKS 228

Query: 226 -YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXAN 284
            Y  +    +++D+ V ++   P  +   V V PNLYGDI                  AN
Sbjct: 229 LYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGLVPS-AN 285

Query: 285 IGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASG 344
           +G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I  AV + I   
Sbjct: 286 VGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDN 345

Query: 345 PENRTGDLAGTATTSSFTEAVIKRL 369
            + +T DL G +TT    + ++ +L
Sbjct: 346 -KIKTADLGGDSTTQQVIDDILGKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 187/390 (47%), Gaps = 40/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRS   +    R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 2   MLRSAANKLAGCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLQ 48

Query: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
           + N    + ++  D+   F     T   +PD  VQ +      AL G + +P  K  G+ 
Sbjct: 49  SLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYS 108

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LRK  GL+AN+RP KSVEG  +    VD++++RENTE  Y  IE           
Sbjct: 109 SPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIVRENTEDLYIKIEKTYIDKATGTR 166

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V ++ K I+  A++R+   A + A    +  G+  + V HKS +   +DGLF  V +E+ 
Sbjct: 167 VAEATKRISEIATQRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMY 226

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 227 EANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVV 284

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV +
Sbjct: 285 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDA 343

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G   +T DL G ATT +  + ++ RL
Sbjct: 344 NLRDGLV-KTADLGGNATTQNVVDDILARL 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 119/354 (33%), Positives = 178/354 (50%), Gaps = 28/354 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFNAANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSI 92
           T+  I GDGIG E+  + K++    N    + ++  D+   F   L T   +PD  +Q +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
            N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 150 RENTEG------EYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRV 199
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 200 IVVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVS 255
            V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +   V 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  +NP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 316 SSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+ +ML  +G    A  I  AV + +    + +T DL G +TT   TE V+ RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  157 bits (397), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 185/390 (47%), Gaps = 40/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRS   R ++ R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
             N    + +   D+   F     T   +PD  V+ +      AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  N A  I  AV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G   +T DL G A+T    E V+ RL
Sbjct: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 194/396 (48%), Gaps = 52/396 (13%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58
           MLR +++   +R+F     Q +IG  + K N      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47

Query: 59  ---------FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIG 108
                    FN  ++   W++      F++    +P   V+++  N   AL G + +P  
Sbjct: 48  TIGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTT 101

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCP 166
           K  G+ S  + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y  +E     
Sbjct: 102 KVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYID 159

Query: 167 G-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217
                 V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  
Sbjct: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219

Query: 218 VAKELSKE----YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXX 273
           V KE+ +     Y DI    ++ID+ V ++   P  +   V V PNLYGDI         
Sbjct: 220 VCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALV 277

Query: 274 XXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333
                    AN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  I
Sbjct: 278 GSLGVVPS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDI 336

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           Q AV S +    + +T DL G  +TS     VI+RL
Sbjct: 337 QTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 192/396 (48%), Gaps = 55/396 (13%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58
           MLRS +    +RR  A+  +P                T+  I GDGIG E+  + K +  
Sbjct: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44

Query: 59  ---------FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIG 108
                    FN  ++   W++      F++    +PD  ++ + ++   AL G + +P  
Sbjct: 45  NLSSKHNLKFNFIDLQAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTN 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+ANVRP KSV+G  T    VD++++RENTE  Y     + I+
Sbjct: 99  KVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYID 156

Query: 162 HIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217
                 V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  
Sbjct: 157 EKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFRE 216

Query: 218 VAK---ELSKE-YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXX 273
           V K   E +KE Y  I    +++D+ V ++   P  +   V V PNLYGDI         
Sbjct: 217 VCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALV 274

Query: 274 XXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333
                    AN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG T  A  I
Sbjct: 275 GSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDI 333

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
             AV + I    + +T DL G +TT    + ++ ++
Sbjct: 334 HKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  155 bits (392), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/359 (33%), Positives = 170/359 (47%), Gaps = 39/359 (10%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFNAAN-----------VPIEWESCDVNPIFVNGLTTIPD 86
           T+  I GDGIG E+  + KKI  + N           +   WE+      F N    +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75

Query: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143
             +  + N    AL G + +P  K  G+ S  + LRK  GLFANVRP KSV+G K     
Sbjct: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RK 133

Query: 144 VDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI---- 194
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+      
Sbjct: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAY 250
           G   + V HKS +   +DGLF  V +E       +Y  +    +++D+ V ++   P  +
Sbjct: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253

Query: 251 TNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANP 310
              V V PNLYGDI                  AN+G  I I E  HGSAPDIAG+  +NP
Sbjct: 254 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNP 310

Query: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            A + S+ +ML  +G    A  I  AV + I  G +  T DL G +TT    E V+ +L
Sbjct: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 171/353 (48%), Gaps = 28/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFNA----ANVPIEWESCDVN-PIFVNGLTTIPDAAVQSI 92
           T+  I GDGIG E+  + +++  A     ++   +E  D     F+     +P A V+++
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81

Query: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
                 AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + VDLV++
Sbjct: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERV----IRYAFEYARAIGRPRVI 200
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256
           V HKS +    DGLF  V +E+     K Y  I    +++D+ V ++   P  +   V V
Sbjct: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316
            PNLYGD+                   N+G+ I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 APNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315

Query: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 175/359 (48%), Gaps = 39/359 (10%)

Query: 38  TVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGLTTIPD 86
           T+  I GDGIG E+  + K+I           F   ++   WE+      F N    +PD
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79

Query: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143
             V+ +  +   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T    
Sbjct: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137

Query: 144 VDLVLIRENTEGEYSGIEHIVC-PG----VVQSIKLITRDASERVIRYAFEYA----RAI 194
           VD+V++RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAY 250
           G   + V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +
Sbjct: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257

Query: 251 TNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANP 310
              V V PNLYGDI                  AN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 258 D--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANP 314

Query: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            A + S+ +ML  +G    A  I  AV S I    + +T DL G +TT    + ++ ++
Sbjct: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 125/390 (32%), Positives = 185/390 (47%), Gaps = 40/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M RS   R ++ R LA+             N +    T+  I GDGIG E+  + K+I  
Sbjct: 1   MFRSVATRISACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQILE 47

Query: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
             N    + +   D+   F     T   +PD  ++ + +    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LR+  GL+ANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V  +IK I+  A+ R+ + A + A    +  G   + V HKS +   +DGLF  + K++ 
Sbjct: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G  I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I  AV +
Sbjct: 284 PS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G    T DL G A+T    + V+ RL
Sbjct: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 184/390 (47%), Gaps = 40/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M RS   R ++ R LA+             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MFRSVATRLSACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
             N    + +   D+   F     T   +PD  V+ +      AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V  + K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF  + KE+ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDA 342

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G   +T DL G A+T    + V+ RL
Sbjct: 343 NLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 118/396 (29%), Positives = 187/396 (47%), Gaps = 55/396 (13%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58
           M RS++ +  +RR  +  K   IG                 I GDGIG E+  + K++  
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIG----------------LIPGDGIGKEVIPAGKQVLE 44

Query: 59  ---------FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIG 108
                    F+  ++   WE+      F      +PD  V+ +      AL G + +P  
Sbjct: 45  ALGSKHGLQFDFIDLKAGWEA------FQQQGKALPDDTVKVLKEQCQGALFGAVQSPTT 98

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161
           K  G+ S  + LRK  GL+ANVRP KSVE  K    NVD++++RENTE  Y     + ++
Sbjct: 99  KVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVD 156

Query: 162 HIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217
                 V ++IK I+  A+ ++   A + +    ++ G   + V HKS +   +DGLF  
Sbjct: 157 EATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFRE 216

Query: 218 VAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXX 273
           + K++      +Y ++    +++D+ V ++   P  +   V V PNLYGDI         
Sbjct: 217 ICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALV 274

Query: 274 XXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333
                    AN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I
Sbjct: 275 GSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDI 333

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
             AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 334 YKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  149 bits (376), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 180/390 (46%), Gaps = 40/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           M RS   R ++ R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MFRSVATRVSACRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
             N    + +   D+   F     T   +PD  V  +      AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LR+  GLFANVRP KSVEG +   + +D+V++RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V  + K I+  A+ R+   A + A    +  G   + V HKS +    DGLF  + KE+ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVY 225

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDA 342

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G    T DL G A+T    + V+ RL
Sbjct: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 181/374 (48%), Gaps = 42/374 (11%)

Query: 24  GRFTGKPNPSTGRYTVSFIEGDGIGPEI----SKSVKKI-------FNAANVPIEWESCD 72
           G+ + +   ++  +T+  I GDGIG E+     K ++KI       F   ++   W++  
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64

Query: 73  VNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129
               F++    +PD  V+ + NN   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120

Query: 130 PAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVI 184
           P KSV+G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178

Query: 185 RYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL---SKEYPDIILETELID 237
             A E A    +  G   + V HKS +   +DGLF  + K +   +K++ ++    +++D
Sbjct: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238

Query: 238 NSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHG 297
           + V ++   P  +   V V PNLYGDI                   N+G  I I E  HG
Sbjct: 239 SMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHG 295

Query: 298 SAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGT 355
           SAPDI GQ  ANP A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G 
Sbjct: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352

Query: 356 ATTSSFTEAVIKRL 369
           +T       ++ R+
Sbjct: 353 STGEQVANDILSRI 366

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 119/390 (30%), Positives = 184/390 (47%), Gaps = 42/390 (10%)

Query: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60
           MLRS + R  +RR  A+  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45

Query: 61  --AANVPIEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112
             +    + ++  D+      F      +P+  VQ + N    AL G + +P  K  G+ 
Sbjct: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105

Query: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E           
Sbjct: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163

Query: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++ 
Sbjct: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223

Query: 223 ---SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  +    +++D+ V ++   P  +   V V PNLYGDI               
Sbjct: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 281

Query: 280 XXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339
              AN+G +I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV +
Sbjct: 282 PS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +    + +T DL G +TT    E ++ +L
Sbjct: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 172/364 (47%), Gaps = 40/364 (10%)

Query: 33  STGRYTVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGL 81
           +T   T+  I GDGIG E+  + K +           FN  ++   W++      F++  
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTG 70

Query: 82  TTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFK 138
             +PD  +  + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV    
Sbjct: 71  KALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---L 127

Query: 139 TTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA-- 191
           +  + +D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A  
Sbjct: 128 SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQ 187

Query: 192 --RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----IILETELIDNSVLKVVT 245
             +  G   + V HKS +   +DGLF  + +++ +   D    I    +++D+ V ++  
Sbjct: 188 RQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFR 247

Query: 246 NPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQ 305
            P  +   V V PNLYGDI                  AN+G    + E  HGSAPDIAG+
Sbjct: 248 EPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGK 304

Query: 306 DKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
             +NP A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    + V
Sbjct: 305 GISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDV 363

Query: 366 IKRL 369
           + R+
Sbjct: 364 LSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 168/359 (46%), Gaps = 40/359 (11%)

Query: 38  TVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGLTTIPD 86
           T+  I GDGIG E+  + +++           F+  ++   W++      F      +PD
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQT------FQETGKALPD 75

Query: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143
             +  + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132

Query: 144 VDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAI 194
           VD++++RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  
Sbjct: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192

Query: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPD----IILETELIDNSVLKVVTNPSAY 250
           G   + V HKS +   +DGLF  V +++ +   D    I    +++D+ V ++   P  +
Sbjct: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252

Query: 251 TNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANP 310
              V V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +NP
Sbjct: 253 D--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNP 309

Query: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            A + S+ +ML  MG    A  I  AV + +      +T DL G +TT    E V+ R+
Sbjct: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  137 bits (344), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 175/354 (49%), Gaps = 29/354 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFN--AANVPIEWESCDVNPIFVNGLTT---IPDAAVQSI 92
           T+  I GDGIG E+  + K++    ++   + +   D+   F   L T   +PD  V+ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 93  TNNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149
                  L G + +P  +   + S  + LRK   L+AN+RP KSV G  +  + VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143

Query: 150 RENTEGEYSGIEHIVCPG----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 202 VHKSTIQRLADGLFVNVAKELSK----EYPDIILETELIDNSVLKVVTNPSAYTNAVSVC 257
            HKS +   +DGLF  + K++ +    +Y  I    ++ID+ V ++   P  +   V V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261

Query: 258 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317
           PNLYGDI                  AN+G  I + E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 318 VMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
            +ML  +G    A  I  AV S +    EN  +T DL G ++T +  + V+++L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 94/352 (26%), Positives = 152/352 (43%), Gaps = 34/352 (9%)

Query: 42  IEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVNGL------TTIPDAAVQSITNN 95
           + GD IG E+ +   K+  A    +     D     V G       + +PD A+ +    
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 96  LIALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSVEGFK----TTYE 142
              L G +  P  +G      + L L LR+  G++AN+RP    A S+            
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 143 NVDLVLIRENTEGEYSGIEH-IVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VI 200
           + D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 201 VVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNL 260
            + K+ +   +      V +    E+P++ L+ +LID++ + +V NP A+ N V V  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDI-AGQDKANPTALL 314
           +GDI                        +      ++E  HGSAPD+ AG  KANP   +
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPAG--KANPIGCI 305

Query: 315 LSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
           LS+ MML   + +    + ++ AV   + SG   RTGDL G+++TS   +A+
Sbjct: 306 LSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 161/357 (45%), Gaps = 34/357 (9%)

Query: 39  VSFIEGDGIGPEIS-------KSVKKIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQS 91
           +  + GD +G EI+       K++ ++ N+ N   ++       I   G+  +PD A+++
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVP-LPDEALEA 64

Query: 92  ITNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSVEGFKTTYE 142
             N+   L G +  P  G G     + L L +RK  GL+AN+RP    ++S+ G      
Sbjct: 65  SKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 143 NV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRP 197
            +    D +++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPP 183

Query: 198 RVIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+   N + +
Sbjct: 184 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNPTQL-NGIII 242

Query: 257 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPT 311
             N++GDI                        +      ++E  HGSAPD+  + K NP 
Sbjct: 243 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPI 301

Query: 312 ALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           A +LS+ MML   + L    D I+ AV   + +G   RTGDL G+ +T+   +A+ K
Sbjct: 302 ATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG--IRTGDLGGSNSTTEVGDAIAK 356

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 154/356 (43%), Gaps = 32/356 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSI 92
           ++   GD IG EI +   K+ +A      NV  ++    +    ++     + D A+Q  
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 93  TNNLIALKGPLATPIGKGHRSLN-----LTLRKTFGLFANVRPAKSVEGF--------KT 139
            N+   L G +  P   GH  +      L +RK  G++AN+RP + V           + 
Sbjct: 67  KNSDAILLGAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKRE 125

Query: 140 TYENVDLVLIRENTEGEYSGIEHIVCP-GVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
             +  D V++RE   G Y G        GV    +  +    +R+ R A   A     P 
Sbjct: 126 IVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFLALQHNPPL 185

Query: 199 -VIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVC 257
            V  + K+ +   +      V + +  E+P + +   LID++ + +V NP+   N V + 
Sbjct: 186 PVWSLDKANVLATSRLWRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTKL-NGVVIT 244

Query: 258 PNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTA 312
            N++GDI                    A++  K   + ++E  HGSAPD+   D ANP A
Sbjct: 245 TNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DHANPIA 303

Query: 313 LLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            +LS+ MM    + LT   + I+ AV  TI +G   +TGDL G  TT+    AV K
Sbjct: 304 TILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGI--KTGDLGGKNTTTEVGNAVAK 357

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 32/276 (11%)

Query: 116 LTLRKTFGLFANVRP----AKSVEGFK----TTYENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK  GL+AN+RP    +KS+ G         +  D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRP-------RVIVVHKSTIQRLADGLFVNVA 219
           GV    +  T    ER+ R     A     P       +  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRR------TVN 207

Query: 220 KELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX---- 275
           + + +E+P + ++ +LID++ + ++ NP  + N + +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLL 266

Query: 276 -XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQI 333
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +NAV   I SG   RTGDL G  TT+   +AV   L
Sbjct: 326 ENAVKQVIESG--IRTGDLGGNNTTTEVGDAVTHAL 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 162/358 (45%), Gaps = 32/358 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSI 92
           +  + GD +G EI+    K+  A     +NV  ++E+  +    ++     +PD A+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 93  TNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKTT 140
                 L G +  P  G G     + L L +RK   L+AN+RP          +   K  
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQ 125

Query: 141 Y-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
           + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPPL 185

Query: 199 VIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVC 257
            I  + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+ + N + + 
Sbjct: 186 PIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIIIT 244

Query: 258 PNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTA 312
            N++GDI                    A++  K     ++E  HGSAPD+  ++K NP A
Sbjct: 245 SNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVA 303

Query: 313 LLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K +
Sbjct: 304 TILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 158/359 (44%), Gaps = 40/359 (11%)

Query: 42  IEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVNGL----------TTIPDAAVQS 91
           + GD +G EI+    K+  A    I     DVN  F N L            +PD A+++
Sbjct: 10  LPGDHVGQEITAEAIKVLKA----ISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEA 65

Query: 92  ITNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKT 139
                  L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 RVIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+ + N + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  ++K NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 152/355 (42%), Gaps = 32/355 (9%)

Query: 42  IEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVNGLTT------IPDAAVQSITNN 95
           + GD +G EI++   K+  A +     +  +     + G         +PDA++++   +
Sbjct: 10  LPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAAKKS 69

Query: 96  LIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFK-TTYE 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K     
Sbjct: 70  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECAR 128

Query: 143 NVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VI 200
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V 
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPVW 188

Query: 201 VVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNL 260
            + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+   N V +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQL-NGVIITNNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+  + K NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATIL 306

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+ MML   + +      ++ AV   + SG   RT DL GT+TTS   EAV+K L
Sbjct: 307 SAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVGEAVVKAL 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 161/355 (45%), Gaps = 32/355 (9%)

Query: 42  IEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSITNN 95
           + GD +G EI+    K+  A     +NV  ++E+  +    ++     +PD A+++    
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 96  LIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKTTY-E 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  + +
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 143 NVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I 
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIW 188

Query: 202 -VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNL 260
            + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+ + N + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIIITSNM 247

Query: 261 YGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                    A++  K     ++E  HGSAPD+  ++K NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATIL 306

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           S+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV + +
Sbjct: 307 SAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAEEV 359

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 171/395 (43%), Gaps = 34/395 (8%)

Query: 2   LRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYT--VSFIEGDGIGPEISKSVKKIF 59
           LRS LFR+++R +     Q +    T     +  + T  +  + GD +G EI++   K+ 
Sbjct: 51  LRSVLFRSSNRSYPLHSHQFNFIISTHHSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVL 110

Query: 60  NA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSITNNLIALKGPLATP-IGKG-- 110
           NA      NV  +++   +    ++     +PD A+++       L G +  P  G G  
Sbjct: 111 NAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSV 170

Query: 111 --HRSLNLTLRKTFGLFANVRPAK-------SVEGFK-TTYENVDLVLIRENTEGEYSG- 159
              + L L +RK   L+AN+RP          +   K    +  D+ ++RE   G Y G 
Sbjct: 171 RPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGE 229

Query: 160 IEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VIVVHKSTIQRLADGLFVNV 218
            +     GV    +  +    +R+ R A   A     P  V  + K+ +   +      V
Sbjct: 230 RKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPVWSLDKANVLASSRLWRKTV 289

Query: 219 AKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX--- 275
            + +  E+P + ++ +LID++ + +V NP+ + N V +  N++GDI              
Sbjct: 290 EETIKNEFPTLTVQHQLIDSAAMILVKNPT-HLNGVVIANNMFGDIISDEASVIPGSLGL 348

Query: 276 --XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQ 332
                     +      ++E  HGSAPD+  + K NP A +LS  MML   + +T     
Sbjct: 349 LPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIA 407

Query: 333 IQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           ++ AV   + SG   RT DL G+ +TS   +A+ K
Sbjct: 408 VEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIAK 440

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 138/307 (44%), Gaps = 27/307 (8%)

Query: 84  IPDAAVQSITNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSVE--- 135
           +PD  +++   +   L G +  P  G G     + L L +RK  GL+ N+RP K +    
Sbjct: 58  LPDETLEAAKQSDAVLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKL 116

Query: 136 -GFKTTYENV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFE 189
            G     E V    D V++RE   G Y G  +     GV    +  + +  +R+ + A  
Sbjct: 117 IGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMA-A 175

Query: 190 YARAIGRPRVIVVHKSTIQRLADG-LFVNVAKELSKEYPDIILETELIDNSVLKVVTNPS 248
           +      P + +        LA   L+     E   E+P++ ++ +LID++ + +V NP+
Sbjct: 176 FLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKNPT 235

Query: 249 AYTNAVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIA 303
              N + +  N++GDI                    A++  K     ++E  HGSAPD+A
Sbjct: 236 QL-NGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA 294

Query: 304 GQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFT 362
            + K NP A +LS+ MML   + +    + I+ AV   +  G   RT DL G +TTS   
Sbjct: 295 -RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRGI--RTADLGGNSTTSELG 351

Query: 363 EAVIKRL 369
           +AV + L
Sbjct: 352 DAVAQEL 358

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 155/356 (43%), Gaps = 32/356 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSI 92
           +  + GD +G E++    K+ NA       +   ++   +    ++   T +PD A+++ 
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 93  TNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKTT 140
                 L G +  P  G G     + L L +RK  GL+AN+RP          +   K  
Sbjct: 65  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKPE 123

Query: 141 Y-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR 198
           Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P 
Sbjct: 124 YAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPPL 183

Query: 199 VIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVC 257
            I  + K+ +   +      V + +  E+P + ++ +LID++ + +V +P+   N V + 
Sbjct: 184 PIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKL-NGVVIT 242

Query: 258 PNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTA 312
            N++GDI                        +      ++E  HGSAPD+   +K NP A
Sbjct: 243 NNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPIA 301

Query: 313 LLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            +LS+ MML   + L      ++ AV + + +G   RTGDL G+ +T+   +A+ K
Sbjct: 302 TILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTEVGDAIAK 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK   L+AN+RP          +   K  + +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  T+   +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 226 YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + L  +LID++ + +V +P+   N + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L+   + ++ AV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + SG   RTGDL G+ +TS   +A+ K
Sbjct: 330 VLDSG--VRTGDLGGSNSTSEVGDAIAK 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 151/353 (42%), Gaps = 32/353 (9%)

Query: 42  IEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSITNN 95
           + GD +G EI++   K+  A      N    ++   +    ++     +PD A+++    
Sbjct: 8   LPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEASKKA 67

Query: 96  LIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKTTY-E 142
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y +
Sbjct: 68  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQ 126

Query: 143 NVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  I 
Sbjct: 127 GTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIW 186

Query: 202 -VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNL 260
            + K+ +   +      V K + +E+P + +  +LID++ + +V NP+   N + +  N+
Sbjct: 187 SLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQL-NGIIITSNM 245

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+A + K NP A +L
Sbjct: 246 FGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATIL 304

Query: 316 SSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           S+ MML   + +      I+ AV   +  G   RTGDL G+ +TS   +AV K
Sbjct: 305 SAAMMLKLSLNMVEEGVAIEKAVKKVLDDG--IRTGDLGGSNSTSEVGDAVAK 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 156/361 (43%), Gaps = 39/361 (10%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFVNGL----------TTIPDA 87
           T+  + GD +G EI++   K+ NA     E     VN  F + L            +PD 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQ---ECRPDKVNFKFDHHLIGGAAIDATGVPLPDE 62

Query: 88  AVQSITNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVE 135
           A+++       L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 63  ALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 121

Query: 136 GFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARA 193
             K       D V++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 122 PLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQ 181

Query: 194 IGRPRVIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTN 252
              P  I  + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+ + N
Sbjct: 182 HNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPT-HLN 240

Query: 253 AVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDK 307
            + +  N++GDI                    A++  K     ++E  HGSAPD+  + K
Sbjct: 241 GIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGK 299

Query: 308 ANPTALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366
            NP A +LS+ MML   + L    + I+ AV   + SG   RT DL GT +T+   +AV 
Sbjct: 300 VNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAVA 357

Query: 367 K 367
           K
Sbjct: 358 K 358

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 160/359 (44%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGLTTIP--DAAVQS 91
           +  + GD +G EI++   K+  A      NV  ++E   +    ++  T +P  D A+++
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEA 65

Query: 92  ITNNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKT 139
                  L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRP 197
            +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPP 184

Query: 198 RVIV-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P + ++ +LID++ + +V NP+   N + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQL-NGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---ISIFEAVHGSAPDIAGQDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  ++K NP 
Sbjct: 244 TSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + +T     I++AV   + +G   RTGDL G+ +T    +AV K +
Sbjct: 303 ATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG--IRTGDLGGSNSTIEVGDAVAKEV 359

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 151/351 (43%), Gaps = 32/351 (9%)

Query: 44  GDGIGPEISKSVKKIFNA-----ANVPIEWESCDVNPIFVNGL-TTIPDAAVQSITNNLI 97
           GD +G EI+    K+  A     ++V  E++   +    ++     +PDA++++      
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAAKKADA 71

Query: 98  ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SVEGFKTTY-ENV 144
            L G +  P  G G     + L L +RK   L+AN+RP          +   K  +    
Sbjct: 72  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGT 130

Query: 145 DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPR-VIVV 202
           D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V  +
Sbjct: 131 DFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVWSL 190

Query: 203 HKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYG 262
            K+ +   +      V + +  E+P + ++ +LID++ + +V NP+   N V +  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQL-NGVIITNNMFG 249

Query: 263 DIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317
           DI                        +      ++E  HGSAPD+  + K NP A +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILSA 308

Query: 318 VMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            MML   + +      ++ AV   + SG   RTGDL G+ +T    +AV K
Sbjct: 309 AMMLELSLDMFEEGTAVEEAVRRVLDSG--IRTGDLRGSNSTQEVGDAVAK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 152/354 (42%), Gaps = 33/354 (9%)

Query: 42  IEGDGIGPEISKSVKKIFNAA------NVPIEWESCDVNPIFVNGL-TTIPDAAVQSITN 94
           + GD +G EI     K+  A        +  E++   +    ++   T +PD A+ +  N
Sbjct: 9   LPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDAAKN 68

Query: 95  NLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSVEGFKTTYENV- 144
           +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G     E + 
Sbjct: 69  SDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLGLSPLKEEIA 127

Query: 145 ---DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVI 200
              D  ++RE   G Y G  +     G     +  T    +R+ R A   A     P  I
Sbjct: 128 KGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQHDPPLPI 187

Query: 201 V-VHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPN 259
             + K+ +   +      V + +  E+P++ ++ +LID++ + +V +P    N + +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQL-NGIIITNN 246

Query: 260 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHKISIFEAVHGSAPDIAGQDKANPTALL 314
           ++GDI                        +      ++E  HGSAPD+  + K NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPIATI 305

Query: 315 LSSVMMLN-HMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           LS+ MML   + L +    I+ AV   + +G   RT DL G+ +TS   +AV K
Sbjct: 306 LSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEVGDAVAK 357

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 120/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRP----AKSVEGFKTTYENV----DLVLIRENTEGEYSGI-EHIVCP 166
           L +RK  GL+AN+RP    ++ + G       +    D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  +    ER+ R A   A     P  I  + K+ +   +      V   +  E
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNE 214

Query: 226 YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + ++ +LID++ + +V NP+   N + +  N++GDI                     
Sbjct: 215 FPTLTVQNQLIDSAAMILVKNPTQL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASLA 273

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  ++K NP A +LS+ MML   + +    + ++ AV  
Sbjct: 274 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRR 332

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + +G   RTGDL G+ +T    +A+ K
Sbjct: 333 VLDAG--VRTGDLGGSNSTQEVGDAIAK 358

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 119/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK   L+AN+RP          +   K  Y +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  +    +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + ++ +LID++ + +V +P+   N + +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  ++K NP A +LS+ MML   + L    + ++ AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + +G   RT DL G  +TS   +AV+K
Sbjct: 332 VLDAG--IRTADLRGENSTSEVGDAVVK 357

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 112/268 (41%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SVEGFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK   L+AN+RP          +   K  Y +  D  ++RE   G Y G  +     
Sbjct: 95  LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGD 154

Query: 167 GVVQSIKLITRDASERVIRYAFEYARAIGRPRVIV-VHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  +    +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 155 GVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNE 214

Query: 226 YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDIXXXXXX-----XXXXXXXXXX 280
           +P + +  +LID++ + +V NP+   N + +  N++GDI                     
Sbjct: 215 FPSLKVSHQLIDSAAMILVKNPTQL-NGIIITNNMFGDIISDEASVIPGSLGLLPSASLS 273

Query: 281 XXANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLN-HMGLTNHADQIQNAVLS 339
              +      ++E  HGSAPD+  + K NP   +LS  MML   + L      ++ AV  
Sbjct: 274 SLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRR 332

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + +    RT DL G+ +TS   +AV K
Sbjct: 333 VLDNNI--RTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 319 MMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +MLNH+GL   A +I  AV  TIA G ++ T D+ G+++T+ FT  +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%)

Query: 312 ALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           AL L    ML   G  +    ++N  +S +AS   N  G+L   ATT S T AV  R+
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAVTTRI 178

>TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {ON}
            Anc_5.559 YDR443C
          Length = 1334

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 16/173 (9%)

Query: 94   NNLIALKGPLATP---IGKGHRSLNLTL-RKTFGLFANVRPAKSVEGFK----TTYENVD 145
            N LI+    +  P   + K H  +N++   + F  F NV+PAK ++ F+    TT    D
Sbjct: 867  NELISSLSTIKEPSIYVKKHHSMMNMSADSQVFSKFLNVKPAKGIKNFRFLMLTTSYAED 926

Query: 146  LVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKS 205
             +         Y G E     G  + +KL + D+   +    F+ +R +     IV + S
Sbjct: 927  CLSFVSTLCQTYIGYEF----GFCELLKLTSDDSQGLMQLPDFDKSRLLLLAAQIVTYCS 982

Query: 206  TIQRLADGLFVNVAKELS----KEYPDIILETELIDNSVLKVVTNPSAYTNAV 254
            T +     + V +   +     +E    + + E+I N V   + N   Y   V
Sbjct: 983  TNKNAGKDVPVMILLPIECYKLEELTSKVAKFEIIHNEVTSKIPNAQIYLKVV 1035

>ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} similar
           to uniprot|P48563 Saccharomyces cerevisiae YNL297C MON2
           Peripheral membrane protein with a role in endocytosis
           and vacuole integrity interacts with Arl1p and localizes
           to the endosome member of the Sec7p family of proteins
          Length = 1621

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 4/35 (11%)

Query: 44  GDGIGPEISKSVKKIFNAANVPIEWESCDVNPIFV 78
           GD +G     S   +F+  N P EW   D NP+FV
Sbjct: 853 GDMLG----HSWSTVFSIINSPFEWGQIDANPVFV 883

>TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.352
           YLR144C
          Length = 883

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 155 GEYSGIEHIVCPGVVQSIKLITRDASERVIRYA--FEYARAIGRPRVIVVHKSTIQRLAD 212
           G  S + H + P +  SI   + +    + RY   FE     GR  +I +      R+A 
Sbjct: 335 GFVSAVYHYITPVIYSSIGFRSLEELPAISRYTQKFESILENGRKWIIYISSPDNTRIAF 394

Query: 213 GLFVNVAKELSKEYPDIILET 233
               N A    K  P+I+L+T
Sbjct: 395 KKMSNNAYSADKRLPEILLQT 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,792,817
Number of extensions: 1304203
Number of successful extensions: 3849
Number of sequences better than 10.0: 89
Number of HSP's gapped: 3644
Number of HSP's successfully gapped: 89
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)