Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2865.443ON1278127865490.0
YOR124C (UBP2)5.443ON1272127856450.0
Smik_15.3015.443ON1272127855810.0
Suva_8.1765.443ON1270127855710.0
ZYRO0G01606g5.443ON1305125735520.0
NCAS0H021005.443ON1269125735420.0
TDEL0D025805.443ON1272122835320.0
NDAI0C015505.443ON1295124633900.0
KNAG0B041905.443ON1262123733690.0
Kpol_1062.235.443ON1266123333650.0
KAFR0D050705.443ON1227124633220.0
SAKL0G02728g5.443ON1237126232930.0
TBLA0A064705.443ON1320127731690.0
CAGL0K10252g5.443ON1267128231450.0
Kwal_55.213935.443ON1233124031220.0
KLTH0F15862g5.443ON1241123830980.0
TPHA0E017105.443ON1283124130890.0
Ecym_45145.443ON1246123428800.0
KLLA0E02377g5.443ON1220124627300.0
ACL164C5.443ON138983518520.0
Kpol_1016.15.443ON1251121317630.0
TPHA0J026205.443ON1225125315410.0
TBLA0C012001.369ON503361211e-05
SAKL0D10120g1.369ON492401211e-05
KLLA0A10791g1.369ON4841091202e-05
KLTH0H13354g1.369ON495391183e-05
Ecym_27171.369ON483331174e-05
ZYRO0G01188g1.369ON500331156e-05
Kwal_34.162681.369ON449341131e-04
TDEL0D024001.369ON494331131e-04
KAFR0C045201.369ON4991021131e-04
AEL029W1.369ON446331112e-04
Kpol_2001.541.137ON1223591077e-04
Ecym_81401.137ON1264591060.001
KNAG0C019401.369ON499421040.002
Skud_6.941.369ON499481030.002
YFR010W (UBP6)1.369ON499481030.002
TDEL0C056401.137ON1178391030.002
Smik_7.3141.369ON499481020.003
Kpol_534.231.369ON496981000.004
Suva_6.2761.137ON1256701010.004
YJL197W (UBP12)1.137ON1254581010.004
NCAS0D006001.369ON493331000.004
TPHA0A025101.369ON505411000.004
NDAI0B034302.307ON856391000.005
ZYRO0C17908g1.137ON1204561010.005
Smik_10.371.137ON1247391000.005
Smik_2.497.390ON74531990.007
Skud_10.221.137ON125539990.007
CAGL0K10494g1.369ON49533980.008
TPHA0P006807.390ON72792980.009
Suva_6.831.369ON50096970.009
KNAG0A054502.307ON76440960.013
KLTH0B09944g5.18ON118995960.014
Kwal_33.136281.137ON116059960.015
Smik_4.1152.307ON79039960.016
Skud_4.1332.307ON78739950.017
YDL122W (UBP1)2.307ON80939950.018
KAFR0D021605.712ON84651950.018
NDAI0H035501.369ON50234950.018
Suva_4.1252.307ON79339950.019
Ecym_46857.390ON77831950.019
NDAI0E041807.390ON827182950.021
NCAS0I031401.137ON120176950.021
TPHA0A025401.137ON128628950.022
TBLA0E017605.712ON121240950.022
CAGL0M13783g5.18ON119696950.022
KAFR0A069102.307ON67839940.023
Smik_13.5215.18ON1231123950.024
Kpol_1003.532.307ON78840940.024
ZYRO0A02420g2.307ON74539940.026
KLTH0F03674g1.137ON119839940.027
NCAS0B061302.307ON77039930.030
Kwal_27.108427.390ON71131930.032
CAGL0H10582g2.307ON79039930.032
AGR389C2.307ON77538930.033
TPHA0G008502.307ON78239930.034
KAFR0I026005.18ON121397930.039
Suva_13.4955.18ON123095920.041
CAGL0H06721g5.712ON108179920.042
YBL067C (UBP13)7.390ON74733920.042
AFR627C1.137ON128749920.048
SAKL0E07106g2.307ON79139910.052
TBLA0B060802.307ON82439910.052
Kwal_27.114442.307ON75739910.056
TDEL0G023702.307ON74739910.057
YMR304W (UBP15)5.18ON1230131910.057
KLTH0G10934g2.307ON75839910.060
KNAG0E012905.18ON119641900.072
Kwal_26.95985.18ON119195900.086
NCAS0A143707.390ON72931890.089
KNAG0B023707.390ON75331890.097
KLLA0C03476g1.137ON125255890.11
Suva_2.507.390ON75031880.11
KLLA0A00396g5.712ON101239890.11
KAFR0F015601.137ON117129890.12
KNAG0C021801.137ON123149890.12
Klac_YGOB_Anc_5.18b5.18ON1166125880.12
Skud_13.4785.18ON1231108880.13
Kwal_55.196455.712ON97045880.13
SAKL0C04246g1.137ON129739880.14
TDEL0B020805.712ON102568880.14
SAKL0D03322g3.270ON76557880.15
KNAG0J008003.270ON76540870.16
Smik_5.2447.390ON74931870.16
Ecym_40095.712ON151730880.16
KAFR0C004103.270ON76963870.16
Smik_9.135.712ON106092870.17
AGR370W7.390ON74031870.18
AFR296C5.712ON116949870.18
KAFR0L017307.390ON70176870.18
TDEL0B036708.742ON463112860.18
Skud_5.2237.390ON74831870.19
ZYRO0D07062g5.18ON119395870.19
NDAI0B004801.137ON125369870.20
Suva_4.2953.270ON782130860.23
TPHA0E008707.390ON71531860.23
TBLA0D006207.390ON117131860.23
KNAG0C035807.390ON77631860.24
TBLA0C070205.18ON1247120860.24
TPHA0L022905.18ON119395860.24
TDEL0G004105.18ON118644860.26
Skud_2.387.390ON74831850.27
NDAI0A016707.390ON84698850.29
TPHA0D046605.712ON104526850.29
Kpol_1045.417.390ON71236850.30
NCAS0G001705.712ON103030850.30
KLTH0C06732g7.390ON71431850.33
KLLA0E20351g7.390ON69731840.34
YER098W (UBP9)7.390ON75431840.34
Suva_5.2177.390ON75431840.36
KNAG0L022005.712ON116126840.37
NCAS0E026107.390ON71731840.38
NCAS0B005808.742ON466169830.39
CAGL0G02563gsingletonON63129840.40
SAKL0F12430g7.390ON75431840.41
ZYRO0F01276g3.270ON776124830.47
CAGL0L01639g1.137ON114742830.47
YIL156W (UBP7)5.712ON107126830.49
NDAI0F002005.712ON110526830.49
TBLA0J006001.137ON146251830.52
NCAS0D023905.18ON1211128830.53
KLLA0E08801g2.307ON77139820.58
Suva_9.305.712ON106226830.59
KLTH0E00814g5.712ON97430820.61
TBLA0D010708.742ON48339820.61
NDAI0I025305.18ON119795820.73
Skud_9.125.712ON106426820.77
KAFR0A042108.742ON44094810.78
Kpol_513.255.18ON119095810.87
SAKL0E15136g5.712ON103730810.91
CAGL0A04477g7.390ON77031801.1
Kpol_1018.937.390ON75531801.2
Smik_13.4318.742ON47140791.2
ZYRO0B03300g7.390ON81331801.3
SAKL0H00418g5.18ON119031801.3
CAGL0I05522g7.390ON72431791.3
TDEL0C015707.390ON76531791.3
KNAG0G029308.742ON459169781.5
ZYRO0B16544g5.712ON104447791.5
YMR223W (UBP8)8.742ON47140781.7
Skud_11.3385.712ON71230781.7
CAGL0G05247g8.188ON94752781.8
NDAI0E008108.742ON49340781.8
Skud_13.3928.742ON47340781.8
Suva_13.4078.742ON47140782.0
Skud_2.1773.270ON782130782.2
AGL357W5.18ON116631782.4
Ecym_56715.18ON117629772.4
NDAI0G007802.307ON48639772.5
KAFR0K018107.390ON71433763.0
KLTH0C07326g3.270ON76230763.2
Kpol_1032.288.188ON88248763.4
TBLA0F011503.115ON112270763.5
NCAS0B042808.188ON92249754.2
KAFR0H001505.712ON65626754.3
NCAS0G036802.307ON48239754.4
KLTH0G11330g8.361ON50158744.6
CAGL0H05335g8.540ON48369744.6
Suva_11.3355.712ON72440745.3
KLTH0H07678g8.188ON86151745.4
NDAI0A036808.188ON111647745.5
ZYRO0A05962g8.742ON46547745.6
TDEL0B025605.667ON36249735.7
NCAS0B080101.88ON1065146746.3
CAGL0I06765g8.188ON88743736.9
YKR098C (UBP11)5.712ON71741737.2
TPHA0K002405.581ON174102707.2
SAKL0H18986g8.188ON89351737.2
NCAS0I016203.270ON79556737.3
NCAS0E031507.232ON29772727.9
TBLA0E025703.270ON78520738.6
AGR023C3.270ON780124738.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.286
         (1278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  2527   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  2179   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  2154   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  2150   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1372   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1368   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1365   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1310   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1302   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1300   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1284   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1273   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1225   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1216   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1207   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1197   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1194   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1113   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1056   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   717   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   683   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   598   0.0  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    51   1e-05
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    51   1e-05
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    51   2e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   3e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   4e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    49   6e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    48   1e-04
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    48   1e-04
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    48   1e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    47   2e-04
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    46   7e-04
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    45   0.001
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   0.002
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    44   0.002
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    44   0.002
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    44   0.002
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    44   0.003
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    43   0.004
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    44   0.004
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    44   0.004
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.004
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.004
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     43   0.005
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    44   0.005
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    43   0.005
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    43   0.007
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    43   0.007
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    42   0.008
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    42   0.009
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.009
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    42   0.013
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    42   0.014
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    42   0.015
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    42   0.016
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    41   0.017
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    41   0.018
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    41   0.018
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    41   0.018
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    41   0.019
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    41   0.019
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    41   0.021
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    41   0.021
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.022
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    41   0.022
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    41   0.022
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    41   0.023
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    41   0.024
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    41   0.024
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    41   0.026
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    41   0.027
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    40   0.030
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    40   0.032
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    40   0.032
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    40   0.033
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    40   0.034
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    40   0.039
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    40   0.041
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    40   0.042
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    40   0.042
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    40   0.048
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    40   0.052
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    40   0.052
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    40   0.056
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    40   0.057
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    40   0.057
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    40   0.060
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    39   0.072
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    39   0.086
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    39   0.089
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    39   0.097
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    39   0.11 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.11 
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    39   0.11 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    39   0.12 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    39   0.12 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    39   0.12 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    39   0.13 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    39   0.13 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    39   0.14 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.14 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    39   0.15 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    38   0.16 
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    38   0.16 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    39   0.16 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    38   0.16 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    38   0.17 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.18 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    38   0.18 
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    38   0.18 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    38   0.18 
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    38   0.19 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    38   0.19 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    38   0.20 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    38   0.23 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.23 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    38   0.23 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    38   0.24 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    38   0.24 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    38   0.24 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    38   0.26 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.27 
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    37   0.29 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.29 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    37   0.30 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      37   0.30 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    37   0.33 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.34 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    37   0.34 
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    37   0.36 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.37 
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    37   0.38 
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       37   0.39 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.40 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.41 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    37   0.47 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.47 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.49 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.49 
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    37   0.52 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    37   0.53 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.58 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    37   0.59 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    36   0.61 
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    36   0.61 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    36   0.73 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.77 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    36   0.78 
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    36   0.87 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    36   0.91 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    35   1.1  
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    35   1.2  
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    35   1.2  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    35   1.3  
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    35   1.3  
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    35   1.3  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    35   1.3  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    35   1.5  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   1.5  
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    35   1.7  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    35   1.7  
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    35   1.8  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    35   1.8  
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    35   1.8  
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    35   2.0  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   2.2  
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    35   2.4  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    34   2.4  
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               34   2.5  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    34   3.0  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    34   3.2  
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    34   3.4  
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    34   3.5  
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     33   4.2  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    33   4.3  
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    33   4.4  
KLTH0G11330g Chr7 complement(956495..958000) [1506 bp, 501 aa] {...    33   4.6  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    33   4.6  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   5.3  
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    33   5.4  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              33   5.5  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    33   5.6  
TDEL0B02560 Chr2 complement(463639..464727) [1089 bp, 362 aa] {O...    33   5.7  
NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]...    33   6.3  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    33   6.9  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    33   7.2  
TPHA0K00240 Chr11 (39455..39889,39976..40065) [525 bp, 174 aa] {...    32   7.2  
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    33   7.2  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   7.3  
NCAS0E03150 Chr5 complement(624142..625035) [894 bp, 297 aa] {ON...    32   7.9  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   8.6  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   8.6  

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 2527 bits (6549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1236/1278 (96%), Positives = 1236/1278 (96%)

Query: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60
            MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL
Sbjct: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120
            YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120

Query: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180
            PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH
Sbjct: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240

Query: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300
            LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG
Sbjct: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360
            PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG
Sbjct: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360

Query: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420
            YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF
Sbjct: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420

Query: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480
            HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY
Sbjct: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540

Query: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660
            DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660

Query: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720
            EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL
Sbjct: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780

Query: 781  SGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            SGH                  QFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXX 900
            EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDI    
Sbjct: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIENVK 900

Query: 901  XXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960
                    DIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 901  ANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960

Query: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020
            GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY
Sbjct: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020

Query: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080
            DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE
Sbjct: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080

Query: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140
            VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL
Sbjct: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140

Query: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200
            ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS
Sbjct: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200

Query: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1260
            LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS            GNTATPYFLV
Sbjct: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLV 1260

Query: 1261 YVKQGQESDIEPLKRILE 1278
            YVKQGQESDIEPLKRILE
Sbjct: 1261 YVKQGQESDIEPLKRILE 1278

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 2179 bits (5645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1063/1278 (83%), Positives = 1135/1278 (88%), Gaps = 6/1278 (0%)

Query: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60
            MP EDNELQ AIE H +QL NQ+K N   + + I+D PLYGT  + QS P  VDDGKHLL
Sbjct: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120
            YPDIAT+LPLKTSDRLLDD+LCDTIFLNSTDP V++KGLQ+ GIL+ESMLSYS+FRSSIR
Sbjct: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120

Query: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180
            PN LGSLTDQV  QTK+EYDSISCP+YNKI+VFQAVI NPSL+EQQIS+FDDIV+IPIYH
Sbjct: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDP L+DYGIYVSDDTNK
Sbjct: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240

Query: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300
            LILIEIF+PEFNSPEEHESFT DAIKKRYN +C+KNESL+K E PSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300

Query: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360
            PLTRKSK EP KTIDSGNL LNTHLN EWLTSKYGFQASSEIDEETN+ FTEYVPPDMV 
Sbjct: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360

Query: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420
            YV D   RKIRESFV+KCLQLIFWGQLS SLL PNS LKNTKSVKG+SSLQTSFST PWF
Sbjct: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420

Query: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480
            HLLGESRARILLNSNEQ HSPLDAE HFINLSVSHYYTDRDIIRNYE+LSSLDP+NIGLY
Sbjct: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQ+IIGQEALENAL+ FKI+PKE NI+ELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540

Query: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            +ETSNKS+VTSNHLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISKRSLDLFNFLT+ECPQF  YYGPEKL YQ
Sbjct: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720
            EALKLLQVNENASDET+LKIFKQKW+DE+V+EPDQFLILRAALT+ISIERNS LITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY+LEYQKT++NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780

Query: 781  SGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            SGH                  QFIYQLRNLFYAMVH+RERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXX 900
            EFEVEGNKV      +S DSK E T +A TT + KD SLIDLEMED  N DV  D     
Sbjct: 841  EFEVEGNKVVDQTGVLS-DSKKETTDDAFTT-KIKDTSLIDLEMEDGLNGDVGTD----A 894

Query: 901  XXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960
                    D E++  E+ T L SPTRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 895  NRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 954

Query: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020
            GSEPIRYDEDNEQYDL+KQLFYGTTKQSIVPLSAT+KVRTKVERFLSLL+NIGDHPKDIY
Sbjct: 955  GSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIY 1014

Query: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080
            DAFDSYFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKE
Sbjct: 1015 DAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKE 1074

Query: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140
            VIYMDRY+DTENPLLLAKK+ETE+MKQ LKVMKNRQRELL RD+SGLTRKDAFLESIKLL
Sbjct: 1075 VIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLL 1134

Query: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200
            ES+ +       E   DVI+ L++N+ +IDNELM LYNDINSLE+KISHQFDDF+EYGYS
Sbjct: 1135 ESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYS 1194

Query: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1260
            LFSVFIHRGEASYGHYWIYIKDRN  G+WRKYNDETIS            GNTATPYFLV
Sbjct: 1195 LFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLV 1254

Query: 1261 YVKQGQESDIEPLKRILE 1278
            YVKQGQE DIEPLKRIL+
Sbjct: 1255 YVKQGQEGDIEPLKRILK 1272

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 2154 bits (5581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1052/1278 (82%), Positives = 1137/1278 (88%), Gaps = 6/1278 (0%)

Query: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60
            M  ED ELQ AIE HQS+ SNQ+KNN+ ++   I++ PLY T AS QSAPV  DDGKHLL
Sbjct: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120
            YPDIATSLPLKTSDRLLDD+LCDTIFLNSTDP+VIEKGLQT+GILRESMLSYSSFRSSIR
Sbjct: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120

Query: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180
            PNALGS+TDQV IQTK EYDS SCP+YNKI+VFQAVILNPSL+EQ +SSFDDIV+IPIYH
Sbjct: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFHS+D LHEYDRVD STFDSSDP LMDYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240

Query: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300
            LILIEIF+PEF+SPEEHESFT +AIK+RY+D+CL NESL+K   PSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300

Query: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360
            PLTRKSK EP+KTIDSGNL LNTHLN EWLTSKYGFQ SSEIDEETN+ FTEY+PPDMV 
Sbjct: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360

Query: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420
            YV D   RKIRESFV+KCLQL+FWGQLS SLL PNS LKNTKSVKGLS LQTSFS+ PWF
Sbjct: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420

Query: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480
            HLLGESR+RILLNSNE +HSPLDAE HF+NLSVSHYYTDRDIIRNYE+LSSLDP NIGLY
Sbjct: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479

Query: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540
            FDALTYIANRKGAYQLIAYCGKQ+IIGQEALENAL+ FKI+PKE NIAELNEATLLSIYK
Sbjct: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539

Query: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            FETSNKS+VTS HLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE
Sbjct: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISK+SLDLFNFLTDECPQFL YYG E+L YQ
Sbjct: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659

Query: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720
            EALKLLQVNENASDET+LKIFKQKW+DESV+EPDQFL L+AALT+ISIERNSNLI+NFLL
Sbjct: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL+YQKT++NFNDHLSN
Sbjct: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779

Query: 781  SGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            SGH                  QFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSN+EV
Sbjct: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839

Query: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXX 900
            EFEVEGNK  ++GAAI    K E TQE+ TT +E DP  I  +MED TN D  ++     
Sbjct: 840  EFEVEGNK-PADGAAIPIGLKEEATQESCTT-KENDPKSIGSKMEDNTNRDTHRN---PS 894

Query: 901  XXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960
                    +++I  G++ TDL S TRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 895  NTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 954

Query: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020
            GSEPI+YDEDNEQYDL+KQLFYGTTKQSIVPLSAT+KVRTKVERFLSLL+NIGDHPKDIY
Sbjct: 955  GSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIY 1014

Query: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080
            DAFDSYFKDEYLTMEEYGDV RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE
Sbjct: 1015 DAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1074

Query: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140
            VIYMDRY+DTENPLLLAKK ETE+MKQ L+VMKNRQRELL RD SGLTRKDAFLESIKLL
Sbjct: 1075 VIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLL 1134

Query: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200
            ES++V      +E   DVI  L++N+ +IDNELMSLYN+IN+LE+KISHQFDDF+EYGYS
Sbjct: 1135 ESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYS 1194

Query: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1260
            LFSVFIHRGEASYGHYWIYIKDRN+ GVWRKYNDET+S            GNTATPYFLV
Sbjct: 1195 LFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLV 1254

Query: 1261 YVKQGQESDIEPLKRILE 1278
            YVKQGQE+DIEPLKRIL+
Sbjct: 1255 YVKQGQEADIEPLKRILQ 1272

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 2150 bits (5571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1053/1278 (82%), Positives = 1126/1278 (88%), Gaps = 8/1278 (0%)

Query: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60
            MP EDNELQ AIEG Q+ LSN EK +T ++ T IDD PLY   AS QS    VDDGKHLL
Sbjct: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60

Query: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120
            YPDIAT LPLKTSDRLLDD+LCDT F NSTDP+VIE+GLQTSGIL++SMLSYS+FRS IR
Sbjct: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120

Query: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180
            P+ALGSLTDQV +QTKTEYDSISCP+YNKI V QAVI NPSL EQQI++FDDIV+IPIYH
Sbjct: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFH+LDHLHEYD  DLSTFDSSDP L DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240

Query: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300
            LILIEIF PEF+SPEE +SFTT AI+KRYND+CLKNESLN+ E PSQPDCFYTLFKIFKG
Sbjct: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300

Query: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360
            PL RKS  +PIKTIDSGN+VLNTHLN EWLTSKYGFQASSEIDEETN+ FTEYVPPDMV 
Sbjct: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360

Query: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420
            YVGDW  RKIRES+V+KCLQLIFWGQLSASLL PNS LKNTKSVKGLSS+QTSFS  PWF
Sbjct: 361  YVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQTSFSILPWF 420

Query: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480
             LLGESRARILLN NEQAHSPLDAE HFINLSVSHYYTDRDIIRNYEALSSLDP+NIGLY
Sbjct: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540
            FDALTYIANRKGAYQ+IAYCGKQ+IIGQEALENAL+ FKIDPK+++IAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540

Query: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600
            FETSNK+K  SNHLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660
            DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQF  YYGPEKL YQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720
            EALKLLQVNENASDET+LKIFK KW+DE+V+EPDQFLIL+AALT+ISIERNSNLITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR YIL YQKTL+NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780

Query: 781  SGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            S H                  QFI+QLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXX 900
            EFEVEGNK  ++   +  +  G      A    E+DP LID E+++ TN DV+KD     
Sbjct: 841  EFEVEGNKESNDATILKEEETG-----GANAINEQDPILIDFEVDENTNGDVEKD---EN 892

Query: 901  XXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960
                    D+EI + ++ TDLASPTRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 893  NHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 952

Query: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020
            GSEPIRYDEDNEQYDLIKQLFYGTTKQ IVPLSATDKVRTKVERFLSLLVNIGDHPKDIY
Sbjct: 953  GSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1012

Query: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080
            DAFDSYF+DEYLTM EYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE
Sbjct: 1013 DAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1072

Query: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140
            VIYMDRY+DT+N  LLAKKEETEQ+KQ  K MKNRQRELL+RD SGLTRKDAFLE+IKLL
Sbjct: 1073 VIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLL 1132

Query: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200
            ES+IV     N ED K++I+ LK+ + DIDNELMSLY+DINSLEDKISHQFDDF+EYGYS
Sbjct: 1133 ESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYS 1192

Query: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1260
            LFSVFIHRGEASYGHYWIYIKDRN  GVWRKYNDETIS            GNTATPYFLV
Sbjct: 1193 LFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLV 1252

Query: 1261 YVKQGQESDIEPLKRILE 1278
            YVKQGQE+DIEPLKRILE
Sbjct: 1253 YVKQGQEADIEPLKRILE 1270

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1372 bits (3552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1257 (54%), Positives = 888/1257 (70%), Gaps = 44/1257 (3%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113
            D GK  LYP+ A   P KT+DRLLDD+L D  F+NS D +++   L ++GIL+  +LSYS
Sbjct: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116

Query: 114  SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173
                  R   LGSL DQV +QTK EYDS+SCP++N + VF  V+++  +++Q +++F+++
Sbjct: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174

Query: 174  VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKLMDYG 231
              +PI+HLKVTVK R  LER KK  G+T +HSLD   +H YD+ DL TFDS DP+L+DY 
Sbjct: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234

Query: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291
            IYVS D+NKLILIEIF+PEF+S EE ++F  ++I  RY   C + +SL+    P+QPDC 
Sbjct: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294

Query: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351
             TLFKIFKGPL RKS EEP KTI+  N+ LN+H++  WLTSKYGF+   E DEET +   
Sbjct: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354

Query: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411
            EY PPD+  Y  DW  R++RESF ++CL+LIF G++S  LL+  +  +N K  +  S +Q
Sbjct: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414

Query: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471
            T+FST  WF LLGE RA      + ++ SPLD++ HFI+LS  + Y DRDIIRNYEA  +
Sbjct: 415  TNFSTMFWFQLLGEYRAIF----STESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470

Query: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531
            LDP+N+G+Y DAL +IANRKGAYQLIAYCGKQ+ +GQEAL++AL  F+ID KEF+   LN
Sbjct: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530

Query: 532  EATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            ++ LLSIYK E++  S    N     KN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 531  DSVLLSIYKNESA--STRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588

Query: 592  LSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKY 651
            L +DESVD+DII+TAY++K+NDSPGLK+DCDRALYTIA+  RSL LFNFL  +  +F +Y
Sbjct: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648

Query: 652  YGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERN 711
            +GP++  YQ+AL +LQVNENA D+T+L+IF++KWY E VF+ DQFL L+ AL++I  ERN
Sbjct: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708

Query: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTL 771
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR+Y+L+Y+ T+
Sbjct: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768

Query: 772  DNFNDHLSNSGHXXXX-XXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAY 830
             +F   L+N  +                   QF+YQLR+LF +M+H+++RCVTP KELAY
Sbjct: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825

Query: 831  LAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAA--------------------- 869
            LAF PS + VEFE+      +  A +  ++   +  E +                     
Sbjct: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNH 885

Query: 870  ---TTSEEKDPSLIDLEMEDKTNSDVDKDIXXX---XXXXXXXXXDIEITVGENITDLA- 922
                 +   D  + + +      +DVD DI               D   +   +   +A 
Sbjct: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAM 945

Query: 923  -SPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLF 981
             + TRVAKI SDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DL+KQLF
Sbjct: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLF 1005

Query: 982  YGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVK 1041
            YG  KQ+I+PL    +VRTK ERFLSLLVNIGDHPKDIYDA D YF+DEYL +EEYGDVK
Sbjct: 1006 YGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVK 1065

Query: 1042 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEE 1101
            RTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRYSDT NP+L+ +K E
Sbjct: 1066 RTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRE 1125

Query: 1102 TEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRI 1161
            TE++ Q L  +K RQRELL ++E GL+RK A +E+   L+S+++ T+    ++   + + 
Sbjct: 1126 TEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQE 1185

Query: 1162 LKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIK 1221
            L + ++ I++EL  LY++I  LE KISHQFDDF+  GYSLF+VFIHRGEASYGHYWIYIK
Sbjct: 1186 LDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIK 1245

Query: 1222 DRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRILE 1278
            DR   G+WRKYNDETI+            GNTATPYFLVYVKQG E +IEPLKR+LE
Sbjct: 1246 DRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1368 bits (3542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1257 (54%), Positives = 890/1257 (70%), Gaps = 36/1257 (2%)

Query: 43   RASLQSAPVAV-DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKG--- 98
            R   Q   V V DDGK LLYP++    P+KT++RL+DD++ D  FL     +   +G   
Sbjct: 24   RKDTQRIEVRVADDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDID 83

Query: 99   -LQTSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVI 157
             +  +GIL++SML+YS  ++      +GSL DQVT+QTK EY S++CP  NK+ VF  V+
Sbjct: 84   TMLGNGILKQSMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVL 143

Query: 158  LNPSLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDL 217
             N S    QI++ D++ + PIYHLKVTVK R  LE  KKH GVTQFH +D LH YD+ D+
Sbjct: 144  FNNS---TQITNLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDI 200

Query: 218  STFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNE 277
             TF+  DP L+DY IYVS+DTNKLILIE+F+PEF S +E ESF ++ I +RY   C + +
Sbjct: 201  PTFNPEDPNLLDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFD 260

Query: 278  SLNKKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQ 337
            +LN  E P+Q DC  TLFK+FKGPL+RKS +EP KTIDS N  LN+H+N EWLTSKYGF 
Sbjct: 261  TLNPNEPPTQLDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFN 320

Query: 338  ASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSS 397
               + D        EY PP++V YV D+  R++RE+++++CLQLIFWG+LS +L   + +
Sbjct: 321  IVVDEDLPNAQQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPT 380

Query: 398  LKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYY 457
            LKN+KS K +++LQT+F+ +P   L   S    L+    ++ SPLD   HFINLS  ++Y
Sbjct: 381  LKNSKSYKSINALQTNFTITPLLQLFKGSGQNFLMGP--ESRSPLDFNFHFINLSACYHY 438

Query: 458  TDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVT 517
            TDRD+IRNYE L  LDP N+G+YFDAL YIAN KG+YQLIAYCGKQ+I+GQEAL+ AL +
Sbjct: 439  TDRDVIRNYERLCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKS 498

Query: 518  FKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYV 577
            F +DP E +I ++N++ LL++YK    N+ K++++ + N KNA+RL AK   S KLKFY+
Sbjct: 499  FNLDPMEVDITKINDSVLLTLYK----NELKISTSDIPNLKNAMRLFAKVKHSSKLKFYI 554

Query: 578  DHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDL 637
            DHEPYR ++QAY+TL IDESVD+DI++TAY IK+ DSPGL +DCDRALYTIAI KRSL L
Sbjct: 555  DHEPYRRVAQAYETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLL 614

Query: 638  FNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFL 697
            F FL + CP F +YY P++  Y +AL + QVNENA+DE ++K F+ +W++ESVFEP+ F+
Sbjct: 615  FTFLIERCPDFQEYYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFV 674

Query: 698  ILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSI 757
            I   AL  I ++RNS+LI+NFL TG IDPN LP ++WP GINNIGNTCYLNSLLQYYFSI
Sbjct: 675  ICVHALVEIGLQRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSI 734

Query: 758  APLRRYILEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHS 817
            APLR Y+L+Y KT+++F    +N+                    QFIYQLR+LF+AMV+S
Sbjct: 735  APLRNYVLQYSKTIEDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYS 794

Query: 818  RERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDP 877
             ERCVTP +ELAYLAFAPSN+EVEFE   N+      A   D+    T E     +EK+ 
Sbjct: 795  NERCVTPRRELAYLAFAPSNIEVEFETNENQ-----PATQQDNPEVTTAELGQDKDEKER 849

Query: 878  SL--IDLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDL-------------A 922
            S+   D+ M D      D +             D+   V     D+              
Sbjct: 850  SVDSGDISMSDNITPK-DAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEG 908

Query: 923  SPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDE-DNEQYDLIKQLF 981
            + T+VAKI SDQLENALEMGRQQDVTECIGNVLFQ+ESGSEP+   E DNEQ DL+KQLF
Sbjct: 909  TSTKVAKISSDQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLF 968

Query: 982  YGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVK 1041
            YG  +Q+IVPL+  D+ R K+ERFLSLLVNIGDHP+DIYDA D YFKDEYL MEEYGDVK
Sbjct: 969  YGELEQTIVPLANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVK 1028

Query: 1042 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEE 1101
            RTVAVT FPTILQ+QIQRVYYDRE+FMPFKSIEPLPF+E IYMDRYS T+NP L+A+K E
Sbjct: 1029 RTVAVTKFPTILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNE 1088

Query: 1102 TEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRI 1161
            T  MK+ L  +K +QR+LL R+  GL++KD+++E  KLL S+ + ++     +  +++  
Sbjct: 1089 TLLMKEKLVELKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSS 1148

Query: 1162 LKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIK 1221
            LK+    ID+EL  LY +I+ LE+ I+ QF++F+  GYS+F+VFIHRGEASYGHYWIYIK
Sbjct: 1149 LKTLTAGIDDELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIK 1208

Query: 1222 DRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRILE 1278
            DR+  G+WRKYNDET+S            GNTATPYFLVYVK+G+E +IEPLKRI+E
Sbjct: 1209 DRSQNGIWRKYNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRIIE 1265

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1365 bits (3532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/1228 (55%), Positives = 888/1228 (72%), Gaps = 19/1228 (1%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113
            D GK +LY +++T  P KTSDRLLDD++ D  F+NS D +++   L  +GIL+  +L+YS
Sbjct: 59   DSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLH-NGILKAPVLAYS 117

Query: 114  SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173
               S + P + G+L DQ+T+QT  EY SISCP +NK+ V+  V+++     +  SS   +
Sbjct: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSS--TL 175

Query: 174  VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKLMDYG 231
                +YHLKVTVK R  LE  KK  GVT +H +    LH++DR DL  FD +DP+L+D+ 
Sbjct: 176  SENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLE-FDPTDPRLVDHA 234

Query: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291
            IYVS DTNKL+LIE+F PEF+  E+ E ++  AIK RY++ C + ++L+  E P+Q DC 
Sbjct: 235  IYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCI 294

Query: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351
             TL KIF+GPL R++ EEP+KTI+S N+VLN+ +N  WLTSKYGF+   E DE T + + 
Sbjct: 295  NTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYF 354

Query: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411
            E+ PP++  Y+ D   R++RESF++KC++LIF G+ +  LL  ++    +K  +  +++Q
Sbjct: 355  EFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNAIQ 413

Query: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471
             +FS + WF +LGE R+   + S E A SPLDA  +FINLS   YY DRDII+NYEA  +
Sbjct: 414  IAFSKTTWFKMLGEHRS---IFSFESA-SPLDANYNFINLSACFYYIDRDIIKNYEAQCA 469

Query: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531
            LDP+N G+YFDALTYIANRKGAYQL+AYCGKQ+++GQEAL+ AL  F ID K+ ++A ++
Sbjct: 470  LDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATID 529

Query: 532  EATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            ++ L+SIYK ET   +    N  T+ KNALRLLAKY KSDKLKF+ D+EPY+ +S+AY+ 
Sbjct: 530  DSLLVSIYKSET--MANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEI 587

Query: 592  LSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKY 651
            L +DESVD+DII+TAYSI INDSPGLK+DCDRALYTI + KRSL L N+L  +CP F  Y
Sbjct: 588  LEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLY 647

Query: 652  YGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERN 711
            YGP  L Y EAL +LQ+NENA DETVL++F++KW+ E+ FE D  L L+AALT+I IERN
Sbjct: 648  YGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERN 707

Query: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTL 771
            S LI +F+ TGTID + LP +NWPTG+NNIGNTCYLNSLLQYYFS+APLRRY+LEYQ+T+
Sbjct: 708  SKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETM 767

Query: 772  DNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYL 831
            ++F  H  N                     QF+YQLR+LF AM++S+ERCVTP KELAYL
Sbjct: 768  EHFRHHTGN--ELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825

Query: 832  AFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPS-LIDLEMEDKTNS 890
            AFAPSN EVEFE          + I+  +  ++     T   + D +  I+L+  D  N 
Sbjct: 826  AFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELD-SDSGNE 884

Query: 891  DVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTEC 950
            D+D  +            DI ++  E    +++ TRVAKI SDQLENALEMGRQQDVTEC
Sbjct: 885  DID--VSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTEC 942

Query: 951  IGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLV 1010
            IGNVLFQ+ES S+PI  DEDNEQ DL+KQLFYG  KQ+I+PL+ + +++TK+ER+LSLLV
Sbjct: 943  IGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLV 1002

Query: 1011 NIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPF 1070
            NIGDHPKDIYDA DSYF DE LTM EYGDVKRTVAVT FPTILQ+QIQRVYYDRERFMPF
Sbjct: 1003 NIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPF 1062

Query: 1071 KSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRK 1130
            KSIEPLPF EV+YMDRYSD+++P ++ KK+E+EQ+K  L  +K RQ+ELL  +E GL+RK
Sbjct: 1063 KSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRK 1122

Query: 1131 DAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQ 1190
             A++E+I  L+S+++ ++     +N  +I  LK +I DID EL SLY+DI  LE+ I  Q
Sbjct: 1123 AAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQ 1182

Query: 1191 FDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXX 1250
            F++F++ GYSLF+VFIHRGEASYGHYW+YIKDR+  G WRKYNDETI+            
Sbjct: 1183 FEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTE 1242

Query: 1251 GNTATPYFLVYVKQGQESDIEPLKRILE 1278
            GNTATPYFLVYV+QG E DIEPLKRI++
Sbjct: 1243 GNTATPYFLVYVRQGHEHDIEPLKRIID 1270

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1310 bits (3390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1246 (53%), Positives = 860/1246 (69%), Gaps = 47/1246 (3%)

Query: 53   VDDGKHLLYPDIATS-LPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLS 111
            +D G  LLYPD+ T+  P+KTS+R++DD+LCD  F+N   PN+  K    +GIL+ESM+ 
Sbjct: 75   IDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFING--PNLSFK----NGILQESMIM 128

Query: 112  YSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILN-PSLSEQQISSF 170
            YS  R + +    GS+ DQV +QTK EY+S++CP  NK+ V   +++N PS     I++ 
Sbjct: 129  YSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----NITNV 184

Query: 171  DDIV-RIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKL 227
            D+I+ ++PIYHLK+TVK RQ LE  KK  G+TQ+H LD   LH +D+ DL TFD  +P L
Sbjct: 185  DEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDL 244

Query: 228  MDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQ 287
            +DY IYVS DTN+LILIEIF  EF+S EE ESF T  IK RY + C K ++L+ +  P+ 
Sbjct: 245  LDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTG 304

Query: 288  PDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETN 347
             DC  T+ K+ K PLTRK+  + I+T+ S N +L++H N EWL  KY F      DE T 
Sbjct: 305  IDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTG 364

Query: 348  DPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNS--SLKNTKSVK 405
                EY PPD++ YV  +  R +RE ++++CLQLIFWG+    L    S  +L+ +KS +
Sbjct: 365  QEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYR 424

Query: 406  GLSSLQTSFSTSPWFHLLGESRARILLNS-NEQAHSPLDAEQHFINLSVSHYYTDRDIIR 464
              + L T+ ST+P + LL +S++  L ++ N+     LD   HFINLS S YYTDRDII+
Sbjct: 425  AFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIK 484

Query: 465  NYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKE 524
            NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQ+++GQE +  AL  F IDP  
Sbjct: 485  NYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNV 544

Query: 525  FNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRA 584
             N+  ++++ LLSIYK    N+S        N KNA+RL AK   S +LKFYVDHEPYR 
Sbjct: 545  VNLESIDDSLLLSIYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN 600

Query: 585  LSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDE 644
            ++QAY+TL ID SVD+DII+TAYSIK  D+PGLK+DCDRALYTIAI +RS+ LFNFL + 
Sbjct: 601  VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN 660

Query: 645  CPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALT 704
            C +F  YY   +  Y++AL +LQVNENA+DE +LK F+ KW++E + E DQFL  + AL 
Sbjct: 661  CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM 720

Query: 705  RISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 764
            ++ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR Y+
Sbjct: 721  KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780

Query: 765  LEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTP 824
            L Y KT ++F D   N+                    QFIYQLR+LFYAM+++ +RCVTP
Sbjct: 781  LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP 840

Query: 825  SKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEV-------TQEAATTSEEKDP 877
             +ELAYLAFAPSNVEVEFE        NG     D+K +V       T +      E D 
Sbjct: 841  RRELAYLAFAPSNVEVEFE--------NGVT---DAKEDVSHYNDDKTSDTLIKIGEGDE 889

Query: 878  SLIDLEMEDKTNSD----VDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSD 933
             L + E  + + ++     D D+            + E T  EN  D+   T+VAKI SD
Sbjct: 890  DLGEAERTEASPTEDIYMTDDDMLGAAKATDGINKEDEST--ENGIDILPSTKVAKISSD 947

Query: 934  QLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLIKQLFYGTTKQSIVPL 992
            QLENALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DL+KQLFYG  KQ I+PL
Sbjct: 948  QLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPL 1007

Query: 993  SATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTI 1052
            S   + R K+ERFLSLLVN+GDHP+DIYDA D YFKDE+LTM+EYG+VKRTVA+T FPTI
Sbjct: 1008 SGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTI 1067

Query: 1053 LQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVM 1112
            LQVQIQRVYYDRERFMPFKSIEPLPF   IYMDRY DT +P +L  +E T +MK  L  +
Sbjct: 1068 LQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQL 1127

Query: 1113 KNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNE 1172
            K RQ+ELL R+E GL+RK+A+ E++  L+SN +  +    E   ++  ILK    DID+E
Sbjct: 1128 KKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDE 1187

Query: 1173 LMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKY 1232
            L ++YN I  LE+ ISHQF+ F++ GYSLF+VFIHRGEASYGHYW+YIKD N  G+WRKY
Sbjct: 1188 LSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKY 1247

Query: 1233 NDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRILE 1278
            NDET+S            GNTATPYFLVYVK+G E DIEPLKRI+E
Sbjct: 1248 NDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1302 bits (3369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1237 (53%), Positives = 867/1237 (70%), Gaps = 42/1237 (3%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113
            DDGKHLLY D+    P+KTSDRL+DD+LCD + LN     ++ +  Q+ GIL+   + YS
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCD-LSLNGQSQCLLSE--QSQGILKLLPIIYS 108

Query: 114  SFRSSIR-PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDD 172
              R  ++  + LGSL DQV  QTK EY S+SCP++NK+ VF  V+LN S S     S DD
Sbjct: 109  KQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVSSS---FESTDD 165

Query: 173  IVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGI 232
            +VR P++HLKVTVK R +LE  KKH GV+QF S+D LH YD+ DL TFD  D +L+DY I
Sbjct: 166  VVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAI 225

Query: 233  YVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFY 292
            YVS DTNKL+LIEIF PEFN+ EE ESFT D I+KRY D C + +SLN ++ P+Q DC  
Sbjct: 226  YVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLN 285

Query: 293  TLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTE 352
            TL+K FK P+ +     P++TI + N +LN+H+NA WLT +YGF   + +  E  D   E
Sbjct: 286  TLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGF---TLLPGENEDDEDE 342

Query: 353  YVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLL--TPNSSLK-NTKSVKGLSS 409
            Y PP+   Y+ D   RK++E +++KCLQLIFW +L   ++  T  S L  ++KS K LS 
Sbjct: 343  YEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSG 402

Query: 410  LQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEAL 469
            +    ++ P + L GES+    LNSN+Q +   D   HFI LS S++Y DRDII NYE  
Sbjct: 403  IAVQNTSKPLYQLFGESK-NAFLNSNDQNYM-WDTNYHFIALSASYHYNDRDIIMNYETY 460

Query: 470  SSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAE 529
            S +D  NIG+YFDA+ +IANRKG+YQL+AYCGKQNI+G EALE A+  FK+DP   +I +
Sbjct: 461  SVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINK 520

Query: 530  LNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
            L+ + LLS+YK E    S   ++HL++ KNALR+LAK+  +  +KFYVDHEPY+ +SQAY
Sbjct: 521  LDISLLLSMYKHE--QISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAY 578

Query: 590  DTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFL 649
            + L +DESVD+DII+TAYSIK+NDSPGLK++C RALYTIAI+KRS+ LFN+L +ECP+F 
Sbjct: 579  NELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQ 638

Query: 650  KYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIE 709
             +YGPEK  Y++AL ++QVNENASDE +L+IF++KW DE + E DQFL L+AAL ++ IE
Sbjct: 639  DFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIE 698

Query: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769
            +NS LI++FL TG IDP+ LP ENWP G+NNIGNTCYLNSLLQYYF+IAPLR YI  YQ 
Sbjct: 699  KNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQS 758

Query: 770  TLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELA 829
            T ++F    +++                    QF YQLR+LF  M+ S  RCV+P++ELA
Sbjct: 759  TTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELA 818

Query: 830  YLAFAPSNVEVEFEVEGNKVGSNGAAIS---ADSKGEVT----QEAATTSEEKDPSLIDL 882
            YLAF+PSN+EVEF+        +G   S    D+   +T     E  T +E  +P L D 
Sbjct: 819  YLAFSPSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQLDDT 878

Query: 883  EMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMG 942
             +     +DV  D               ++ + + +  + S T+VAKIGSDQLENALE+G
Sbjct: 879  GLLAPVEADVPVD---------------QMKLAKEV--INSSTKVAKIGSDQLENALELG 921

Query: 943  RQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKV 1002
            RQQDVTECIGNVL+Q+ES S+PI+ DEDNEQYDLIK LFYG T+Q IVPLS +  VR+K 
Sbjct: 922  RQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKY 981

Query: 1003 ERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYY 1062
            ERFLSLLVN+ DHPKDIYDA DSYF +EYLT+EEYGDV+RTVA+T FPTILQ+QIQRVYY
Sbjct: 982  ERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYY 1041

Query: 1063 DRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDR 1122
            DRERFMPFKSIEP+PF   +YMDRY+ T++P++L K+ ET ++K  L+  K RQ+ELL R
Sbjct: 1042 DRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSR 1101

Query: 1123 DESGLTRKDAFLESIKLLESNIVVTEAS-NSEDNKDVIRILKSNIIDIDNELMSLYNDIN 1181
            ++ GL+RK+A+ E++K+L+S+ +    S   ED   V+  L   +  ID EL+ LY +I 
Sbjct: 1102 NDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIG 1161

Query: 1182 SLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXX 1241
             LE +I HQFD F++ GYSLF+VFIHRGEASYGHYW+Y+KD    G+WRKYNDET+S   
Sbjct: 1162 QLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVP 1221

Query: 1242 XXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRILE 1278
                     GN ATPYFLV VKQ  E DIEPL RI++
Sbjct: 1222 EEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLHRIID 1258

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1300 bits (3365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1233 (52%), Positives = 875/1233 (70%), Gaps = 27/1233 (2%)

Query: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDT--IFLNSTDPNVIEKGLQTSGILRESMLS 111
            DDGK LLYPD     P KTS+RLLD+++C    I L+  D +  E    ++G+L++ +LS
Sbjct: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGLLKKQLLS 108

Query: 112  YSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFD 171
            YS  R +++P ++G++ DQ+ +QTK EY S +CP +N IYV   V+++ +   Q +S+FD
Sbjct: 109  YSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166

Query: 172  DIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYG 231
            D+  + IYHLK+TVK+R  LER K+HVGV ++H LD LH +D+ DL  FD  DPKL+D+ 
Sbjct: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226

Query: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291
            IYVSDDTNKL+L+EIF+PEF+S EE  S T  AIK+R+     K ++L+K E P+Q DC 
Sbjct: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286

Query: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351
             T+FKIFKGPLTRKS +EP+KT+ S N+VLN+ +N +WL +KYGFQ   E +EET +   
Sbjct: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLI 346

Query: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411
            +Y+PP++V +  D + RK RE+  +KCL+LI+ G++S SL+TP      +KS++  + LQ
Sbjct: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406

Query: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471
            TSFST  W  +L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462

Query: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531
            LDP NIG+YFD+L +IAN +G+Y LI YC KQ+I+GQEALE AL TF +DP   ++++ N
Sbjct: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522

Query: 532  EATLLSIYKFETSNKSKVTSN---HLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQA 588
            +A  ++IYK    N+ K+  N    LTN +NALR+LAK+  S +LKFYVD+EPY ++ +A
Sbjct: 523  DAIFMTIYK----NEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRA 578

Query: 589  YDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQF 648
            ++ L +DESVD+DII+TAYSIK+ND+PGLK+DCDRALYT+A+SKRS+ L NFL  ECP F
Sbjct: 579  FNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPF 638

Query: 649  LKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISI 708
              +YGP++  Y EAL+ LQVNENA+D+T+L+IF+++W  +SV + D+ L L++ LT+I+ 
Sbjct: 639  QDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAF 698

Query: 709  ERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ 768
            ERNS LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR Y+ +YQ
Sbjct: 699  ERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQ 758

Query: 769  KTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKEL 828
            KTL+   + L +                     QF+YQLR+LF  M+HS  RCVTP+KEL
Sbjct: 759  KTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKEL 818

Query: 829  AYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLI-DLEMEDK 887
            AYLAFAPSNVEVEF+        NG     D  G++       SE K  SL+ D E    
Sbjct: 819  AYLAFAPSNVEVEFDQPNELQSGNGE----DVDGDIVFIDEDISEPKGKSLVLDEENSKV 874

Query: 888  TNSDVDKDIXXXXXXXXXXXXDIEITVGENIT---DLASPTRVAKIGSDQLENALEMGRQ 944
             NS  ++ I             +E  + +N        + TRVAKI  DQLENALE+GRQ
Sbjct: 875  ENSPENQLIEIDDSSDSSGHKKVE-EISQNPCFGKSTDTSTRVAKISFDQLENALELGRQ 933

Query: 945  QDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVER 1004
            QDVTECIGNVLFQ+ES S PI  +ED+EQYDLIK+LFYG TKQSI+PL   +++R K+ER
Sbjct: 934  QDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIER 993

Query: 1005 FLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDR 1064
            F+SLLVN+ DHPKD+YDA D YF DEYLTM+EYG+VK+++AVT FPTILQ+QIQRVYYDR
Sbjct: 994  FVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDR 1053

Query: 1065 ERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDE 1124
            ERFMPFKSIEPLPF E IYMDRY++T +  LL KK+ET ++K+ L  M+ RQ+ELL R+E
Sbjct: 1054 ERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNE 1113

Query: 1125 SGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLE 1184
             GL+RK+AF+E+ K L S+ +  +   +E+ + +I  L   + DID+EL  LYNDI ++E
Sbjct: 1114 LGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIE 1173

Query: 1185 DKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXX 1244
             KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD    G+WRKYNDETI+      
Sbjct: 1174 AKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAE 1233

Query: 1245 XXXXXXGNTATPYFLVYVKQGQESDIEPLKRIL 1277
                  GNTATPYFLVYVKQ   ++IEPLKRI+
Sbjct: 1234 VFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1284 bits (3322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1246 (53%), Positives = 868/1246 (69%), Gaps = 42/1246 (3%)

Query: 35   DDSPLYGTRASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNV 94
            D+  +  T A  +S P   DDGK LLYP +  +LP KT DRL+DD++ D  F+N +D + 
Sbjct: 18   DEQSVSSTTADEKSLP-PNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS 76

Query: 95   IEKGLQTSGILRESMLSYSSFRSSIRPN-ALGSLTDQVTIQTKTEYDSISCPRYNKIYVF 153
                 +  GIL+ S L+YS  R  +RP+  LG+  DQ+T+QTK EY+SISCP +N+I VF
Sbjct: 77   -----EFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVF 131

Query: 154  QAVILNPSLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYD 213
              V+++ ++  +  +SFD +   PIYHLKVTVK R +LE LKKHVG++ +H +  LH +D
Sbjct: 132  FGVLIDSNM--ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFD 189

Query: 214  RVDLSTFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLC 273
            + DL TFD SD  L+D+  YVS DTNKLILIEIF+PEF+S EE ESF T+ I  RY  +C
Sbjct: 190  KQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVC 249

Query: 274  LKNESLNKKEAPSQPDCFYTLFKIFKGPLTRKSKE-EPIKTIDSGNLVLNTHLNAEWLTS 332
             + +SLN    PSQ DCF TLF++FKGPL RKS + +PIKTI++ N  LN+H++++WL S
Sbjct: 250  EQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVS 309

Query: 333  KYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLL 392
            KYGFQ +S  + E ND   EY PPD++ +  DW  RK+R+S+ +KCLQL FWG+LS  LL
Sbjct: 310  KYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLL 369

Query: 393  TPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLS 452
            +  +  K  KS +  + + T  ST+  F +  +S  R  L  ++ + SPLD   HFINLS
Sbjct: 370  SKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARR--LQQDDTSASPLDNNYHFINLS 427

Query: 453  VSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALE 512
             S+YYTDRDII+NYE L ++D +N G+YFDALTYIAN KG+YQLI+YCGKQ+++GQE L+
Sbjct: 428  SSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQ 487

Query: 513  NALVTFKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDK 572
            N+L    +D    +I  LN++ L SIYK E  N S+     LT  K+A+R++ K  +S K
Sbjct: 488  NSLRVLGLDATSVDIKSLNDSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKK 546

Query: 573  LKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISK 632
            L+F++DHEPY  +  AY+ L IDESVD+DI++TAY+I+INDSPGLK+DCD+ALYTIAI  
Sbjct: 547  LQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRT 606

Query: 633  RSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFE 692
            RS+ LFNFL ++CP F+ YYGP+ L +Q+AL LLQVNENA+DE V+KIF+Q+W  + + E
Sbjct: 607  RSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNE 666

Query: 693  PDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 752
             DQ LIL+AALT+I+ E+NS LI+ FL TG ID N L PENWP G+NNIGNTCYLNSLLQ
Sbjct: 667  YDQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQ 726

Query: 753  YYFSIAPLRRYILEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFY 812
            YYFSIAPLR YIL Y+ ++ N+   +  + +                  QF+YQLR+LF 
Sbjct: 727  YYFSIAPLREYILNYKGSISNY--EIDETSNKRRIGGREVSENEVERSIQFMYQLRDLFN 784

Query: 813  AMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTS 872
             M++S+ RC+TP  ELAYLAFAPSN+EVEF               A S+ E T       
Sbjct: 785  DMIYSKSRCITPKHELAYLAFAPSNIEVEF---------------AASEVERTTVDLPFD 829

Query: 873  EEKDPSLIDLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGS 932
            +E D  L+DL  ++   ++  +++            DI +   + +    S T+ AKI S
Sbjct: 830  KEGDIDLVDLSNDNLNTTNNAQEVTS----------DISVATEDKVMTNTS-TKTAKISS 878

Query: 933  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPL 992
            DQLENALEMGRQQDVTECIGNVL+Q+ES S+PI+ DED EQYDLIK+LFYG TKQ IVPL
Sbjct: 879  DQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPL 938

Query: 993  SATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTI 1052
            S   K RTK E F SLLVNI DHP+DIYDA +S F  E+L M+EYGDV+RTV++T FP I
Sbjct: 939  SDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKI 998

Query: 1053 LQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVM 1112
            LQ+QIQRVYYDRERFMPFKSIEPLPF   IYMDRY+  +N LL  KK ET++++  LK +
Sbjct: 999  LQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTL 1058

Query: 1113 KNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNK-DVIRILKSNIIDIDN 1171
            K RQ ELL+R+E GL+RK+++LE+I  L     VT    S  N+  +I  L+  I +ID+
Sbjct: 1059 KARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDS 1118

Query: 1172 ELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRK 1231
            EL  +Y++IN +E+KI HQFD+F + GYSLF+VFIHRGEASYGHYW+YIKD    G+WRK
Sbjct: 1119 ELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRK 1178

Query: 1232 YNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRIL 1277
            YNDET++            GNTATPYFLV+VK   + DIEPLKRI+
Sbjct: 1179 YNDETVTEVNEEEVFNFTEGNTATPYFLVFVKDYYKGDIEPLKRII 1224

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1273 bits (3293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1262 (51%), Positives = 863/1262 (68%), Gaps = 48/1262 (3%)

Query: 28   PNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFL 87
            PND T    S +      +Q  P  +DDGK LLYP +  + P KTSDRLLDD+  D  FL
Sbjct: 12   PNDST----SDIDTHEEIIQEVPPVIDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFL 67

Query: 88   NSTDPNVIEKGLQTSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRY 147
            NS + +++   L  +G+LR  ML YS  + + +P ++G L DQVT++TK EY+S +CP  
Sbjct: 68   NSEEHDILYSQLH-NGVLRLPMLEYSR-KKTTQPCSVGYLLDQVTLKTKYEYESKTCPEL 125

Query: 148  NKIYVFQAVILNPSLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLD 207
            NKI VF  V+++  +  +   S DD++ +PIYHLK+TVK R  LER+KKHVGVT +H +D
Sbjct: 126  NKINVFMGVLVDQHIRPE---SLDDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLID 182

Query: 208  HLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKK 267
             LH +D+ D+     S+ +L+D   YVS DTN+L+ IEIF+PEF + E+   F+ + +K+
Sbjct: 183  QLHSFDKQDIFMTTESE-QLVDSATYVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKE 240

Query: 268  RYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNA 327
            RY   C K + L+    P+Q +C  TLFKIFKGPL R+S E+ +KTI + N  LN+ ++ 
Sbjct: 241  RYASACEKFQDLDPTSVPTQVECLNTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDP 300

Query: 328  EWLTSKYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQL 387
             WLT KY F+     DEET +   E+ PPD+  YV DW+ R  RES+ +KCL+LIF G+ 
Sbjct: 301  SWLTEKYDFKLVETTDEETGELIREFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKT 360

Query: 388  SASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHS---PLDA 444
            SA LL  +   K++KS +  +  QT+FSTS WFHLLG+ R       N Q H+   P D 
Sbjct: 361  SAQLLPKDILSKDSKS-RSFNLYQTNFSTSFWFHLLGDGR-------NFQDHNLQQPFDN 412

Query: 445  EQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQN 504
            + HFINLS S YY+D+DII+NYE   SLDP+N+G+YFDAL YIAN KG YQLIAYCGKQN
Sbjct: 413  DYHFINLSASSYYSDKDIIKNYETQISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQN 472

Query: 505  IIGQEALENALVTFKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLL 564
            I+G+EAL+ AL  F ID K+ ++  + +  LLSIYK E    S       T+ KNALRLL
Sbjct: 473  IVGKEALDGALTVFGIDSKDTDVKSITDELLLSIYKNELKAAS---VQKRTDLKNALRLL 529

Query: 565  AKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRA 624
            AK+ +S KLKF+VD+EPY + S+AY  L I ESVD DII+TAY+I++ D+PGLK+DCDRA
Sbjct: 530  AKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRA 589

Query: 625  LYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQK 684
            LYT+A++KRSL LFNFLT ECP F ++Y  +   Y+EAL LLQVNENA+D+ +L+IF++K
Sbjct: 590  LYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWSYKEALSLLQVNENATDDVILEIFQRK 649

Query: 685  WYDESVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNT 744
            W  E +  PDQFLIL+ ALT++ IERNS LI NF+ TG +D + LP  NWPTG+NNIGNT
Sbjct: 650  WSQEPMTSPDQFLILKTALTKLGIERNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNT 709

Query: 745  CYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXX---XXXX 801
            CYLNSLLQYYFSI+PLR Y+L YQK L+ F D    +G                      
Sbjct: 710  CYLNSLLQYYFSISPLRDYVLNYQKMLNCFRDIEDATGGEISKRRIGSREVSKPEVERSV 769

Query: 802  QFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSK 861
            QF+YQLR+LF  MVH++ER VTP+KELAYLAFAPSN+EVEFE       +        +K
Sbjct: 770  QFVYQLRDLFRDMVHTKERFVTPTKELAYLAFAPSNIEVEFEAPTITTVAPEDLDERTNK 829

Query: 862  GEVTQEAA-----TTSEEKDPSLIDLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGE 916
             ++   AA      T +    SL+D+  + K     +               DI +   +
Sbjct: 830  LDIIDLAADGIDNETEKGSKSSLLDVHNQQKPEEQTE---------------DIIMGGTQ 874

Query: 917  NITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDL 976
                + +  RVAKI SDQLEN LE+GRQQDVTECIGNVLFQ+ES S+P   +EDNEQ+DL
Sbjct: 875  EEEAVNASMRVAKISSDQLENTLELGRQQDVTECIGNVLFQLESASDPWSLEEDNEQHDL 934

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEE 1036
            IK+LFYG  KQ ++P+    K+RTK+ERF+SLLVNIGDHPKDIYDA D YFKD+ L ++E
Sbjct: 935  IKELFYGKIKQHLIPVKNPSKIRTKIERFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDE 994

Query: 1037 YGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLL 1096
             G+VKRTVAVT  P ILQ+QIQRVYYDRERFMPFKSIEPLPF E IYMDRY DT++P++L
Sbjct: 995  DGEVKRTVAVTNLPKILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVML 1054

Query: 1097 AKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNK 1156
            AK+++T+++K+ L+ +K+RQ +LL ++++GL+ K + L++ K L+S ++       E+  
Sbjct: 1055 AKRDDTKKLKEELRALKDRQHQLLSKNDTGLSFKGSLLQTKKFLQSEVLDKHEIAVENKG 1114

Query: 1157 DVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHY 1216
             ++  + S I  ID EL SLY  I +LE +I++QF++F + GYSLF+ FIHRGEASYGHY
Sbjct: 1115 ALVCHIDSMITKIDGELSSLYQKITALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHY 1174

Query: 1217 WIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRI 1276
            WIYIKDR   G+WRKYNDE+++            GNTATPYFLVY+K+G E +IEPLKR+
Sbjct: 1175 WIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRV 1234

Query: 1277 LE 1278
            ++
Sbjct: 1235 IK 1236

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1277 (48%), Positives = 865/1277 (67%), Gaps = 72/1277 (5%)

Query: 53   VDDGKHLLYPDIATSLPLKTSDRLLDDVLCD---TIFLNSTD------------------ 91
            VDDGKH+LY   +     KT+DRLLDD++ D    +F NS++                  
Sbjct: 61   VDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNN 120

Query: 92   -----PNVIEKGLQTSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPR 146
                  +  E     +GILR     YS  R S    A+G++ DQ+ +QT+ E+ S++CP 
Sbjct: 121  TSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPE 180

Query: 147  YNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFH-- 204
            +N ++V   V+++ + S+  + +F     +P+YH K+TVK R  LE+ KKHVG++ FH  
Sbjct: 181  FNDVHVLLGVLMD-NRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGISHFHLI 234

Query: 205  SLDHLHEYDRVDL--STFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTT 262
              D LHE+D+ DL  +  D +   L+D  I++S+DTNKL+++EIF+PEFN  EE ESF+ 
Sbjct: 235  DFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQ 294

Query: 263  DAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLN 322
            ++I +RY + C +  +L++++ P+Q +C  T+FKIFKGPL  K+  EP+K I++ N +LN
Sbjct: 295  ESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLN 354

Query: 323  THLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLI 382
            +H N  WL +KYGF  + + + +T + F EY+PP++  Y+ D N R +RES+++KCL+LI
Sbjct: 355  SHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELI 414

Query: 383  FWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPL 442
            F  + + SL+ PN    N+K+++  + LQT F+TS W   L E + ++        ++ L
Sbjct: 415  FISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQL------DTYNKL 468

Query: 443  DAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGK 502
            D E H+INL  S YYT+RDIIRNY  L++LDP NIG+Y+DAL YIA  K +YQLI++  K
Sbjct: 469  DYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSK 528

Query: 503  QNIIGQEALENALVTFKIDPKEFN-IAELNEATLLSIYKFETSNKSKVTSNHLTNFKNAL 561
            Q++IGQEAL  AL  F ID  + + I+ L E+ + +IYK E   ++ ++S  L   KNAL
Sbjct: 529  QDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERK-QANISSARLAEMKNAL 587

Query: 562  RLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDC 621
            RLLAKY  SD+LKFY D+EPY + SQ Y+TL +DESVD+DII+TAY+IK+ND+PGLK+DC
Sbjct: 588  RLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDC 647

Query: 622  DRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIF 681
            DRAL T+A  ++SL LF FL  ECPQF ++YG ++  Y +AL  LQVNENA+DET+L+IF
Sbjct: 648  DRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIF 707

Query: 682  KQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNI 741
            +Q+W ++   + D  L L++AL++I+ E+NS LI+NF+ TG +DP  LP ENWP G+NNI
Sbjct: 708  QQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNI 767

Query: 742  GNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSGHXXXXXX---XXXXXXXXX 798
            GNTCYLNSLLQYYFSI PLR +IL+YQ T+ +F + +  +                    
Sbjct: 768  GNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVE 827

Query: 799  XXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVE------GNKVGSN 852
               QFIYQ+R+LF  M+ S+ RCV+P +ELAYLAF PSN+EVEFE        G+K  + 
Sbjct: 828  RSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQ 887

Query: 853  GAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDK---DIXXXXXXXXXXXXD 909
             A +  D     T    T     + +LIDLE   K ++  D+   D             +
Sbjct: 888  DAVVLQDEAKNDTDINLT-----EVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKE 942

Query: 910  I-------EITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGS 962
            +       E++  E+IT     TRVAKI SDQLENA EMGRQQDVTECIGNVLFQ+E+G 
Sbjct: 943  LSKTNPFREVSPNEDIT---ISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGF 999

Query: 963  EPIRYD-EDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYD 1021
            +PI  D EDNEQYDL+K+LFYG TKQSI+PL+     R KVERFLSLLVNI DHPKDIYD
Sbjct: 1000 DPISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYD 1059

Query: 1022 AFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEV 1081
            A + YF DE+LTMEEYGDVK+T+++T +P ILQ+QIQRVYYDRERFMPFKSIEPLPF++V
Sbjct: 1060 ALNQYFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQV 1119

Query: 1082 IYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLE 1141
            IYMDRY+++ +P L++KKEET Q+K  LK  + RQ+ELL ++E GL+RK+A +E+IK L+
Sbjct: 1120 IYMDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLK 1179

Query: 1142 SNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSL 1201
            S +++    ++ +   ++R L+  +  I+NEL +LYN IN L+++I HQFDDF++  YSL
Sbjct: 1180 SPVILENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSL 1239

Query: 1202 FSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVY 1261
            F+VFIHRGEASYGHYW+YIKD +  G+WRKYNDE+++            GNTATPYFLVY
Sbjct: 1240 FAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVY 1299

Query: 1262 VKQGQESDIEPLKRILE 1278
            VKQ   SDIEPLKRI++
Sbjct: 1300 VKQDSLSDIEPLKRIIQ 1316

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/1282 (50%), Positives = 866/1282 (67%), Gaps = 52/1282 (4%)

Query: 29   NDDTFIDDSPLYGT---RASLQSAPVAV-------DDGKHLLYPDIATSLPLKTSDRLLD 78
            NDD        +G     A LQ  P+         DDG+ LLYP+I T LPLKTSDRLLD
Sbjct: 4    NDDAVTGMGVHFGGDPPEADLQGEPIPSADVTNIEDDGRQLLYPNIGTHLPLKTSDRLLD 63

Query: 79   DVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTE 138
            D+LC   FL S D            IL  + L YS  R  I+ +A+G   DQV IQTK E
Sbjct: 64   DILCSVGFLTSGD---------NKSILNSNTLEYSKQRPHIKGSAVGFFQDQVIIQTKYE 114

Query: 139  YDSISCPRYNKIYVFQAVILNPS-LSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKH 197
            Y S SCP +NKI+V   +++    L + +     ++  IPIYH+K++VK+R  LE  KK 
Sbjct: 115  YPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISEVTEIPIYHVKISVKVRSILENSKKL 174

Query: 198  VGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEH 257
            VGV++++ LD LH+YDRVD  ++D +D KL+D  +Y +DDTNK++LIEI++PEF+  ++ 
Sbjct: 175  VGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKD 234

Query: 258  ESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSG 317
             S ++  IK R+     K   L K+E+P+Q D   TLFK+FKGPL RKS + P K+I++ 
Sbjct: 235  LSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEAE 294

Query: 318  NLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKK 377
            + +L +++N   L + +GF  ++E     N P  EY+ PD+V Y+GD N +K+R++F +K
Sbjct: 295  HPLLISNMNPSALVTHFGFTYTNE-----NIPGGEYMAPDLVNYLGDPNIQKLRDTFTRK 349

Query: 378  CLQLIFWGQLSASLLTPN--SSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARI--LLN 433
            CL+LI +G +  S L  N  S+ + +K  + L ++Q  FS   W  LLG+ ++R   LLN
Sbjct: 350  CLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLN 409

Query: 434  SNEQA------------HSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLYF 481
             NE              +SP D + +F NLSV  +Y +RDII+NYE L +LD  NIG+YF
Sbjct: 410  VNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIYF 469

Query: 482  DALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYKF 541
            D+L+ +ANRKG+YQL++YCGKQ++IGQEAL+N+L  F ID  +  +  L+E  LLS+YK 
Sbjct: 470  DSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYKH 529

Query: 542  ETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDED 601
            E   K    +N +++ KNALRLLAKY  SD LKFYVD+EPYR + +AYD L IDESVDED
Sbjct: 530  EW--KENPDNNRISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDED 587

Query: 602  IIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQE 661
            II+TAY+IKIND+PGLK+DCDRALYTIA S+RSL LFNFL D+CP+F +YYG + L Y +
Sbjct: 588  IIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQ 647

Query: 662  ALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLLT 721
            + ++LQ+NEN ++  +L +F+QKW +  + EPDQ L  RAALT+I++ERNSNL+ NFL T
Sbjct: 648  SFEILQINENITEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLET 707

Query: 722  GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNS 781
            G I+PNSLP ENWPTGINNIGNTCYLNSLLQ+YF+I+PLR YI++YQKT+ + + +  + 
Sbjct: 708  GNINPNSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSI 767

Query: 782  GHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVE 841
                                QF+YQLR+L+  M+ S +RCVTP +ELAYLAFAPS+++VE
Sbjct: 768  ISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVE 827

Query: 842  FEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXXX 901
            FE    K  S  + I   +    +Q   +T E  D ++ D+E E++ N +++        
Sbjct: 828  FE--NAKTKSPISNIEGSNSTTDSQPMPSTGENIDHNM-DIEQEERNNEEINSTNNIESN 884

Query: 902  XXXXXXXDIEI--TVGENITDLA---SPTRVAKIGSDQLENALEMGRQQDVTECIGNVLF 956
                   DIE+  T  EN  ++    +  +VAKI  +QLENALE+GRQQDVTECIGNVLF
Sbjct: 885  DLVSNNHDIEMLDTDKENEGNMEIEDTAIKVAKIDPEQLENALELGRQQDVTECIGNVLF 944

Query: 957  QIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHP 1016
            Q+ES S P    ED+EQ DLIK+LF+G T Q I PL A    RTKVERF+SLLVNI DHP
Sbjct: 945  QLESSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHP 1004

Query: 1017 KDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPL 1076
            KD+YDA D YFK+EYLTMEEYG+VKR +A+  FPTILQ+QIQRVYYDRERFMP+KSIEPL
Sbjct: 1005 KDVYDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPL 1064

Query: 1077 PFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLES 1136
            PF+  IY+DRY+DT++  LL K+EET ++K+ L+  K RQ+ELL R+E GL+R+DA+ E+
Sbjct: 1065 PFESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKET 1124

Query: 1137 IKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEE 1196
               L S ++     +  D   +   L+ +   + +EL  LY  I +LE+KI+HQFDDF E
Sbjct: 1125 ANFLRSEVLQNTNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTE 1184

Query: 1197 YGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATP 1256
            +GY+LF+VFIHRGEASYGHYW+YIKD     +WRKYNDET++            GNTATP
Sbjct: 1185 HGYTLFAVFIHRGEASYGHYWVYIKDF-VNSIWRKYNDETVTEVPEEEVMNFTEGNTATP 1243

Query: 1257 YFLVYVKQGQESDIEPLKRILE 1278
            YF+V+VK+G E DIEPLKR++E
Sbjct: 1244 YFIVFVKKGHEKDIEPLKRMIE 1265

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1240 (50%), Positives = 824/1240 (66%), Gaps = 37/1240 (2%)

Query: 41   GTRASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQ 100
            G  ++L       D GK LLY D     P KTS+RLLDD+  +  + NS + +++   L 
Sbjct: 23   GLESNLNDGQPIKDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELH 82

Query: 101  TSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNP 160
              G+LR  +L YS   +    N +G L DQV ++T+ EYDS +CP  NKI VF  V+LN 
Sbjct: 83   -KGVLRLPILEYSRKPTDDVYN-IGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLN- 139

Query: 161  SLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTF 220
              S Q    +DD+ +  +YHLKVTVK R  LER +K  GV Q+H L  LH +D+ DL   
Sbjct: 140  --SSQMPKIYDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLT 197

Query: 221  DSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLN 280
            D+ DP L+D  +YVS DTNKLI IEIF+PEF+  +  E F  DAIKKRY+  C K   L+
Sbjct: 198  DAEDPHLIDSVMYVSSDTNKLICIEIFKPEFSQADLTE-FCPDAIKKRYSSACDKYPDLD 256

Query: 281  KKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASS 340
                PSQ +CF TL KIFKGPL R+  E+ +KTI + N  LN+ L+ +WLT K+ F+   
Sbjct: 257  PDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQ 316

Query: 341  EIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKN 400
              D +      E+ PPD+  YV D + R++RES+ +KCL+LIF G++S+SL+T     K+
Sbjct: 317  ANDTDEAGSAMEFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKD 376

Query: 401  TKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDR 460
            +++ +     QTS S S +FHLL E+R  +   S E     +D   +F+NLS  +YYTD+
Sbjct: 377  SRA-RSFQLYQTSNSLSFFFHLLNETRGVMDYGSQE-----IDRNYNFMNLSSCYYYTDK 430

Query: 461  DIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKI 520
            DII+NYE  + LD +NIG+YFDALTYIAN KG+Y LIAYC KQ+++G+EAL++AL  F I
Sbjct: 431  DIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGI 490

Query: 521  DPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHE 580
            DP + ++  + +  LL +Y+ E S  S  T  H T  KNALRLLAK   S  L+FY  +E
Sbjct: 491  DPSDTSLMTIPDELLLGVYRKECSQGS--TQKHAT-LKNALRLLAKAKNSSTLQFYAAYE 547

Query: 581  PYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNF 640
            PY  + QAY  L +DESVD D+I+TAY+IK+ DSPGLK+DCDRA+YT+A++KRS+ LFNF
Sbjct: 548  PYDNVHQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNF 607

Query: 641  LTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILR 700
            L ++CP F ++Y  +KL Y +AL LLQVNENASD+ +L++F++KW  E+V  PDQFL   
Sbjct: 608  LVEQCPVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSS 667

Query: 701  AALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPL 760
            +ALT+I   RNS LI  +L TGTID   LP  NWPTG+NNIGNTCYLNSLLQYYF I+PL
Sbjct: 668  SALTKIGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPL 727

Query: 761  RRYILEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRER 820
            R++I++YQKTL  F+D + N G                   QF+YQLR+LF  M+H+  R
Sbjct: 728  RQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESR 787

Query: 821  CVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLI 880
             VTP KELAYLAFAPSN+EVEFE                  G  T E A  + E D  +I
Sbjct: 788  FVTPRKELAYLAFAPSNIEVEFE------------------GTPTVEPAKENSENDVEVI 829

Query: 881  DLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITD---LASPTRVAKIGSDQLEN 937
            DL  E + + DVD                 E TV  ++     + S TRVAKI +DQLEN
Sbjct: 830  DLTAEGEASEDVDMLKPAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTDQLEN 889

Query: 938  ALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDK 997
            ALEMGRQQDVTECIGNVLFQ+ES S+PI  D D EQ DLIK+LF+G  KQ + PL    K
Sbjct: 890  ALEMGRQQDVTECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSK 949

Query: 998  VRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQI 1057
            +RTK+ERF+SLLVN+GDHPK++YDA D YFKD+ L +E+ GDVKRT+A+   P +LQ+QI
Sbjct: 950  IRTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTLAIKELPVVLQIQI 1008

Query: 1058 QRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQR 1117
            QRVYYDRE+FMPFKSIEPLPF++ IYMDRY DT++  +  K++E  + K  L+ +K RQ+
Sbjct: 1009 QRVYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQK 1068

Query: 1118 ELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLY 1177
             LL+++ +G++ K + LE+ + LES ++   A   +     ++ ++S ++ IDNEL  +Y
Sbjct: 1069 ALLEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIY 1128

Query: 1178 NDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            + I +L+ K+S  FD+F+E GYSLF+VFIHRGEASYGHYW+YIKD N  G+WRKYNDET+
Sbjct: 1129 SRITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETV 1188

Query: 1238 SXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRIL 1277
            +            GNTATPYFLVYVK G ES+I+PL R++
Sbjct: 1189 TEAPENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1238 (49%), Positives = 833/1238 (67%), Gaps = 33/1238 (2%)

Query: 44   ASLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSG 103
              L+      D+GK LLYPD  +  P KTS+RLLD++  +  + NS   +++   L  SG
Sbjct: 26   GGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALH-SG 84

Query: 104  ILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLS 163
            +L+  +L YS  +    P ++G L DQV ++T+ EY+S +CP  NK+ VF  V+++PS+ 
Sbjct: 85   VLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIV 143

Query: 164  EQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSS 223
             ++    +D+   PIYHLK+TVK R  LE  +K  GV Q+H L  LH  D+ DL   + S
Sbjct: 144  PREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEES 200

Query: 224  DPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKE 283
            DP L+D  +YVS DTNKL+ IEIF+PEF S E+  +F+ D+I++R+ + C K   L+ ++
Sbjct: 201  DPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEK 259

Query: 284  APSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEID 343
             PSQ +CF TL KIFKGPL R+S ++ +KTI + N  LN+ +   WLT ++ FQ      
Sbjct: 260  VPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQA 319

Query: 344  EETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKS 403
             E  +   EY PPD+  YV + + RK+RE + +KCL+L+F G+++ +L++ +   +++++
Sbjct: 320  SEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRA 379

Query: 404  VKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDII 463
             +     Q S+S S +FHLLGE+R  +   + E     +D   HFINLS  HYY+D+DII
Sbjct: 380  -RSFHLYQISYSPSFFFHLLGETRGVMDYGTQE-----IDKNYHFINLSACHYYSDKDII 433

Query: 464  RNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPK 523
            +NYE  + LDP+NIG+YFDAL +IAN KG+YQLI YC KQ+++G+EAL++AL  F ID  
Sbjct: 434  KNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDAS 493

Query: 524  EFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYR 583
            + +++ + +  LL IY+ E+S  S+   + L   KN+LRL+AK  KS  L+FY  +EPY 
Sbjct: 494  DTDLSTVPDDLLLGIYRKESSQASQQKRSSL---KNSLRLIAKAKKSQILQFYTAYEPYD 550

Query: 584  ALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTD 643
               QAY  L ++ESVD DII+TAY++K+ DSPGLK+DCDRA+YTIA+S+RS+ LFNFL +
Sbjct: 551  NTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAE 610

Query: 644  ECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAAL 703
            +CP F ++Y  +KL YQEAL LLQVNENASD+ +L++F++KW+ E V  PDQFLI  +AL
Sbjct: 611  QCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSAL 670

Query: 704  TRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY 763
            T+I   RNS LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR+ 
Sbjct: 671  TKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQS 730

Query: 764  ILEYQKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVT 823
            I+EYQKTL  F+  + +                     QF+YQLR+LF  MVH+  R VT
Sbjct: 731  IVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVT 790

Query: 824  PSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLI--- 880
            P+KELAYLAFAPSN+EVEFE      G+  +    +++ E       T+E  D + +   
Sbjct: 791  PTKELAYLAFAPSNIEVEFE------GTPSSGSVGEAEDEEEGAIKETTEVIDLTSVPNA 844

Query: 881  --DLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLENA 938
              D+EM D   S+ +  +            D +    E I    + TRVAKI SDQLENA
Sbjct: 845  EQDIEMLDPVPSESEMIV---EQFVDSPKDDKKQDAAEAI---GTSTRVAKISSDQLENA 898

Query: 939  LEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKV 998
            LEMGRQQDVTECIGNVLFQ+ES SEP   D D EQ DLIKQLF+G  +Q + PL+   KV
Sbjct: 899  LEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKV 958

Query: 999  RTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQ 1058
            RTK+ERF+SLLVN+GDHPKD+YDA D YFK++ L +E+ GDV R+VA+   P +LQ+QIQ
Sbjct: 959  RTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQ 1017

Query: 1059 RVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRE 1118
            RVYYDRERFMPFKSIEPLPF++ IYMDRY DTE+P++L K+EE   +K+ L  +K +QR 
Sbjct: 1018 RVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRS 1077

Query: 1119 LLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYN 1178
            LLD++ SG++ K + LE+ + L+S+++      S + +  I+ + S ++ ID EL S+Y+
Sbjct: 1078 LLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYH 1137

Query: 1179 DINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
             I  LE K+S  FDDF++ GYSLF+VFIHRGEASYGHYWIYIKD    G+WRKYNDE+++
Sbjct: 1138 RIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVT 1197

Query: 1239 XXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRI 1276
                        GNTATPYFLVYVK GQES IEPL R+
Sbjct: 1198 EAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1241 (50%), Positives = 842/1241 (67%), Gaps = 44/1241 (3%)

Query: 53   VDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFL----NSTDPNVIEKGLQ-TSGILRE 107
            +DDG  LLY ++    PLKTS+R+LDD+L +   +    +  + N +    Q  + IL++
Sbjct: 67   LDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQ 126

Query: 108  SMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQI 167
             M+ YS  R+++ P+++GS+ DQ+ IQ+K EY S++CP +NKI VF  V+++   S Q+ 
Sbjct: 127  PMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLID---STQKA 183

Query: 168  SSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKL 227
            ++ DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D+ DL TFD +   L
Sbjct: 184  NTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANL 243

Query: 228  MDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQ 287
            +D+ IYVS+DTNKLILIEIF PEF+S EE   FT + I +RY     + E  + ++ P+ 
Sbjct: 244  IDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTG 303

Query: 288  PDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETN 347
             +C  TLFK+FKGPLTRKS  +PIK I+S N +L  H+N EWL SKYGF    E D ET 
Sbjct: 304  IECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVETG 363

Query: 348  DPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGL 407
            D FTEY PPD+  YV +   RKIRES  +KCL+LIF+G++  +LL+     K++KS++  
Sbjct: 364  DEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSLRTF 423

Query: 408  SSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYE 467
            + LQTSFSTS +F LL + R   L   N+   S  + + HFINLSVS++Y++RDII+ +E
Sbjct: 424  NLLQTSFSTS-FFKLLIQERGVGLPIENQ---SNYNIDYHFINLSVSYHYSERDIIQMFE 479

Query: 468  ALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNI 527
             +S +DPDNIG Y+D+L +IAN KG+YQLIAYC K +I+GQE+LE A+ TF +D     +
Sbjct: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539

Query: 528  AELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 587
            + L ++ ++SIY+ E  NKS     H+ N +NAL++LA Y KS KLKF+VD+EPY     
Sbjct: 540  SSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTRT 598

Query: 588  AYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQ 647
            AY+ L IDES+D+DII+TAYSIK+ND+PGLKLDCDRALYTIAI++RS+ LFNFL +    
Sbjct: 599  AYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNLI 658

Query: 648  FLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRIS 707
            F +YY  +   Y  AL LLQVNENASDE +L++F++KW++E++   D  L L+AALT+I+
Sbjct: 659  FQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIA 718

Query: 708  IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
             +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I+ Y
Sbjct: 719  FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778

Query: 768  QKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKE 827
             KT+D+  ++L   G                   QF+YQLR+LF  M++S  RCVTP KE
Sbjct: 779  TKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKE 838

Query: 828  LAYLAFAPSNVEVEFEVEGNK-----VGSNGAAISADSKGE---VTQEAATTSEEKDPSL 879
            LAYLAFAPSNVEVEF+ E  K     + +    + AD K +   V  ++   +  +D  L
Sbjct: 839  LAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKL 898

Query: 880  I---DLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSDQLE 936
            +   D  + DK   +  K I                    N     + TRVAKI  DQLE
Sbjct: 899  LVDLDSNISDKIKEEEVKKI--------------------NTLKPVTSTRVAKISPDQLE 938

Query: 937  NALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATD 996
            NALEMGRQQDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  + 
Sbjct: 939  NALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSK 998

Query: 997  KVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQ 1056
              R K+ERFLSLLVNIGDHPK+IYDA D YF DE L MEEYG+V++T+++T FP+ILQ+Q
Sbjct: 999  PPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQ 1058

Query: 1057 IQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQ 1116
            IQRVYYDRE+F+PFKSIEPLPF  V+YMDRY++ +N  L+  K +   MK+ L  MK RQ
Sbjct: 1059 IQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQ 1118

Query: 1117 RELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSL 1176
            +ELL R+E GL+RK++ +E+ +LL S+++     +      +I  +++N+++ID EL +L
Sbjct: 1119 KELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTL 1178

Query: 1177 YNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDET 1236
            +N+I  +E  IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD     +WRKYNDET
Sbjct: 1179 FNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDET 1238

Query: 1237 ISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKRIL 1277
            I+            GNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1239 ITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1234 (48%), Positives = 799/1234 (64%), Gaps = 35/1234 (2%)

Query: 56   GKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSF 115
            GK +LYP ++ + P KTSDRLLDD+        ST   V+E G++ +G+L+  ML YS  
Sbjct: 30   GKTVLYPLVSGNYPFKTSDRLLDDI-------RSTLSFVLE-GVRGNGVLKSPMLDYSKE 81

Query: 116  RSSIRPNALGSLTDQVTIQTKTEYDSISCP------RYNKIYVFQAVILNPSLSEQQISS 169
            R  +R  ++G L DQV +QT  EY S+         +++KI VF  ++ +P +   ++ S
Sbjct: 82   RGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMV---KLCS 138

Query: 170  FDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMD 229
             DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D+ DL  F+  D  ++D
Sbjct: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198

Query: 230  YGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPD 289
               YVS  TN+L+ IEI +PEF + EE   FT D+I+KRY  +C K   LN++  P+Q +
Sbjct: 199  SATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAE 257

Query: 290  CFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDP 349
            C  TLFK+FK PL+R+  ++ +KTI + N VLN+ L+  WL  K+GF+   E+ EE    
Sbjct: 258  CLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDGRK 316

Query: 350  FTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSS 409
              EY PPD   YV DWN R +RE +++K L+L+F G+ S  LL P   +  +  ++    
Sbjct: 317  EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASSKLRSFQL 375

Query: 410  LQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEAL 469
             QT FS + WF LLGE       + N+Q   P D   HFINLSV++YY DRDIIRNYE+ 
Sbjct: 376  YQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQ 432

Query: 470  SSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAE 529
              LDP N G+Y+D LT+IAN KG++QL+ +  KQNI+GQEAL +AL  F IDP E +  +
Sbjct: 433  ILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQ 492

Query: 530  LNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
            + +  LLS YK E   K   T  H  + +NALRLLAKY +S+KLKFYV+ EP++  SQAY
Sbjct: 493  IPDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAY 549

Query: 590  DTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFL 649
              L IDESVD DII+TAY+IK++D+PGLK+DCDRALYT+AI+KRS+DLFN+L   CP+F 
Sbjct: 550  SILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQ 609

Query: 650  KYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIE 709
            ++Y      Y  AL+ LQVN NA+D+ +L+IF++KW +E V  PDQFL L+ AL +I+ E
Sbjct: 610  QFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHE 669

Query: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769
            RNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI  Y+ 
Sbjct: 670  RNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYED 729

Query: 770  TLDNFNDHLSNSGHXXXXXXXXXXXXX--XXXXXQFIYQLRNLFYAMVHSRERCVTPSKE 827
            T  +   +++ SG                     QF+YQLR+LF  M HS+ERCVTPS+E
Sbjct: 730  TASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRE 789

Query: 828  LAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDK 887
            LAYL+F+PS   VEFE        +   +          E    S E      +   ED 
Sbjct: 790  LAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNVETEAAAEDI 849

Query: 888  TNSD-VD-KDIXXXXXXXXXXXXDIEITVGENITDLASP---TRVAKIGSDQLENALEMG 942
               D +D KD               +     NI +   P   T VAKI  DQLEN LE+G
Sbjct: 850  IADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKISPDQLENTLEIG 909

Query: 943  RQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKV 1002
            RQQDVTECIGNVL+QIES S P+ +DE +EQYDL+KQLFYG  KQ ++P+   +K RTK 
Sbjct: 910  RQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKF 969

Query: 1003 ERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTM-EEYGDVKRTVAVTTFPTILQVQIQRVY 1061
            ERF+SLLVN+GDHPKDIYDA D YF+D+ L + ++   V+R+VAV   PTILQ+QIQRVY
Sbjct: 970  ERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVY 1029

Query: 1062 YDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLD 1121
            YDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK+E+ Q+ + L+ +K R++++L 
Sbjct: 1030 YDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILS 1089

Query: 1122 RDESGLTRKDAFLESIKLLESNIVV-TEASNSEDNKDVIRILKSNIIDIDNELMSLYNDI 1180
            ++++GLT KD+  E+   LES+++  +E     + +++I+ L S  ++ID EL +L + I
Sbjct: 1090 KNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKI 1149

Query: 1181 NSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXX 1240
              +E+ ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR   G+WRKYNDE+++  
Sbjct: 1150 KDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEV 1209

Query: 1241 XXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLK 1274
                       NTATPYFLVY+K G E +IEPLK
Sbjct: 1210 PESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1246 (45%), Positives = 771/1246 (61%), Gaps = 70/1246 (5%)

Query: 45   SLQSAPVAVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGI 104
            SL+S    VDDGK LLY DI+ S P KT DR+LDD+     FL              S +
Sbjct: 30   SLESFSDLVDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKF----------GSSV 79

Query: 105  LRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSE 164
            +++ ML YS  R  ++P  L  L DQV ++++ +YDS++CP  N I V  A++++P+ + 
Sbjct: 80   MKQPMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTP 139

Query: 165  QQISSFDDIVRIP--IYHLKVTVKIRQELERLKKHVGVTQFHSLD--HLHEYDRVDLSTF 220
               + FDDI + P   +HLK+TVK R  LE   +HVG+T +H L+   LH +D+ D+   
Sbjct: 140  ---NDFDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIM 196

Query: 221  DSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLN 280
            +  D +L+D  I+VS DTNKLIL+EI +PEFNS E    + T  I++RY + C + + LN
Sbjct: 197  EEKDCRLVDQSIFVSADTNKLILVEIIKPEFNS-ENLAEYRTAKIEERYKNACQEFDLLN 255

Query: 281  KKEAPSQPDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASS 340
              + PSQ +C  TLF IFK PL RKS     K I   ++ LN+ +N +WLT+ + F    
Sbjct: 256  PDDIPSQAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQK 315

Query: 341  EIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKN 400
               E+      EY PPD+V Y+ D+  R IRE++ +K ++++  G+   S+L  N     
Sbjct: 316  TAVEDNVQSGEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGK--QSMLLENELGTE 373

Query: 401  TKSV-KGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTD 459
             K+V K  S+   S S + WF++L                 P D   HFINLSV+  Y D
Sbjct: 374  KKTVAKCFSNQHFSASHTWWFNILNHQHIEPF---------PYDINYHFINLSVAFKYID 424

Query: 460  RDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFK 519
            +DII+NYE   +LD +NI  YFDAL Y+ N KG+YQLIAYCGKQ+++G E L NAL  F 
Sbjct: 425  KDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFG 484

Query: 520  IDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDH 579
            +DP + + + L+  T++  Y    S+  + + N   + +NALR+L KY  S K+ F V++
Sbjct: 485  LDPTDIDASLLDANTMIEYY---NSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEY 541

Query: 580  EPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFN 639
            EPY  + QAY  L +DE+VD+DII+TAY+I I D+PGLK D DRA++TIA+ +RS+ L N
Sbjct: 542  EPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLN 601

Query: 640  FLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLIL 699
             LTDECP+F +YY    + Y EAL +++++ NASD+ +L++F++KW    +  PD  L L
Sbjct: 602  VLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKL 661

Query: 700  RAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAP 759
            + AL  I   RNS LI +FL TG +D + LP   WP GINN+GNTCYLNSLLQ++F+I P
Sbjct: 662  KMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKP 721

Query: 760  LRRYILEY----QKTLDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMV 815
            LR +IL Y     K LD    H                        QF+Y LR+LF  M+
Sbjct: 722  LRDFILNYDDDSAKLLDASEYH-----SRRRIGGREVSKQEELRSVQFVYHLRDLFNDMI 776

Query: 816  HSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEK 875
            H+  RCVTP+KEL YLAFAPSNVEVEF   G+   +    I             TT   +
Sbjct: 777  HTNSRCVTPTKELVYLAFAPSNVEVEF---GDDTVAQKELID-----------LTTDVVE 822

Query: 876  DPSLIDLEMEDKTN--SDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPTRVAKIGSD 933
            DP+       D T   +  D DI                  G          +VAKI +D
Sbjct: 823  DPT-------DTTRHLASCDDDIIMCQSPVALPEHKTSSEAGTQ----QYSVQVAKISAD 871

Query: 934  QLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLS 993
            QLEN LE+GRQQDVTECIGNVL Q+E  SEP+  ++D EQ DL+KQLFYG  KQ ++P++
Sbjct: 872  QLENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVN 931

Query: 994  ATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTIL 1053
                VRTK ERFLSLLVN GDHPKDIYDA D YF+++YL +EEYGDVKRTV+++  P +L
Sbjct: 932  DEASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVL 991

Query: 1054 QVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMK 1113
            Q+QIQRVYYDRE+FMPFKSIEPLPF E +YMDRY  TE+P LLA+ ++  ++KQ L+ +K
Sbjct: 992  QIQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLK 1051

Query: 1114 NRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNEL 1173
             RQR+LL ++E GLT K + +E+ K L+S  +     ++++    I  +   I +ID EL
Sbjct: 1052 QRQRKLLSQNEIGLTLKSSLIETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEEL 1111

Query: 1174 MSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYN 1233
             SL+N I  LE  IS QF +F+  GYSLF+VFIHRGEASYGHYW+YIKD    G+WRKYN
Sbjct: 1112 KSLFNKITDLETTISQQFSEFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYN 1171

Query: 1234 DETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESD-IEPLKRILE 1278
            D++++            GNTATPYFLVYV++GQE + IEPLKRIL+
Sbjct: 1172 DDSVTEVPQSEVFNFTEGNTATPYFLVYVREGQEQETIEPLKRILQ 1217

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/835 (46%), Positives = 546/835 (65%), Gaps = 39/835 (4%)

Query: 54  DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113
           DDG+ +LY ++A   P+KTSDRLLDDV   T+ L+       E+G +   +LR  ML Y+
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRV-TVSLS-------EEGRE---VLRAPMLEYA 69

Query: 114 SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173
             R++ R  ++G L DQV +QT  EY S +C + N+++VF  V+ +P    Q+ +S D++
Sbjct: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125

Query: 174 VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIY 233
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D+ D   F+  DP ++D   Y
Sbjct: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185

Query: 234 VSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYT 293
           V+  TN+L+ IE+ +PEF  P+E + FT + I+ RY ++C ++  L+  + PSQ +C  T
Sbjct: 186 VASGTNRLVRIEVLRPEFG-PDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244

Query: 294 LFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEY 353
           LFK+FK PL+R+  ++ +KTI + N VLN+ L A WL +K+GF+   EI+E+    + EY
Sbjct: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EIEEDGQKIY-EY 302

Query: 354 VPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTS 413
            PPD   +V +W  R+ RES+++K L+LIF G+ S  L+  +  + N+K ++     QT 
Sbjct: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361

Query: 414 FSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLD 473
           FS S W+HL+GE       + N+Q H P D   HF++LS ++YY+DRDII+NYEA  +LD
Sbjct: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417

Query: 474 PDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEA 533
           P N  +Y+D L+++AN KG+ QL+ Y  KQN++G EAL +AL  F +DP   +  +L++ 
Sbjct: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477

Query: 534 TLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593
            LL  YK E    S    +   + +NALRLLA+Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 478 FLLESYK-EVCKDSGPQKH--ADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLE 534

Query: 594 IDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYG 653
           IDESVD DII+TAYSIK++D+PGLK+DC RALYT+A++KRS+ LFN L  +CP+F ++Y 
Sbjct: 535 IDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594

Query: 654 PEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSN 713
              L YQ AL+ L VN NA+D+ +L+IF++KW  + +  P+Q L L+ ALT+I  ERNS 
Sbjct: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654

Query: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T  N
Sbjct: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASN 714

Query: 774 -FNDHLSNSGHXXXX-XXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYL 831
             N+ +S+S                     QF+YQLR+LF+ MVHSRER VTP++EL YL
Sbjct: 715 LLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774

Query: 832 AFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMED 886
           +F+PS+ EVEFE     VG+   A+ A+   EV  E        D  +ID+ ME+
Sbjct: 775 SFSPSSTEVEFEPVPPAVGTASNALVAN---EVYNE--------DTEVIDISMEE 818

 Score =  384 bits (986), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 261/373 (69%), Gaps = 10/373 (2%)

Query: 915  GENITDLASP--------TRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR 966
            G++IT + SP        T VAKI SDQLEN LE+GRQQDVTECIGNVL+QIES S P+ 
Sbjct: 1016 GKDITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLS 1075

Query: 967  YDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSY 1026
             DE+ EQ+DL+KQLFYG  KQ ++PL   D+ RTK+ERF+SLLVNIGDHPKDIYDA DSY
Sbjct: 1076 LDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSY 1135

Query: 1027 FK-DEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1085
            FK D     E+ G V+R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMD
Sbjct: 1136 FKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMD 1195

Query: 1086 RYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIV 1145
            RY  T+N  L AKK++   +++ L+ ++ R+R LL +++ G+T   A  ++ + L++  +
Sbjct: 1196 RYLATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAEL 1255

Query: 1146 VTEASN-SEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSV 1204
             + +    E        L +  + +D EL +L   I S++D I+H+FD F  YGYSL +V
Sbjct: 1256 TSGSRQLQEQYHATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAV 1315

Query: 1205 FIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQ 1264
            FIHRGEASYGHYW+YIKD   GG+WRKYNDE+++             NTATPYFLVYVK+
Sbjct: 1316 FIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKE 1375

Query: 1265 GQESDIEPLKRIL 1277
              E DIEPLKR+L
Sbjct: 1376 AHELDIEPLKRLL 1388

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1213 (37%), Positives = 653/1213 (53%), Gaps = 116/1213 (9%)

Query: 86   FLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIRPNALGSLTDQVT-IQTKTEYDSISC 144
            F+NS+   + E GL   GILR     YS FRSS     + +L+++   I  + EY+S + 
Sbjct: 122  FINSSADEIKELGL-NKGILRLPTTDYSKFRSSFSEYKIINLSNKNNLINYRFEYESKTN 180

Query: 145  PRYNKIYVFQAVILNP----SLSEQQISSFDDIVRIPIYHLKVTVKIRQELERLKKHVGV 200
             + NKI  F +++  P    +L  + ++ F    +   YHLKV++K R +LE  KKH  +
Sbjct: 181  HQDNKILEFFSILHKPKDASNLDYESMAKF--WSQNEFYHLKVSIKTRNQLELSKKHTPI 238

Query: 201  TQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESF 260
              F+ +D  +E D++D   F+  +P L+DY I++S +TNK++L+EIF+ EFN  ++    
Sbjct: 239  QHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVEIFKSEFNLNDK--LI 296

Query: 261  TTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKGPLTR---KSKEEPIKTIDSG 317
              D ++   N    KN S +K + P+Q D    L   F          S E+ IK  DS 
Sbjct: 297  ILDDLQVLNNYEKYKN-SNHKLKLPTQTDVLLVLMYCFNKQQNFDNIHSSEDEIKLKDSK 355

Query: 318  NLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKK 377
               +   LN  WLT ++  +   +            +  ++   +    K K R     +
Sbjct: 356  --AIKISLNPSWLTERFSLKFQED---------ESLIFMNLRNNLNLIKKEKRRFDVFTR 404

Query: 378  CLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQ 437
            CL  +F    SA       + K+T  +K + ++  + S S W  +LGE ++ IL  +N  
Sbjct: 405  CLLELFVLIKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFWSQILGEYKS-ILSQNNFN 463

Query: 438  AHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLI 497
             +S       FINLS+   YT+ +I++NYE L+ L+PD IG+YFD+L +++     Y+ +
Sbjct: 464  QYS---KHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLKFVSQCLTQYENL 520

Query: 498  A-YCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTN 556
            A Y  K  IIG E    +L  FK+D  EF     +++ L   Y     +K+    NH   
Sbjct: 521  ADYVNKNEIIGNEEFNQSLKIFKMDKLEF--TNCSDSVLWEKYLTYYEDKN-FDYNHAI- 576

Query: 557  FKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPG 616
             +N+++ L+    S  LKF   +EPY+    A+ TL+I ESVD D I  +Y+ KIND   
Sbjct: 577  LRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVSYTTKINDMKD 636

Query: 617  LKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDET 676
             K   D+AL TIAI ++ L LF+ L + C  F+  Y    + Y+ AL+ +  +E  SD  
Sbjct: 637  KKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAIDSSELNSDNE 696

Query: 677  VLKIFKQKWY----DESVFEPD--QFLILRAALTRISIERNSNLITNFLLTGTIDPNSLP 730
            ++  FK++WY    +   F  D    L LR  +  IS  RNS L+ N++  G ++P  LP
Sbjct: 697  LILSFKKRWYRIDVNNDTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYIEYGIVNPKFLP 756

Query: 731  PENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSGHXXXXXXX 790
             ++WP G+NNIGNTCYLNSLLQYYF+I+PLR Y++       NFND +   G        
Sbjct: 757  SKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLI-------NFND-IELDGREMKNLEK 808

Query: 791  XX------XXXXXXXXXQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEV 844
                             QF+YQLR+L+  MVHS  R V+P  +LAYLAFAPS+  +EF  
Sbjct: 809  RRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPIEFR- 867

Query: 845  EG--NKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXXXX 902
            +G  N +G N      D   + T   + +S     S+  L     ++SD D  +      
Sbjct: 868  DGIQNAIGKN------DYYSDKTNGGSESS-----SIKGLNSNLNSDSDADSSLDSDSES 916

Query: 903  XXXXXXDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGS 962
                  ++ I +  + T+L  PT + KI S QLE  LEMG QQDVTECI NVLFQIE+ S
Sbjct: 917  SLLTFDNLPI-IKTSTTNL--PTLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEAAS 973

Query: 963  EPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDA 1022
             PI  DEDNEQ DL+KQLF+G T+Q I P +   KV  K ERFLSLLV++ D P+DIYDA
Sbjct: 974  NPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDA 1033

Query: 1023 FDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI 1082
             D+YFKDE   MEEYG VK+++ +++FPTILQVQIQRVYYD E+ +PFK +EPL F E +
Sbjct: 1034 LDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESL 1093

Query: 1083 YMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLES 1142
            Y+DRY++  +  L  KK E   +K+ LK +   ++EL  ++++                 
Sbjct: 1094 YLDRYANDIDEKLAEKKIEVASLKKRLKGLITIKKELEKKNDNV---------------- 1137

Query: 1143 NIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLF 1202
                                         E+ ++  +IN +E KI   F +F ++GYSLF
Sbjct: 1138 -----------------------------EIRTISKEINDVETKIDTAFSEFHKHGYSLF 1168

Query: 1203 SVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYV 1262
            +VFIHRG+A++GHYWIYIKD    G WRKYND  ++            GN++TPYFLVY+
Sbjct: 1169 AVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYI 1228

Query: 1263 KQGQESDIEPLKR 1275
            K G E D+EPLKR
Sbjct: 1229 KNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1253 (32%), Positives = 630/1253 (50%), Gaps = 129/1253 (10%)

Query: 52   AVDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLS 111
            ++DDG HLLY +I      KTS R+LDD+L D  F+ S D    +      G+L    + 
Sbjct: 67   SIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFM-SLDSEKSDDIDFKDGVLNLPTIK 125

Query: 112  YSSFRSSIRPNALGSL-TDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSF 170
            YS +R  I+P  +    T+   +  K ++ S++ P+ N I     +++       ++++F
Sbjct: 126  YSLWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRSELNTF 185

Query: 171  DDIVRI-PIYHLKVTVKIRQELERLKKHVGVTQFHSLD---HLHEYDRVDLSTFDSSDPK 226
            D+ +R  P+Y +++TVK R  LE  KKH+ +T +  LD    LHE D+ D   F+     
Sbjct: 186  DEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNKDSKD 245

Query: 227  LMDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESL----NKK 282
            L+D+ IY+S DTNK+ILIEIF+P FN  E     ++ ++  R N+L   +E L    N  
Sbjct: 246  LLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPDYNDA 305

Query: 283  EAPSQPDC----FYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQA 338
                Q D      + + +  KG   R+ +++    + S ++ L T+++ +WL   +  + 
Sbjct: 306  IVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKV 365

Query: 339  SSE---------IDEETNDPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSA 389
              +         +DE     F +  P +   +          +   +  ++L++ G++  
Sbjct: 366  KEQKRKDHVSITLDEALKLSFDDPNPKNQAKF----------DKITRYAMELMYLGKVLQ 415

Query: 390  SLLTPNSSLKNTKSVKGLSSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFI 449
            S  +    ++          ++   +TS W  +L E ++      + Q  S    ++HFI
Sbjct: 416  SFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIF----SSQKTSTRCVDEHFI 471

Query: 450  NLSVSHYYTDRDIIRNYEALSSLDPDNIGLYFDALTYIANRKGAYQLI-AYCGKQNIIGQ 508
            NL +    +++DII NYE     DPDN   YF++L Y++ +   Y ++  YC +  II +
Sbjct: 472  NLCIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISK 531

Query: 509  EALENALVTFKIDPKEFNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYT 568
             A  +AL  FK   + FN  E + + +   Y     + +     +  +  ++   LA   
Sbjct: 532  AAYLHALEIFKYSEEYFNAIE-HVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVK 590

Query: 569  KSDKLKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTI 628
            KS  L +   +EP+     AY  L++D  +D + I  AY+++I + P  K+  DRAL+ I
Sbjct: 591  KSSPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAI 650

Query: 629  AISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDE 688
            AI +  L L   L   C  F +      L   +A +++ + + +S+ +++  F + W + 
Sbjct: 651  AIQRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKET 710

Query: 689  SVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLN 748
                P  F++  AAL  +S  R S L+ +F   G ++P  +  E WPTGINNIGNTCYLN
Sbjct: 711  DDSNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLN 770

Query: 749  SLLQYYFSIAPLRRYILEYQKT---LDNFNDHLSNSGHXXXXXXXXXXXXXXXXXXQFIY 805
            SLLQYYFSI   R +I  YQ     L N N  +S                      QFIY
Sbjct: 771  SLLQYYFSITLFREFIENYQSIESDLLNSNAEMSKR----RVGGREIQNNEINRSVQFIY 826

Query: 806  QLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVT 865
            Q+++LF  MVH++ R VTPS +LAYLAFAP+N E++F+ +     S    ++  +   + 
Sbjct: 827  QVQDLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSELESSEEHQLT--TSHSIA 884

Query: 866  QEAATTSEEKDPSLIDLEMEDKTNSDVDKDIXXXXXXXXXXXXDIEITVGENITDLASPT 925
              +AT+                ++SD+D               D +I++    +   S  
Sbjct: 885  LSSATSI---------------SHSDID-------------TQDHDISLN---STSYSNR 913

Query: 926  RVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTT 985
             VA +  D LE  LE+G QQDVTECI  VL+Q+E+GS P+  D DNEQ DL+K+LFYG T
Sbjct: 914  LVAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGET 973

Query: 986  KQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVA 1045
             Q I P+    K   K E + SLLVNI D P D+Y+  D YF DEY++MEEYG+VK+T++
Sbjct: 974  IQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLS 1033

Query: 1046 VTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRY---SDTENPLLLAKKEET 1102
            +T  PTIL +QIQRVYYD+E+ +P+K    LPFK  I++DRY   +  EN +L       
Sbjct: 1034 ITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNKKENDVL------- 1086

Query: 1103 EQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRIL 1162
            E+ +  LK+ K + REL+                    E N V         NK      
Sbjct: 1087 EKARLELKLAKVKYRELVS-------------------EYNSV---------NK------ 1112

Query: 1163 KSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKD 1222
                  I + +++ Y+ I  L   I  +     +  YSLF+VFIHRG+AS+GHYW+YI+D
Sbjct: 1113 -----SISDRIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIRD 1167

Query: 1223 RNYGGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQESDIEPLKR 1275
                G+WRKYND  ++            G+ +TPYFL YV   ++S ++PL R
Sbjct: 1168 FE-NGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVR 1219

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKT 770
           P G+ N+GNTCYLN+ LQ  F I PLR  IL Y+++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  +  H+G  S  GHY  +I+DR    +W K+ND+ ++
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVT 474

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNF 774
           P G+ N+GNTCY+N+ LQ  + I PLR  IL + K   NF
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVS 463

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 44/109 (40%), Gaps = 25/109 (22%)

Query: 716 TNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFN 775
           T FL   T     +  +  P G+ N+GNTCY N+ LQ  + I PLR  +L Y +   + +
Sbjct: 86  TKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLH 145

Query: 776 DHLSNSGHXXXXXXXXXXXXXXXXXXQFIYQLRNLFYAMVHSRERCVTP 824
                                     Q + QLRN F A    +E+  TP
Sbjct: 146 G-------------------------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y+L  V  H+G  S  GHY  +++D      W KYND+ +
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKV 454

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773
           P G+ N+GNTCY+NS LQ  + I PLR  IL +Q   +N
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN 143

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVS 466

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P GI N+GNTCY+N+ LQ  F I PLR  +LE+
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P G  N+GNTCYLNS LQ  + I PLR  IL Y
Sbjct: 107 PIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVS 471

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ 768
           P G+ N+GNTCY+NS LQ  + I PLR  +L Y+
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYK 92

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVS 420

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P G  N+GNTCYLN+ LQ  + I PLR  IL+Y
Sbjct: 108 PIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 23/102 (22%)

Query: 695 QFLILRAALTRISIERNSNLI---TNFLLTGTIDPN-------------SLPPE------ 732
           Q  +++  LT  SI+  S +I   +N +L GT D N              L PE      
Sbjct: 43  QKYMVKGGLTDDSIKNLSEIIKPGSNIMLLGTPDANLVSKPKSQNHFIEDLTPEQQVQQF 102

Query: 733 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773
            + P G  N+GNTCYLN+ LQ  + I  LR  +L +  +++N
Sbjct: 103 NDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINN 144

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  H+G  S  GHY  +I+D N   +W K+ND+ +S
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVS 470

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P GI N+GNTCY+N+ LQ  + I PLR  IL +
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSGH 783
           N+L P     G+NN+GNTCY+NS LQ    I  LR Y L   ++K + N ++ L   GH
Sbjct: 333 NALTPSRGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEI-NLDNPLGYQGH 390

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSGH 783
           N + P N   G+ N+GNTCY+NS LQ    I   + Y L   Y+K + N ++ L + GH
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEI-NVDNPLGHKGH 397

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ-KTLDNFN 775
           P G  N+GNTCYLN+ LQ  F +  LR  IL Y  K   N N
Sbjct: 107 PIGFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLN 148

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D N   VW K+ND+ +S
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVS 470

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSG 782
           P G  N+GNTCYLN+ LQ  + +  LR  IL Y     N +   SNSG
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNY-----NPSQEASNSG 150

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSG 782
           P G  N+GNTCYLN+ LQ  + +  LR  IL Y     N +  +SNSG
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY-----NPSQGVSNSG 150

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           N+L P    TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSG 782
           P G  N+GNTCYLN+ LQ  + +  LR  IL Y     N +  +SN+G
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNY-----NPSQGVSNNG 150

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 23/98 (23%)

Query: 695 QFLILRAALTRISIERNSNLI---TNFLLTGTIDPN-------------SLPPEN----- 733
           Q  +++  LT  +I   S++I   +  +L GT D +              L PE+     
Sbjct: 45  QKYMVKGGLTDNTISNLSSVIKPGSTVMLLGTPDADMISKPKESNKFIEDLAPEHQRQKF 104

Query: 734 --WPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769
              P G+ N+GNTCY+NS LQ  + +  LR  +L+Y++
Sbjct: 105 NQMPIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKE 142

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVS 467

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 708 IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-- 765
           +E N + ++N  +      N L P +  TG+ N+GNTCY+NS LQ    +  LR Y L  
Sbjct: 338 VEGNHHWVSNHFVY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYN 392

Query: 766 EYQKTLDNFN 775
            Y+K ++  N
Sbjct: 393 GYEKEINEEN 402

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 708 IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           IE N +  +N+        N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 341 IEGNHHWPSNYFAY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P G+ N+GNTCY+N+ LQ  F +  +R  IL Y
Sbjct: 106 PIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVS 464

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFN 775
           P G  N+GNTCY+NS LQ  F +  L+  IL Y+   +N +
Sbjct: 108 PIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNNIS 148

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  H+G  S  GHY  +I+D N    W K+ND+ +S
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVS 476

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y GVW + +DET+
Sbjct: 722  YSLRSVIVHYGTHNYGHYIAF---RKYRGVWWRISDETV 757

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 710 RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           +N + ++N+ +      N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 272 KNYHWLSNYFMY-----NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++++PLR  IL++
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           P G+ N+GNTCYLN+ LQ  F    L+  IL+Y
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ +S
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVS 466

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 1174 MSLYNDIN-SLEDKISHQFDDFEEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNYGGVWRK 1231
            + L+N +N      IS  FDD     Y L S+ +H GE+   GHY    K ++YG  W  
Sbjct: 561  IKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYG--WLI 618

Query: 1232 YNDETISXXXXXXXXXXXXG--NTATPYFLVY 1261
            Y+DET+                 +AT Y L Y
Sbjct: 619  YDDETVQAVSDELVSRILNNEQRSATAYLLFY 650

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (43%), Gaps = 23/96 (23%)

Query: 695 QFLILRAALTRISIERNSNLI---TNFLLTGTIDPN-------------SLPPENW---- 734
           Q  +++  LT     + S+LI   T  +L GT D N              L PE      
Sbjct: 45  QKYMVKGGLTGEESIQISSLIKPGTTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQF 104

Query: 735 ---PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
              P G  N+GNTCYLN+ LQ  + +  +R  IL Y
Sbjct: 105 AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVT 471

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            YSL SV +H G  +YGHY  +   R Y G W + +DET+ 
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVG 660

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYL---- 1032
            + +LF G  K  I  ++  D   ++VE F  + +N+ +  K + ++FD+Y + E +    
Sbjct: 308  LNELFVGKMKSYIRCINV-DYESSRVEDFWDIQLNVKN-LKGVQESFDNYVEVEIMDGEN 365

Query: 1033 --TMEEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                ++YG  D K+ V   +FP++L +Q++R  YD
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYD 400

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 16/79 (20%)

Query: 702 ALTRISIERNSNLITNFLLTGTI------DPNSLPPENWPT----------GINNIGNTC 745
           +L R +  +NS  ++N  L  ++      DP  +   N+            G+ N G TC
Sbjct: 152 SLKRRTSSKNSGFLSNGRLNVSVFVRILKDPTGVLWHNFMNYDSKKLTGFIGLKNQGATC 211

Query: 746 YLNSLLQYYFSIAPLRRYI 764
           YLNSLLQ YF     R+ +
Sbjct: 212 YLNSLLQSYFFTKLFRKIV 230

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 37/95 (38%), Gaps = 24/95 (25%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTATP-- 1256
            Y+L  V +H GE S GHY+  IK  + G  W +++D+ +             G+   P  
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDD 497

Query: 1257 ---------------------YFLVYVKQGQESDI 1270
                                 Y LVY+++  E ++
Sbjct: 498  KLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNV 532

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 707 SIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
            +E++ + ++N+        N L P +   G++N+GN+CY+NS LQ    I  LR Y L
Sbjct: 274 GVEKDQHWLSNYYYY-----NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETV 717

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETV 718

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETV 716

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFND-HLSNSGH 783
           +G+ N+GNTCY+NS+LQ  F+    R   L   Y++ +    D HLSNS H
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFH 496

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ 768
           P G  N+GNTCY+N+ LQ  +    +R+ IL+Y+
Sbjct: 110 PIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1199 YSLFSVFIHRGEAS-YGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y+L  +  H+G  S  GHY  +++D N    W K+ND+ ++
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVT 473

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETV 720

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G+ N GNTCY NS+LQ  F+++ LR  IL Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (41%), Gaps = 30/182 (16%)

Query: 918  ITDLASPTRVAKIGSDQLENAL-EMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYD- 975
            +T + SPT   ++   + EN L +    QD  E      F I   S+ I+ D  N Q D 
Sbjct: 487  LTGVVSPTEFVQLL--KKENVLFDTMMHQDAHEFFN---FLINQLSDYIQTDCANPQDDN 541

Query: 976  LIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPK--DIYDAFDSYFKDEYL- 1032
             I + F G     I  LS  D V ++ E FL   + + +H +  DI     SY + E L 
Sbjct: 542  FINESFQGILTNRIKCLSC-DNVTSRDEPFLDFPIEVQEHKEFTDISTILKSYHQKEMLG 600

Query: 1033 -----------TMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEV 1081
                       T++E    +RTV +   P  L + ++R  Y  E F   K      F ++
Sbjct: 601  GHNKFYCSQCCTLQE---AQRTVGLKKLPNTLALHLKRFKYSEEHFTNIKL-----FNKI 652

Query: 1082 IY 1083
            +Y
Sbjct: 653  VY 654

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 710 RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EY 767
           +N + ++N+ +      N L P    TG+ N+GNTCY+NS LQ    I   R Y L   Y
Sbjct: 300 KNYHWLSNYFIY-----NDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGY 354

Query: 768 QKTLDNFNDHLSNSGH 783
           +K L N ++ L   GH
Sbjct: 355 EKEL-NTDNPLGYQGH 369

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRY 763
            G+NN+GNTCY+NS LQ    I P+R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDN 773
           TG+ N+GNTCY+NS+LQ  F+    R   L  +Y+K +D+
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDH 792

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 976  LIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME 1035
            ++ ++F G  K S +     D   ++VE F  L +N+ +  K + ++FD+Y + E L  E
Sbjct: 308  MLNEIFVGKMK-SYIKCIDVDYESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGE 365

Query: 1036 ------EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                  +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 366  NQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     RR + +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ 233

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAF---RKYRGYWWRISDETV 612

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + ++F G  K S +     D    +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LSEIFVGKMK-SYIKCVNVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYS 1088
                 +YG  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1089 DTE 1091
            D E
Sbjct: 429  DKE 431

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 43/108 (39%), Gaps = 32/108 (29%)

Query: 1197 YGYSLFSVFIHRGEASYGHYWIYIKDRNYGGV---WRKYNDETISXXXXXXXXXXXXGNT 1253
            Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE +             G  
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVFQENFGCD 502

Query: 1254 ATP-----------------------YFLVYVKQGQESDIEPLKRILE 1278
              P                       Y LVY++Q QE D+  L+ +LE
Sbjct: 503  RLPDEKVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            YSL SV +H G  +YGHY  +   R Y G W + +DE+++
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDESVT 723

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETV 689

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           N L P    TG++N+GN+CY+NS LQ    I  L+ Y L
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R + G W + +DET+
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAF---RKFRGCWWRISDETV 679

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 710 RNSNLITNFL-LTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 764
           +N+N+   ++   G ID   L    +  G+ N GNTC++NS+LQ   S   L  ++
Sbjct: 64  KNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFL 119

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++  LR ++LEY
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y+L SV +H G  +YGHY  Y   R + GVW + +DE++
Sbjct: 689  YALRSVIVHYGTHNYGHYIAY---RKFRGVWWRISDESV 724

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDET 1236
            YSL SV +H G  +YGHY  +   R + GVW + +DET
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RKFRGVWWRISDET 708

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  +   R Y G W + +DE++
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESV 709

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 10/97 (10%)

Query: 975  DLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTM 1034
            D + ++F G  K S +     D   ++VE F  L +N+ +  KD+  +F++Y + E +  
Sbjct: 297  DKLNEIFVGRMK-SYIKCINVDYESSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMNG 354

Query: 1035 E------EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
            E      +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 355  ENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 391

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     RR + +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQ 223

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 44/115 (38%), Gaps = 24/115 (20%)

Query: 1179 DINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            D++S  DK+  +  +     Y L  V +H G+ S GHY+  IK       W +++DE + 
Sbjct: 411  DVSSYIDKMGTEDTEMPPCIYKLHGVLVHAGDISTGHYYAMIKPST-EDQWYRFDDEKVW 469

Query: 1239 XXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQESDI 1270
                        G    P                       Y LVY+++ QE+D+
Sbjct: 470  KVTKTQVFDENFGLDRIPDDEVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + ++F G  K S +     D   ++VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGRMK-SYIKCINVDYESSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 45/113 (39%), Gaps = 32/113 (28%)

Query: 1192 DDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGV---WRKYNDETISXXXXXXXXXX 1248
            D+   Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE +           
Sbjct: 441  DNGNPYIYNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVFQE 496

Query: 1249 XXGNTATP-----------------------YFLVYVKQGQESDIEPLKRILE 1278
              G    P                       Y LVY++Q QE D+  L+ ++E
Sbjct: 497  NFGCDRLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL--LRPVVE 547

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 710 RNSNLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--- 765
           RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+   +   
Sbjct: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGK 680

Query: 766 --EYQ-KTLDNFNDHLSNS 781
             EYQ K  DN    +SN+
Sbjct: 681 YREYQMKPNDNKESAISNT 699

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769
           G  N GNTCY NS+LQ  ++++ LR  IL++ K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSGH 783
           G++N+GNTCY+NS LQ    I   + Y L   Y+K + N  + L + GH
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEV-NIENPLGHKGH 394

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRKHR---GFWWRISDETV 743

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETV 707

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y+L SV +H G  +YGHY  +   R + G+W + +DET+
Sbjct: 678  YALRSVIVHYGSHNYGHYIAF---RKFRGLWWRISDETV 713

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L SV +H G  +YGHY  +   R Y G W + +DET+
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETV 693

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 764
           G +D ++L    +  G+ N GNTC++NS++Q   S A L +++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 32/131 (24%)

Query: 1174 MSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGV---WR 1230
            +S + D + L+  +  +  D   Y Y+L  V +H G+ S GHY+  IK     GV   W 
Sbjct: 424  LSPFVDKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIK----PGVEDQWY 479

Query: 1231 KYNDETISXXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQE 1267
            +++DE +             G    P                       Y LVY++Q QE
Sbjct: 480  RFDDERVWRVTKKQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQE 539

Query: 1268 SDIEPLKRILE 1278
             D+  L+ +LE
Sbjct: 540  EDL--LRPVLE 548

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + ++F G  K S +     D    +VE F  L +N+ +  K++ ++FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMK-SYIKCINVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y+L SV +H G  +YGHY  +   R + G+W + +DET+
Sbjct: 679  YALRSVIVHYGTHNYGHYIAF---RKFRGLWWRISDETV 714

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFND 776
            G  N G TCYLNSLLQ YF     RR + E    +D+ N+
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIPTDMDSPNN 243

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + +LF G  K S +     D   ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 309  LNELFVGKMK-SYIKCINVDYESSRVEDFWDLQLNVKNL-KGLEESFSNYIEIELMNGEN 366

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 1179 DINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGV---WRKYNDE 1235
            D++   +K S Q  + E   Y+L  V +H G+ S GHY+  I+     GV   W +++D+
Sbjct: 421  DVSPYIEKGSEQLSNKEACIYNLHGVLVHAGDISTGHYYTMIRP----GVSDEWYRFDDD 476

Query: 1236 TI 1237
             +
Sbjct: 477  KV 478

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYL---- 1032
            +  LF G  K S +     D    +VE F  + +N+ +  KD+ ++F++Y + E +    
Sbjct: 308  LNDLFVGKMK-SYIRCVNVDYESFRVEDFWDIQLNVKN-LKDVKESFENYVEVEMMDGEN 365

Query: 1033 --TMEEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                ++YG  D K+ V   +FP +L +Q++R  YD
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPPVLHLQLKRFEYD 400

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 20/90 (22%)

Query: 710 RNSNLITNFLLTGTI----------DPNSLPPENWPT----------GINNIGNTCYLNS 749
           RNS+  + FL+ G++          DP  +   N+            G  N G TCYLNS
Sbjct: 156 RNSSRNSGFLVNGSLNVSVFIRILKDPTGVLWHNFMNYDSKKLTGYIGFKNQGATCYLNS 215

Query: 750 LLQYYFSIAPLRRYILEYQKTLDNFNDHLS 779
           LLQ YF     R+ + +     ++ ND +S
Sbjct: 216 LLQSYFFTKLFRKMVYKIPSDNESPNDSVS 245

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y+L  V +H G+ S GHY+  IK  N    W +++D+ +
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKP-NVTDQWFRFDDDKV 476

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++  LR  +LEY
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  F++   R  IL++
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 733 NWPTGI---NNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSG 782
           N P+GI   +N+GNTCY+NS LQ    I  L  Y L   Y++ + N N+ L + G
Sbjct: 333 NAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREI-NINNPLGHKG 386

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++++ LR  IL++
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQF 172

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLD 772
           TG+ N+GNTCY+NS+LQ  F  +  R   L  +Y + L+
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           G++N+GNTCY+NS LQ    I  LR Y L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSGH 783
           G++N+GNTCY+NS LQ    I  +R Y +   ++K + N N+ L   GH
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEI-NVNNPLGFQGH 369

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            I +LF G  K  I  ++  D   ++VE F  + +N+ D  K++ ++F+ Y + E +  E 
Sbjct: 303  INELFVGKMKSCIKCINV-DYESSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYS 1088
                 ++G  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 361  QYAAQDHGLQDAQK-VVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYL 419

Query: 1089 DTENP 1093
            D+  P
Sbjct: 420  DSAAP 424

 Score = 32.7 bits (73), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L  V +H G+ S GHY+  I+   +G  W +++D+ +
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDAHGS-WYRFDDDRV 468

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 43/108 (39%), Gaps = 32/108 (29%)

Query: 1197 YGYSLFSVFIHRGEASYGHYWIYIKDRNYGGV---WRKYNDETISXXXXXXXXXXXXGNT 1253
            Y Y+L  V +H G+ S GHY+  IK     GV   W +++DE +             G  
Sbjct: 447  YIYNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVFQENFGCD 502

Query: 1254 ATP-----------------------YFLVYVKQGQESDIEPLKRILE 1278
              P                       Y LVY++Q QE D+  L+ +LE
Sbjct: 503  RLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL--LRPVLE 548

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + ++F G  K  I  ++  D    +VE F  L +N+ +  +++  +FD+Y + E +  E 
Sbjct: 311  LNEIFVGKMKSYIKCINV-DYESARVEDFWDLQLNVKNF-ENLQGSFDNYIEMELMNGEN 368

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYD 403

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 235

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780
           TG+ N+GNTCY+NS+LQ  F+    R   L   K  D F+   SN
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFLS-PKYEDYFSKRYSN 599

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           N L P +   G+ N+G+TC++NS+LQ    I  LR Y L
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFL 380

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 15/68 (22%)

Query: 694 DQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 753
           DQ L L+   +  +IE++SN   +  +TG               + N+GNTCY+NS+LQ 
Sbjct: 581 DQRLSLQRHYSIPTIEKSSNTYVSLSITG---------------LRNLGNTCYINSMLQC 625

Query: 754 YFSIAPLR 761
            F+    R
Sbjct: 626 LFATTKFR 633

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 703 LTRISIERNSNLITNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFSIA 758
           L  + +E+N N     + +   +   LP  + +  G+NN+GN+CY+NS+LQ  F+ A
Sbjct: 279 LVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFNGA 335

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 1199 YSLFSVFIHRGEASY-GHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L+ +  H+G ++  GHY  YI+ R+  G W  YNDE I
Sbjct: 707  YKLYGIVCHKGNSTQSGHYVAYIRQRD--GQWTLYNDEKI 744

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 703 LTRISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQYYF 755
           LT + +E+N N   +F +T       +   P +    G+ N+GN+CYLNS+LQ  F
Sbjct: 286 LTELQVEQNMNW--DFQMTDESGHELVKLNPSKEVGCGLINMGNSCYLNSVLQCLF 339

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++I   R  IL+Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 697 LILRAALTRISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 753
           L     LT + +E+N N   +F +T +     +   P  N+  G+ N+GN+CYLNS+LQ 
Sbjct: 279 LATEKTLTELQVEQNLNW--DFKMTDSAGHELIKLEPNGNFGCGLINLGNSCYLNSILQA 336

Query: 754 YFS 756
            F+
Sbjct: 337 LFA 339

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 19/92 (20%)

Query: 670 ENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSL 729
           ++ S+E + +  +Q+ Y + + +P    +     +  +IERN N+  +  +TG       
Sbjct: 551 QSNSNEIIQRKRQQQHYGQQLLQP----LPPKDYSIPTIERNPNVYVSLSITG------- 599

Query: 730 PPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761
                   + N+GNTCY+NS++Q  F+    R
Sbjct: 600 --------LRNLGNTCYINSMIQCLFAAKTFR 623

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G+ N GNTCY NS+LQ  +++  LR  +L+Y
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKY 130

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFN-DHLSNS 781
           TG+ N+ NTCY+NS+LQ  FS    R   L  +Y + L + N D++S S
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 31/76 (40%), Gaps = 3/76 (3%)

Query: 1187 ISHQFDDFEEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXX 1245
            +S  FD      Y L S  IH G+   YGHY    K   +G  W  ++DET+        
Sbjct: 547  VSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCKTETFG--WLLFDDETVEAVDEQTV 604

Query: 1246 XXXXXGNTATPYFLVY 1261
                  N+ T Y L Y
Sbjct: 605  LSFTGENSDTAYVLFY 620

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ +F+ +  R  +L +
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 956  FQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDH 1015
            FQ+ SG        D+    +    F G  K SIV     +  +T ++ F+ L ++I D 
Sbjct: 251  FQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKD- 309

Query: 1016 PKDIYDAFDSYFKDEYLTMEEYG--------DVKRTVAVTTFPTILQVQIQR 1059
              ++Y+  DS+ K E L    Y         D  + +++   P++L +Q++R
Sbjct: 310  KSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKLPSVLVLQLKR 361

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++I+  R  +L Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYL---- 1032
            + ++F G  K S +     D    + E F  + +N+ +  K + D+F++Y + E +    
Sbjct: 309  LNEIFVGKMK-SFIKCINVDYESARTEDFWDIQMNVKNL-KGLKDSFENYIEVELMDGEN 366

Query: 1033 --TMEEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                ++YG  D K+ V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYD 401

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFND 776
            G  N G TCYLNSLLQ YF     RR + +   + +N  D
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQENPKD 243

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 709 ERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--E 766
           +++S+  +NFL+      N+L       G+ N+GNTCY+NS LQ    I   R Y L   
Sbjct: 308 QKSSHWPSNFLIY-----NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGT 362

Query: 767 YQKTLDNFN 775
           +QK ++  N
Sbjct: 363 FQKEVNEGN 371

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 29/130 (22%)

Query: 624 ALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQ 683
           A+   ++S  + DL+ +  D+  +F     P+ ++   ALK+  +N            ++
Sbjct: 238 AIKLGSLSSSTCDLYCYACDDETRF-----PDNVNLGSALKIYGIN-----------IQE 281

Query: 684 KWYDESVFEPDQFLILRAALTRISIERNSNLITNFLLTGTIDPNSLPPEN-WPTGINNIG 742
           K  DE              L ++ IE+N N     + +   +   LP  N +  G+ N+G
Sbjct: 282 KIADEKT------------LVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLG 329

Query: 743 NTCYLNSLLQ 752
           N+CYLNS++Q
Sbjct: 330 NSCYLNSVMQ 339

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++I  LR  +++Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++  LR  IL++
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  + +   R  +LEY
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 10/120 (8%)

Query: 980  LFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME---- 1035
            +F G  K S +     D   ++VE F  + +N+    + + +AF++Y + E +  E    
Sbjct: 368  VFVGKMK-SYIKCVNIDYESSRVEDFWDIQLNVKG-LEGLANAFENYIEVELMDGENQYA 425

Query: 1036 --EYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTE 1091
              +YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y D E
Sbjct: 426  AQDYGLQDAKKGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKE 485

 Score = 35.8 bits (81), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLS 779
            G  N G TCYLNSLLQ YF     R  + +     +N ND ++
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTADENPNDSVA 302

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + +LF G  K S +     D   ++VE F  + +N+ D  K++  +F++Y + E +  E 
Sbjct: 315  LSELFVGKMK-SYIKCKNVDYESSRVEEFWDIQLNVKD-LKNLQQSFENYIEVELMDGEN 372

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 ++G  D  + V   +FP +L +Q++R  YD
Sbjct: 373  QYAAPDFGLQDAYKGVVFESFPKVLHLQLKRFEYD 407

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1195 EEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            E + Y L  V +H G+ S GHY+  IK  + G  W +++DE +
Sbjct: 444  ESHIYKLHGVLVHTGDISTGHYYTMIKP-DLGDQWYRFDDERV 485

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + E
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE 239

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLS 779
            G  N G TCYLNSLLQ Y+     RR + +     +N ND ++
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGENPNDSVT 246

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            I +LF G  K  I  ++  D    + E F  + +N+ +  +D+  +F++Y + E +  E 
Sbjct: 309  INELFVGKMKSYIRCINV-DYQSVRTEDFWDIQLNVKNM-RDLQTSFENYIEVELMDGEN 366

Query: 1036 EYG-------DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYS 1088
            +Y        D K+ V   +FP +L +Q++R  YD       K  +   F + I +  Y 
Sbjct: 367  QYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYM 426

Query: 1089 DTE 1091
            D+E
Sbjct: 427  DSE 429

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++++ +R  IL++
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 1168 DIDNELMSLYNDIN-SLEDKISHQFDDFEEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNY 1225
            ++ N  + L+N +   L   ++  FD   E  Y L  V IH G +  +GHY    K+  +
Sbjct: 660  EVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKNDKF 719

Query: 1226 GGVWRKYNDETISXXXXXXXXXXXX--GNTATPYFLVY 1261
            G  W  ++DET+                N AT Y L Y
Sbjct: 720  G--WLLFDDETVESVSESTVLEFTGDPNNQATAYVLFY 755

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTL 771
           G  N GNTCY NS+LQ  +++   R  +LEY   L
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHL 207

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY++S+LQ  F+   LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLD 772
           G+ N GNTCY NS+LQ  +++   R  IL    ++D
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSID 167

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           TG+ N+GNTCY+NS+LQ  F+    R   L
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFL 637

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++  LR  +LE+
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  IL+Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  IL+Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 71/171 (41%), Gaps = 19/171 (11%)

Query: 912  ITVGENITDLASPTRVAKIGSDQLENAL-EMGRQQDVTECIGNVLFQIESGSEPIRYDED 970
            IT   ++T + SP +   +   + EN L +    QD  E +    F +   S+  R D D
Sbjct: 378  ITEHSSLTGIVSPVQFVNML--RRENVLFDSMMHQDAHEFLN---FMLNDFSD--RLDRD 430

Query: 971  NEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHP-KDIYDAFDSYFKD 1029
            N+  + I ++F GT    +  L+  D V ++ E FL L + + ++   DI      Y + 
Sbjct: 431  NQAKNFINEIFQGTLTNKVRCLTC-DNVTSREEAFLDLPIEVKENGDTDIQRVLKYYSQR 489

Query: 1030 EYLTMEE---------YGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFK 1071
            E L               + +R V +   P  L + ++R  Y  ++    K
Sbjct: 490  EMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIK 540

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 70/169 (41%), Gaps = 26/169 (15%)

Query: 944  QQDVTECIGNVLFQIESGSEPIRYDEDNEQYD----LIKQLFYGTTKQSIVPLSATDKVR 999
            QQD  E +   L Q+    +  R    NEQ +    +   +F G  K SIV     +  +
Sbjct: 241  QQDAHEFLQYFLNQLHQDYK--RDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSK 298

Query: 1000 TKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYG--------DVKRTVAVTTFPT 1051
            T ++ F+ L ++I D   D+Y   DS+ K E L    Y         D  +   +   P 
Sbjct: 299  TIIDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLPP 357

Query: 1052 ILQVQIQRVYYDRERFMPFKSIE-------PLPFKEVIYMDRYSDTENP 1093
            +L +Q++R     E F+   +++       PL      Y DR ++ E P
Sbjct: 358  MLVLQLKRF----EHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETP 402

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           GI N+GNTCY+NS+LQ  F     R   L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  +L+Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 22/124 (17%)

Query: 649 LKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLI---------- 698
           LK+Y     H   A+KL  +++N+SD     ++     DE+ FE  +  +          
Sbjct: 226 LKHYESNPTH-SIAVKLGSLSKNSSD-----LYCYSCDDETKFEDQRPFVNALKSYGINL 279

Query: 699 ---LRAALTRISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQ 752
              L +  T + ++   N+  +F +T +   + L   P +    G+ N+GN+CYLNS+LQ
Sbjct: 280 EDKLASEKTLVELQVEQNMNWDFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYLNSVLQ 339

Query: 753 YYFS 756
             F+
Sbjct: 340 CLFN 343

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL----EYQKTLDN 773
            G++N+GNTCY+NS LQ    I  LR Y      E +  LDN
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDN 330

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQK--TLDN 773
           N L P     G+ N+GNTCY+NS LQ    +     Y L   YQK   LDN
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDN 455

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + +LF G  K  I  ++  D   ++VE F  L +N+ +  K + ++F +Y + E +  E 
Sbjct: 313  LNELFVGKMKSYIKCINV-DYESSRVEDFWDLQLNVKNL-KGLEESFKNYIEIELMNGEN 370

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI----YM 1084
                 ++G  D ++ V   +FP IL +Q++R  YD       K  +   F E I    YM
Sbjct: 371  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYM 430

Query: 1085 DRYSDTEN 1092
            D+ +  EN
Sbjct: 431  DKKALREN 438

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773
            G  N G TCYLNSLLQ YF     R+ +  YQ   +N
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV--YQIPTEN 242

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 37/99 (37%), Gaps = 24/99 (24%)

Query: 1195 EEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISXXXXXXXXXXXXGNTA 1254
            E   Y+L  V +H G+ S GHY+  IK  +    W +++DE +             G   
Sbjct: 440  ESCKYTLHGVLVHTGDISTGHYYAMIKP-DLQDQWYRFDDEKVWKVTKKQVFEENFGMNK 498

Query: 1255 TP-----------------------YFLVYVKQGQESDI 1270
             P                       Y LVY+++ +E ++
Sbjct: 499  LPEEEIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L SV +H G  +YGHY  +   R + G W + +DE++
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAF---RRFRGCWWRISDESV 716

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L  +  HRG  + GHY  Y K  +  GVW ++ND  +
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTKTAD--GVWYQFNDSVV 459

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + +LF G  K S +     +   ++VE F  L +N+ +  K + D+F++Y + E +  E 
Sbjct: 307  LSELFVGKMK-SYIKCVNVEYESSRVEDFWDLQLNVKNL-KCLKDSFENYIEIELMNGEN 364

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 ++G  D ++ V   +FP IL +Q++R  YD
Sbjct: 365  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYD 399

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 764
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 976  LIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME 1035
            LI  +F G  K SIV     D  +T  + ++ L ++I D    +Y   DS+ K E  T+ 
Sbjct: 251  LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKD-KATLYQCLDSFHKKE--TLH 307

Query: 1036 EYG----------DVKRTVAVTTFPTILQVQIQR 1059
            +Y           D  + + +   P +L +Q++R
Sbjct: 308  DYNYHCPNCDTMQDPIKQLTIDKLPPVLVLQLKR 341

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 35.8 bits (81), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME- 1035
            + ++F G  K S +     D   ++VE F  + +N+ +  K + ++F++Y + E +  E 
Sbjct: 310  LNEIFVGKMK-SYIRCKNVDYESSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGEN 367

Query: 1036 -----EYG--DVKRTVAVTTFPTILQVQIQRVYYD 1063
                 ++G  D  + V   +FP +L +Q++R  YD
Sbjct: 368  QYAAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYD 402

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFND 776
            G  N G TCYLNSLLQ YF     R+ +       +N ND
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPND 244

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           TG+ N+G+TCY+NS+LQ  F+    R   L
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL 642

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  ++ + LR  ++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  HRG  + GHY  + K    GG W K+ND  ++
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKIS--GGQWFKFNDSVVT 448

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  +L++
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G  N G TCYLNSLLQ YF     R+ + +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ 236

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEE 1036
            + ++F G  + S +     D   ++VE F  + +N+ +  + + ++F +Y + E +  E 
Sbjct: 312  LNEVFVGKMR-SYIKCVNVDYESSRVEDFWDIQLNVKN-LRGLQESFKNYIEVEMMDGEN 369

Query: 1037 ------YG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYS 1088
                  YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 370  QYAAQGYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYL 429

Query: 1089 DTE 1091
            D E
Sbjct: 430  DPE 432

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N G+TCY NS+LQ  +++   R+ IL++
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767
           G  N GNTCY NS+LQ  +++   R  +L++
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 71/169 (42%), Gaps = 23/169 (13%)

Query: 944  QQDVTECIGNVLFQIESGSEPIR-YDEDNE--------QYDLIKQLFYGTTKQSIVPLSA 994
            QQD  E +  +L Q+    +  R  DED E         + ++   F GT + SIV    
Sbjct: 226  QQDAHEFLQFLLNQLHCDYKRERQVDEDKEVRSSSSQLCHCIVHSSFQGTLRSSIVCPEC 285

Query: 995  TDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQ 1054
             D  +T ++ FL L ++I    + +YD  DS+ + E L   +Y   +     T+   I Q
Sbjct: 286  QDDSKTMLDPFLDLSLDIKGQ-RTLYDCLDSFHRREQLHDFDYHCPR---CQTSRDPIKQ 341

Query: 1055 VQIQR----VYYDRERFMPFKSIE------PLPFKEVIYMDRYSDTENP 1093
            + I+R    +    +RF    S +      P+ F   + M RY     P
Sbjct: 342  LTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEP 390

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSG 782
           TG+ N+G TCY+NS+LQ  F+   + R + E       FN  L ++G
Sbjct: 599 TGLRNLGATCYINSMLQCLFATN-MFRDLFEPSNYERFFNPELEDTG 644

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  H+G  + GHY  + K    GG W K+ND  +S
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKIS--GGQWFKFNDSMVS 448

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           TG+ N  NTCY+NS++Q  F   P R   L
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFL 321

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSG 782
           N+  G+ N+GN+CY+N +LQ       L +  L   Y+K + N N  L + G
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHI-NINSKLGSKG 630

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L S+  H+G  + GHY + +K  +  G W K+ND  +S
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKVND--GQWFKFNDSMVS 470

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  H+G  + GHY  + K    GG W K+ND  +S
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCKIS--GGQWFKFNDSMVS 450

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            Y L  +  H+G  + GHY  + K    GG W K+ND  +S
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKIS--GGQWFKFNDSMVS 448

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 29/130 (22%)

Query: 624 ALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQ 683
           A+   ++S  + DL+ +  D+  +F     P+ ++   AL++  +N            ++
Sbjct: 238 AIKLGSLSSSTYDLYCYACDDETRF-----PDNVNLGAALQIYGIN-----------IQE 281

Query: 684 KWYDESVFEPDQFLILRAALTRISIERNSNLITNFL-LTGTIDPNSLPPENWPTGINNIG 742
           K  DE              L ++ +E+N N     +  +G      LP +++  G+ N+G
Sbjct: 282 KIADEKT------------LVQLQVEQNENWQFRMVDSSGKEFKRLLPNKDYGCGLINLG 329

Query: 743 NTCYLNSLLQ 752
           N+CYLNS+LQ
Sbjct: 330 NSCYLNSVLQ 339

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
            G+ N G TCYLNSLLQ Y+     R+ + +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQ 220

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 10/120 (8%)

Query: 980  LFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTME-EYG 1038
            LF G  K S +     D   ++VE F  + +N+    K +  +F++Y + E +  E +Y 
Sbjct: 299  LFVGKMK-SYIKCVNVDYESSRVEDFWDIQLNVKG-LKGLQQSFENYIEVEMMDGENQYA 356

Query: 1039 -------DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTE 1091
                   D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y D E
Sbjct: 357  AQGHGLQDAKKGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPE 416

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYI 764
            G+ N G TCYLNSLLQ Y+     R+ +
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 15/141 (10%)

Query: 977  IKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYL---- 1032
            + ++F G  K S +     +   ++VE F  + +N+      +  AF++Y + E +    
Sbjct: 305  LNEIFVGKMK-SYIKCVNVEYESSRVEDFWDIQLNVKG-LNGLNQAFENYIEVEMMDGEN 362

Query: 1033 --TMEEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYS 1088
                + YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 363  QYAAQRYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYL 422

Query: 1089 DTENPLLLAKKEETEQMKQNL 1109
            D E      +K   E M  NL
Sbjct: 423  DPE-----VRKIRPESMMYNL 438

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            YSL S+ +H G   YGHY  Y   R +   W + +DE++
Sbjct: 428  YSLKSIVVHYGSHDYGHYISY---RRFEDQWWRISDESV 463

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769
           G  N GNTCY NS+LQ  F +   R  IL++ +
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKHPR 155

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILE 766
           G+ N+GN+CYLNS+LQ   +   L R+ LE
Sbjct: 310 GLQNLGNSCYLNSVLQVLLN-GDLSRWSLE 338

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFNDHLSNSG 782
           G+ N+GN+CY+N ++Q   S   L +  L   Y+K + N N  L + G
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI-NLNSKLGSKG 566

>TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3.115
            YOL087C
          Length = 1122

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 1036 EYGDVKRTVAVTTFPTILQVQIQ---RVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTEN 1092
            EY +    V  T F TIL  Q++   ++Y + ERF+PF         +++++D     ++
Sbjct: 878  EYIESAIPVNQTIFKTILPKQVKENYQLYRNLERFLPFW------LSKILFIDDTIKNKD 931

Query: 1093 PLLLAKKEET 1102
            PLL+ KK+ T
Sbjct: 932  PLLVPKKKIT 941

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILE--YQKTLDNFNDHLSNSG 782
            G+ NIGN+CYLN ++Q       L +  L   Y++ + N N  L + G
Sbjct: 559 VGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHI-NLNSKLGSKG 606

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
            G+ N GNTCY+NS++Q  F    LR
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLR 263

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237
            Y L +V IH G  +YGHY  Y   R +   W + +DE++
Sbjct: 422  YDLKAVIIHYGTHNYGHYISY---RKFMNQWWRISDESV 457

>KLTH0G11330g Chr7 complement(956495..958000) [1506 bp, 501 aa] {ON}
           similar to uniprot|P06101 Saccharomyces cerevisiae
           YDR168W CDC37 Essential Hsp90p co-chaperone necessary
           for passage through the START phase of the cell cycle
          Length = 501

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 169 SFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPK 226
           SF D V+    H+K  VK+ Q+ E  ++ V   Q  SLD   E  +V+L  FDS DP+
Sbjct: 335 SFLDSVQAKFEHVKKRVKVMQQ-EEPQEGVETIQLKSLDDSTEL-QVNLPNFDSKDPE 390

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 715 ITNFLLTGTIDPN-SLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773
           + N L +  I+ + +  P+ + TG+ N GN CY NS++Q   SI     YI ++   +D 
Sbjct: 50  VKNILFSKNINGSLASRPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGID- 108

Query: 774 FNDHLSNSG 782
             + +S++G
Sbjct: 109 -ENEISSAG 116

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDN 773
           TG+ N  NTCY+NS++Q  FS    R   L  +Y+  L+N
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLEN 335

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-EYQKTLDNFNDHLSNSG 782
           N+  G+ N+GN+CY+N ++Q       L +  L +  K   N N  L + G
Sbjct: 492 NFTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKG 542

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ-KTLDNFNDHLSNSG 782
           G+ N+GN+CYLN ++Q       L +  L Y  +   N N  L + G
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKG 794

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 1192 DDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238
            DD  +  + L  +  HRG  + GHY  + K     G W K+ND  +S
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTT--GHWFKFNDSMVS 442

>TDEL0B02560 Chr2 complement(463639..464727) [1089 bp, 362 aa] {ON}
            Anc_5.667 YKR076W
          Length = 362

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 1154 DNKDVIRILKSNIID--IDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200
            ++ D+IRI  S + D  +D E    Y D+N    K+  Q DDF E+ Y+
Sbjct: 167  ESADIIRIFNSGVFDEFVDKE----YRDVNLYPSKLQSQIDDFNEWVYN 211

>NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa] {ON}
            Anc_1.88 YGR047C
          Length = 1065

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 14/146 (9%)

Query: 93   NVIEKGLQTSGILRESMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYV 152
            N++   +Q    LR+ + +Y S R     N   S+T++  I T+ +    S P    +Y 
Sbjct: 868  NILSSTVQQKFFLRQ-LKAYDSIRYDTHVNGQASITNKEVINTEKK----SSPY---LYY 919

Query: 153  FQAVILNPS---LSEQQISSF--DDIVRIPIYHLKVTVK-IRQELERLKKHVGVTQFHSL 206
              A +L  S   LS  Q  S+  DDI   P+ +L + +  + + ++RL  +      H L
Sbjct: 920  IYATLLYSSKGFLSSLQYLSWLEDDIGDDPMVNLLMGLSHLHRSMQRLTANRHFQVLHGL 979

Query: 207  DHLHEYDRVDLSTFDSSDPKLMDYGI 232
             +L  Y  +  S +   + +  DY I
Sbjct: 980  RYLFHYHEIRSSRYSELERQEADYNI 1005

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 723 TIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           T+  N +   ++  G+ N+GN+CY+N ++Q  F+   L +  L
Sbjct: 512 TLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFL 554

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327

>TPHA0K00240 Chr11 (39455..39889,39976..40065) [525 bp, 174 aa] {ON}
           Anc_5.581 YML036W
          Length = 174

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 467 EALSSLDP-DNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEF 525
           E L +L P  NIG   +A      ++G+  L+     +  +GQE+ E+A    K    EF
Sbjct: 75  ECLLALSPTSNIG---EAFNRFGIQQGSTDLVVLQIVE--VGQESTESANDIVKGTEVEF 129

Query: 526 N----IAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRL 563
           N    +   NE TL  IYK + S + K T        NA++L
Sbjct: 130 NNDNLLHTYNEQTLRKIYKLDNSFQPKTTEGFSQALVNAIQL 171

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRRYIL-EYQKTLDNFNDHLSNSG 782
           ++  G+ N+GN+CY+N ++Q       L +  L +  K   NFN  L + G
Sbjct: 520 DFSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKG 570

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 702 ALTRISIERNSNLITNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFS 756
           +L  + +E+N N     + +   +   LPP +    G  N+GN+CYLNS+LQ  F+
Sbjct: 298 SLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 353

>NCAS0E03150 Chr5 complement(624142..625035) [894 bp, 297 aa] {ON}
            Anc_7.232 YER055C
          Length = 297

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1119 LLDRDESGLTRKDAFLESIK-LLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLY 1177
            ++D  ESG T + A L  I  +LE++  V E+ N   +KD+I  +KS I  +      + 
Sbjct: 168  IVDLVESGETMRAAGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVC 227

Query: 1178 NDINSLEDKISH 1189
             + N+ EDK+S 
Sbjct: 228  CNYNAPEDKLSQ 239

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 18/20 (90%)

Query: 737 GINNIGNTCYLNSLLQYYFS 756
           G+ N+GN+CYLNS+LQ +++
Sbjct: 327 GLINLGNSCYLNSILQCFYN 346

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 21/124 (16%)

Query: 649 LKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVF-EPDQFLILRA------ 701
           LK+Y   + ++  A+KL  +   ++D     I+     DE  F +P++F  + A      
Sbjct: 220 LKHYQQSENNHPLAVKLGSLTSESND-----IYCYSCNDEVAFPDPNRFSAVLAKFGIDL 274

Query: 702 --------ALTRISIERNSNLITNFLLTGT-IDPNSLPPENWPTGINNIGNTCYLNSLLQ 752
                    L  + +E+N N       +G          + +  G+ N+GN+CYLNS++Q
Sbjct: 275 EGQVAKEKTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQ 334

Query: 753 YYFS 756
             F+
Sbjct: 335 VLFN 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,671,140
Number of extensions: 6656600
Number of successful extensions: 26192
Number of sequences better than 10.0: 318
Number of HSP's gapped: 26943
Number of HSP's successfully gapped: 389
Length of query: 1278
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1157
Effective length of database: 39,606,813
Effective search space: 45825082641
Effective search space used: 45825082641
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)