Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2855.440ON48748719200.0
Suva_8.1755.440ON45348715380.0
Smik_15.3005.440ON46338014890.0
YOR123C (LEO1)5.440ON46437314750.0
TDEL0D026105.440ON4403709731e-127
CAGL0K10230g5.440ON4463749421e-122
NCAS0H020805.440ON4353939231e-120
SAKL0G02662g5.440ON4793719131e-118
NDAI0C015905.440ON4703758911e-114
ZYRO0F10164g5.440ON4233798841e-114
KAFR0D050505.440ON4193588781e-113
KNAG0B042105.440ON4632738821e-113
Kpol_1062.265.440ON4573778811e-113
KLTH0F15928g5.440ON4233668231e-105
Kwal_55.214085.440ON4363598081e-102
KLLA0E02311g5.440ON4172537809e-99
TPHA0E017305.440ON4692427832e-98
ACL167C5.440ON4393697592e-95
TBLA0A064905.440ON4282527373e-92
Ecym_45115.440ON4612447352e-91
NDAI0C012205.500ON150997714.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.285
         (487 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   744   0.0  
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   597   0.0  
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   578   0.0  
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   572   0.0  
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   379   e-127
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   367   e-122
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   360   e-120
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   356   e-118
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   347   e-114
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   345   e-114
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   342   e-113
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   344   e-113
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   343   e-113
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   321   e-105
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   315   e-102
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   305   9e-99
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   306   2e-98
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   296   2e-95
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   288   3e-92
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   287   2e-91
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    32   4.3  

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/487 (79%), Positives = 389/487 (79%)

Query: 1   MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYXXXXXXXXXXXXXXXXXYDG 60
           MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDY                 YDG
Sbjct: 1   MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYEVSEQDNNDDEVNEQDNYDG 60

Query: 61  EVNEKDVNDEKVNKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENSINSEDSDDEGVDH 120
           EVNEKDVNDEKVNKR                            PENSINSEDSDDEGVDH
Sbjct: 61  EVNEKDVNDEKVNKRDDTKEEEDAELDDLFGDDDDDDDDEGTKPENSINSEDSDDEGVDH 120

Query: 121 RSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKAN 180
           RSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKAN
Sbjct: 121 RSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKAN 180

Query: 181 VNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVR 240
           VNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVR
Sbjct: 181 VNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVR 240

Query: 241 WRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC 300
           WRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC
Sbjct: 241 WRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC 300

Query: 301 YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQ 360
           YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQ
Sbjct: 301 YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQ 360

Query: 361 SQVXXXXXXXXXXXXXXXESPDAAFETGFRKQSSPTSYGISRRNXXXXXXXXXXXXXXXX 420
           SQV               ESPDAAFETGFRKQSSPTSYGISRRN                
Sbjct: 361 SQVLRDRRRRQLKEREKQESPDAAFETGFRKQSSPTSYGISRRNEYEEDDFLVDDDEEEE 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVI 480
                                 QENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVI
Sbjct: 421 AGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVI 480

Query: 481 EDDEDEE 487
           EDDEDEE
Sbjct: 481 EDDEDEE 487

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/487 (64%), Positives = 345/487 (70%), Gaps = 34/487 (6%)

Query: 1   MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDNDYXXXXXXXXXXXXXXXXXYDG 60
           MSSE+P+G++QN +AV DL   PNN   +K DVTQD+ND                     
Sbjct: 1   MSSESPVGQSQNEQAVGDLGAVPNNTIDEKPDVTQDNND--------------------- 39

Query: 61  EVNEKDVNDEKVNKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENSINSEDSDDEGVDH 120
                    EKVN +                               S NS +SD+E  +H
Sbjct: 40  ---------EKVNNQDEEEEEEEAELDDLFGDDDDDEKESGNENIKSDNSGNSDEESANH 90

Query: 121 RSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKAN 180
           R  HRESLGLDDDEAEEQAMYTRKFYGEDAND+SDQDEA HTFKEEN+E+VRHIIP+KAN
Sbjct: 91  RDHHRESLGLDDDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKAN 150

Query: 181 VNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVR 240
           VNETASHNEIFYARIPNFLTID +PFDPPSFEAKVNERA NS SKEDQLDDRLIDENTVR
Sbjct: 151 VNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVR 210

Query: 241 WRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC 300
           WRYSRD DQHVFKESNTQIVQWSDGSYSLKVGEE TDILVNDTSNTFLTVSHDQQEL+QC
Sbjct: 211 WRYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQC 270

Query: 301 YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQ 360
           YEGGEIKKTLMFIPTST+SKIHQKLSKAV+R+NQRQN+GPGTYI+NMDPEVEK+ELEKKQ
Sbjct: 271 YEGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQ 330

Query: 361 SQVXXXXXXXXXXXXXXXESPDAAFETGFRKQSSPTSYGISRRNXXXXXXXXXXXXXXXX 420
           SQ+               ESPD  FET FRKQSSPT+YG +RRN                
Sbjct: 331 SQILRDRRKRQLKEKEKQESPDVGFETAFRKQSSPTAYGATRRN----EYEEDDFLVDDD 386

Query: 421 XXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVI 480
                                 ++NAARLRNLKREGAAMYKEE  DDDSNE+KRRRVAVI
Sbjct: 387 EEEEAEFDDDDDNEEEEEEEADEDNAARLRNLKREGAAMYKEEGGDDDSNESKRRRVAVI 446

Query: 481 EDDEDEE 487
           EDDEDE+
Sbjct: 447 EDDEDED 453

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/380 (76%), Positives = 310/380 (81%), Gaps = 6/380 (1%)

Query: 112 DSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIV 171
           DSD+E V+HRSRHRESLGLDDDEAEEQAMYTRKFYGED ND+SDQDEA HTFKEEN+E+V
Sbjct: 84  DSDEESVNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELV 143

Query: 172 RHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDD 231
           RHIIP+K  VNETASHNEIFYARIPNFLTID VPFDPPSFEAKVNER  NS SKEDQLDD
Sbjct: 144 RHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDD 203

Query: 232 RLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVS 291
           RLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDG+YSLKVGEECTDILVNDTSNTFLTVS
Sbjct: 204 RLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVS 263

Query: 292 HDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEV 351
           HDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIV+MDPEV
Sbjct: 264 HDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEV 323

Query: 352 EKKELEKKQSQVXXXXXXXXXXXXXXXESPDAAFETGFRKQSSPTSYGISRRNX-----X 406
           EK+ELEKKQSQ+               ESPDAAFETGFRKQSSPT+YG SRRN       
Sbjct: 324 EKRELEKKQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQSSPTAYGTSRRNEYEEDDF 383

Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKD 466
                                               + NAARLR+LK+EGAAMY++EE +
Sbjct: 384 LVDDDEEEEAEFDDDDDNEEEEEEEEEEEEEEEDADEANAARLRSLKKEGAAMYRQEE-N 442

Query: 467 DDSNETKRRRVAVIEDDEDE 486
           +D+NETKRRRVAVIEDDE+E
Sbjct: 443 EDNNETKRRRVAVIEDDEEE 462

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 24/39 (61%)

Query: 1  MSSETPMGETQNGEAVDDLDGTPNNGSIDKTDVTQDDND 39
          MSSE      QNG+ V DLD T NN S +K  +TQD ND
Sbjct: 1  MSSEILQDSPQNGQIVGDLDATSNNTSNEKIALTQDFND 39

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/373 (76%), Positives = 311/373 (83%), Gaps = 3/373 (0%)

Query: 116 EGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHII 175
           E ++HRSRHRESLGLDDDEAEEQAMYTRKFYGEDAN++SDQDE  HTFKEEN+E+VRHII
Sbjct: 94  ENINHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHII 153

Query: 176 PNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLID 235
           P+KANVNETASHNEIFYARIPNFLTID +PFDPPSFEAKVNERA NS S+EDQLDDRLID
Sbjct: 154 PSKANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLID 213

Query: 236 ENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQ 295
           ENTVRWRYSRDKDQHVFKESNTQIVQWSDG+YSLKVGEECTDILVNDTSNTFLTVSHDQQ
Sbjct: 214 ENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQ 273

Query: 296 ELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKE 355
           ELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQ+KGPGTYIV+MDPEVEKKE
Sbjct: 274 ELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKE 333

Query: 356 LEKKQSQVXXXXXXXXXXXXXXXESPDAAFETGFRKQSSPTSYGISRRNXXXXXXXXXXX 415
           LE+KQSQ+               ESPDAAFETGFRKQ+SPT+YG SRRN           
Sbjct: 334 LERKQSQILRDRRRRQLKEKEKQESPDAAFETGFRKQNSPTTYGASRRN--EYEEDDFLV 391

Query: 416 XXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDD-DSNETKR 474
                                      +ENA+RLRNLKREGAAMY+EEE+++ D +ETKR
Sbjct: 392 DDDEEEEAAFDDEEDDNEEEEEEEDADEENASRLRNLKREGAAMYREEEEEEKDRSETKR 451

Query: 475 RRVAVIEDDEDEE 487
           RRVAVIEDDEDE+
Sbjct: 452 RRVAVIEDDEDED 464

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  379 bits (973), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/370 (53%), Positives = 244/370 (65%), Gaps = 10/370 (2%)

Query: 125 RESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNET 184
           R  + +DD+EA+E AMYTRKFYGEDA++ SDQ+E+A+ F EEN+E+VRHI+P K      
Sbjct: 73  RGEMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGA 132

Query: 185 ASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYS 244
              + I+YA++P FLTID VPFDPPSFE+KV ER +NS+S+EDQL DRLIDENT+RWRYS
Sbjct: 133 DEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKER-LNSSSREDQLGDRLIDENTIRWRYS 191

Query: 245 RDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 304
           RD++Q V+KESN QIVQWSDG  SLK+G E TDILVNDT NTF  VSHD+QEL+QC +GG
Sbjct: 192 RDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGG 251

Query: 305 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVX 364
           E+ K+LMFIPTSTNSK+HQKL+KAVIRR+QRQ KGPG Y VN DPE+EK ELEKKQ QV 
Sbjct: 252 EVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVV 311

Query: 365 XXXXXXXXXXXXXXESPDAAFET-GFRKQSSPTS------YGISRRNXXXXXX-XXXXXX 416
                          SPD +    G+RK     S      YG S+RN             
Sbjct: 312 RERRKRQLKEIESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDE 371

Query: 417 XXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNETKRRR 476
                                        A RLR LKR+G   Y E E + D + TKRR+
Sbjct: 372 EEEAGYSEEDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPESDPS-TKRRK 430

Query: 477 VAVIEDDEDE 486
           VA+I+D++DE
Sbjct: 431 VAIIDDEDDE 440

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/374 (54%), Positives = 251/374 (67%), Gaps = 17/374 (4%)

Query: 117 GVDHRSRHRESLGLDDDE--AEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHI 174
           G+  RSR RE   ++D +  A+EQ MYTRKFYGEDA +YSD DE  HTFKE N++++RHI
Sbjct: 86  GITRRSREREDYDMEDYDDEAKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHI 144

Query: 175 IPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLI 234
           IP K        H+EIFYA++P FLTID VPFDP +FEA V+ER   S SKEDQL DRLI
Sbjct: 145 IPYKTRTTNN-EHDEIFYAKVPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLI 203

Query: 235 DENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQ 294
           DENT+RWRYSRD +QHVFKESN QIVQWSDGS+SLK+G+E TDI+VNDT NTFLTVSHDQ
Sbjct: 204 DENTIRWRYSRDAEQHVFKESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQ 263

Query: 295 QELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKK 354
           QEL+QCY+GGEI KT+MFIPTSTNSKIHQKLSKAV RRN RQN GPG+YI+  DPE+EKK
Sbjct: 264 QELMQCYDGGEITKTMMFIPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKK 323

Query: 355 ELEKKQSQVXXXXXXXXXXXXXXXESPDAAF-ETG-FRKQSSPTSYGISRRNXXXXXXXX 412
           ELEK Q Q+               E+ +  F ETG F++ ++P+    SR+N        
Sbjct: 324 ELEKLQGQIIRERRKRQQKEIETRENAENGFAETGEFKRGNTPSRS--SRQN-------E 374

Query: 413 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNET 472
                                           +A RLRN KR+G   + E++ ++D N  
Sbjct: 375 YEDDGFLVDDEDEEDFIDDGEEEEEEEEDDDLDADRLRNAKRQGEHAFTEDDDEEDDN-- 432

Query: 473 KRRRVAVIEDDEDE 486
           KRR+ A+I  +ED+
Sbjct: 433 KRRKTAIISSEEDD 446

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  360 bits (923), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 254/393 (64%), Gaps = 24/393 (6%)

Query: 105 ENSINSEDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGED-ANDYS-DQDEAAHT 162
           EN    E S+D+ +  R R         D  EE+AMYTRKFYG+D  N YS DQD A H 
Sbjct: 57  ENKSVDEQSEDDDIGSRPRRT-------DIDEEEAMYTRKFYGDDDYNRYSSDQDNALHH 109

Query: 163 FKEENIEIVRHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINS 222
           FKEEN+E++RH++P K + +E      ++YA++P FLTI+ VPFDP +FE+ V +R  N 
Sbjct: 110 FKEENVELIRHMVPYKTS-SEKTDETTVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNY 168

Query: 223 TSKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVND 282
           +SKEDQL DRLIDENTVRWRYSRD +Q VFKESN QIVQWSDGS+SLK+G+E TDILVN+
Sbjct: 169 SSKEDQLGDRLIDENTVRWRYSRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNE 228

Query: 283 TSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGT 342
           T+NTFL VSHDQQEL+QCY GGEI KTLMFIPTSTNSKIHQ+LSKAV RRNQR++ GPGT
Sbjct: 229 TNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGT 288

Query: 343 YIVNMDPEVEKKELEKKQSQVXXXXXXXXXXXXXXXESPDAAFET--GF--RKQSSPTSY 398
            I+N DPEVEK+ELEKKQ Q+               ESPD   +   G+  RK+++P   
Sbjct: 289 MIINRDPEVEKRELEKKQGQIIRDRRRRQLKEKELLESPDTTMDVSGGYETRKRNTPNPS 348

Query: 399 GISRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAA 458
             SRR                                       +E A RLRN KR G  
Sbjct: 349 LGSRRQ---DEYEEDDFLVDDEDEEDFIEDDEEEEEEEEEEDNDEEKAERLRNAKRSG-- 403

Query: 459 MYKEEEK----DDDSNETKRRRVAVIEDDEDEE 487
            Y E+ +    +++S+ +K+RRVAVI DDED+E
Sbjct: 404 -YDEDNQESGTENESSSSKKRRVAVINDDEDDE 435

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  356 bits (913), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 245/371 (66%), Gaps = 6/371 (1%)

Query: 119 DHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNK 178
           +H S+   + G   +E EEQAMY RKFYG+D ++ SD +++   FKE ++EI +HI+P K
Sbjct: 113 NHLSKSEANHGSYLEEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYK 172

Query: 179 ANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENT 238
              N  +   E++YA++P FLTID VPFDPPSF+  V  R    +SKEDQLDDRLIDENT
Sbjct: 173 TTSN--SQDKEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENT 230

Query: 239 VRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 298
           +RWRYSRD  Q VFKESN QI+QWSDG++SL++G+E +D+L+NDT NTFLTVSH+QQEL+
Sbjct: 231 IRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELM 290

Query: 299 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEK 358
           QC EGGEI KT+MFIPTST+SKIHQ+LSKAV+RR QR++ GP TYIV  DPE+E++ELEK
Sbjct: 291 QCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEK 350

Query: 359 KQSQVXXXXXXXXXXXXXXXESPDAAFETGFRKQSSPTSYGISRRNXXXXXXXXXXXXXX 418
           KQ Q+               E+ D+    G RK S+ +S+G+ RRN              
Sbjct: 351 KQDQIVRERRKRQLKEQLEKENRDSVEPLGVRK-SATSSFGVGRRNEYEEDDFLVDDEEE 409

Query: 419 XXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMY--KEEEKDDDSNETKRRR 476
                                     NA RLR LKREGAA Y  K+EE   + +  KRR+
Sbjct: 410 EEEGGISGEEEEEAEEEDDDDEDDL-NAERLRQLKREGAAQYEQKDEESGSEESSHKRRK 468

Query: 477 VAVIEDDEDEE 487
           +AV++D+E++E
Sbjct: 469 IAVLDDEEEDE 479

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  347 bits (891), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 246/375 (65%), Gaps = 14/375 (3%)

Query: 119 DHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNK 178
           D  S  R    +DD    E+AMYTRKFYG D + YSD +E AH FKE N+EI+RH++P K
Sbjct: 104 DDESAQRRPEDMDD----EEAMYTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYK 158

Query: 179 ANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENT 238
            + ++  +   I+YA++P FLTID +PFDP SFE KV +R  + +S+EDQL DRLIDENT
Sbjct: 159 TSSDQ--ADTTIYYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENT 216

Query: 239 VRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELI 298
           +RWRYSRD++Q VFKESN QIVQWSDGS+SLK+G+E TDILVNDT NTFLTVSHDQQEL+
Sbjct: 217 IRWRYSRDQNQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELM 276

Query: 299 QCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEK 358
           QCY GGEI KT+MFIPTSTNSKIHQ+LSKAV RRNQRQN GPGT I+  DPE+EKKELEK
Sbjct: 277 QCYNGGEITKTMMFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEK 336

Query: 359 KQSQVXXXXXXXXXXXXXXXESPDAAFE-----TGFRKQSSPTSYGISRRNXXXXXXXXX 413
           KQ Q+               ESPD  F+     +   +  +P+SY  SR++         
Sbjct: 337 KQGQILRERRKRQLKEREIQESPDTTFDVRGSASSKNRSPAPSSYRGSRQDEYEEDDFLV 396

Query: 414 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKE-EEKDDDSNET 472
                                        ++ A RL+ +K+ GA  Y + EE D +   +
Sbjct: 397 DDDEEEEFVGDEDEEEEEEEEEEEEDEDDRK-AKRLKEIKKGGAQEYADREESDMEEGSS 455

Query: 473 KRRRVAVIEDDEDEE 487
           KRR+VAV+ DDE++E
Sbjct: 456 KRRKVAVLSDDEEDE 470

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  345 bits (884), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 241/379 (63%), Gaps = 19/379 (5%)

Query: 109 NSEDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENI 168
            SED +DEG +   RHR+ +  DD+EAEE AMYTRKFYGED +  SD++EA    +EE++
Sbjct: 63  GSEDENDEG-EVTLRHRQEM--DDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEF-REEDV 118

Query: 169 EIVRHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQ 228
           E+VRHI+P +A   +      ++YA+IP FLTID VPFDPPSFEA V ER  N  SKEDQ
Sbjct: 119 ELVRHIVPYRAT--QGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQ 176

Query: 229 LDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFL 288
           L DRLIDENTVRWRYSRD +Q VFKESN QIVQWSDG++SLK+G+E TDIL NDT NTF 
Sbjct: 177 LGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFF 236

Query: 289 TVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMD 348
            VSHDQQEL+QCYEGGE+ KTLMFIPTST+S++HQKL+KAV+RR+ +Q  GPGTYIV  D
Sbjct: 237 AVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKD 296

Query: 349 PEVEKKELEKKQSQVXXXXXXXXXXXXXXXE-SPDAAFETGFRKQSSPTSYGISRRNXXX 407
           PE+E+ ELEKKQ QV               E S D         ++ P   G  RRN   
Sbjct: 297 PELERGELEKKQQQVVRERRRRQVKEMESREASGDPDRRAAISAEAEPM--GNIRRNEYE 354

Query: 408 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDD 467
                                              +  A RLR LKREGA  Y+E     
Sbjct: 355 QDDFLVDDDDEEEYASGSGEEGEEEEEEDEGNVSDE-GAERLRRLKREGANNYEER---- 409

Query: 468 DSNETKRRRVAVIEDDEDE 486
                KRRRVAVI+D+EDE
Sbjct: 410 -----KRRRVAVIDDEEDE 423

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/358 (51%), Positives = 226/358 (63%), Gaps = 13/358 (3%)

Query: 136 EEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYARI 195
           EE+AMY RKFYGE+ +D SD +E A  FKE ++E+VRH++P K    E      I+Y ++
Sbjct: 67  EEEAMYNRKFYGEEGSDMSDHEEEA-LFKEADVELVRHVVPYKT-FPENEDDKTIYYTKV 124

Query: 196 PNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKES 255
           P FL+ID +PFDPPSFE KV ER  N +S EDQL DRLIDENT+RWRYSRD +Q VFKES
Sbjct: 125 PAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKES 184

Query: 256 NTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 315
           N QIVQWSDGSYSLK+G E TDILVN T NTFLTVSHDQQEL+QC +GG+I KTL+FIPT
Sbjct: 185 NAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPT 244

Query: 316 STNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXXXXXXXXXXXX 375
           STNSKIHQ+LSKA+ RR+QR + GPGT IVN+DPEVEK+ELEKKQ+Q+            
Sbjct: 245 STNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKEQ 304

Query: 376 XXXESPD-AAFETGFRKQSSPTSYGISRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 434
              ESP+  AF    R+  +P S G  R +                              
Sbjct: 305 ERLESPELGAFSHSNRRSQTP-SQGYERTHREDEYEEDDFLVDDDEEDESVELESGADEE 363

Query: 435 XXXXXXXXQ------ENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVIEDDEDE 486
                   Q        A RL+ +KR    + +EE   +D N  KRR+  VI DDEDE
Sbjct: 364 DDEEEEEAQFSDEDEARAERLKEMKRSNKVVIEEE---NDENSPKRRKGPVISDDEDE 418

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  344 bits (882), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/273 (62%), Positives = 200/273 (73%), Gaps = 4/273 (1%)

Query: 130 LDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNE 189
           LD DE EE  MY RKFYGED  D SD ++A H FKE N+E+V+HI+P K   ++    N+
Sbjct: 94  LDMDEEEE--MYNRKFYGEDV-DMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTND 150

Query: 190 IFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQ 249
           I+ A++P FL ID  PFDP SFE KV +R   S SKED+L DRLIDENTVRWRYSRD +Q
Sbjct: 151 IYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQ 210

Query: 250 HVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 309
            VFKESNTQIVQWSDGSYSLK+G E TDIL+NDT NTFLTVSHDQQEL+QC EGG + KT
Sbjct: 211 SVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKT 270

Query: 310 LMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXXXXXX 369
           LMFIPTST+SKIHQKLSKAV RRN  Q+ GPGTYIV++DPE+EKKELE+KQ Q+      
Sbjct: 271 LMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRR 330

Query: 370 XXXXXXXXXESPDAAFETGFRKQSSPTSYGISR 402
                    ESPD     G R  S+ + +G  R
Sbjct: 331 RQLREKELAESPDTTI-GGPRSGSAGSWHGTPR 362

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  343 bits (881), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/377 (50%), Positives = 239/377 (63%), Gaps = 24/377 (6%)

Query: 130 LDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNE 189
           +D+DE EEQAMYTRKFYGED  D SDQ+E  H F+EE++ + RH++P K    E  +   
Sbjct: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144

Query: 190 IFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQ 249
           I+YA++P FLTID +PFDPP+FE  V ER  N  SKE+QL+DRLID+NT+RWRYSRD +Q
Sbjct: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204

Query: 250 HVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 309
            VFKESN  IVQWSDGSYSLK+G+E TDIL+NDT NTFLTVSHDQQEL+QC  GGEI K+
Sbjct: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264

Query: 310 LMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXXXXXX 369
           L+F+P ST SK+HQ+LSKA++RRN  +  GP + IVN+DPE+EKKELEKKQSQV      
Sbjct: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRK 324

Query: 370 XXXXXXXXXESPDAAFETGF---------RKQSSPTSYGISRRNX-----------XXXX 409
                    ES +    TGF         ++ ++P SYG SRR+                
Sbjct: 325 KKQKEIEALESLET---TGFGNNSYSASRKRSTTPMSYGGSRRDEYEEDDFIVDDEEEEP 381

Query: 410 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDS 469
                                            ++ A RLR LKR+G A Y ++EK   S
Sbjct: 382 EYAGEEDDDDLDGFEEEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYNDDEK-SGS 440

Query: 470 NETKRRRVAVIEDDEDE 486
              KRR+VAVIEDDED+
Sbjct: 441 ESPKRRKVAVIEDDEDD 457

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  321 bits (823), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 167/366 (45%), Positives = 229/366 (62%), Gaps = 15/366 (4%)

Query: 132 DDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIF 191
           ++E +EQAMY RKFYG+   D +D  E +  F+E +I+I++HI+P   +   +     I+
Sbjct: 62  EEEDDEQAMYNRKFYGDKGEDSND--EGSQEFREADIDIMKHIVP--YSTEPSQGDKTIY 117

Query: 192 YARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHV 251
           Y ++P FLTID +PFDPP+F++K+ ERA   TS EDQ+DDRLI+ENTVRWRYSRDK+Q V
Sbjct: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177

Query: 252 FKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLM 311
           FKESN  IVQWSDG+YSL++G+E TD+L+NDT +T+L VSHDQQELIQ  +GGE+ K ++
Sbjct: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237

Query: 312 FIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXXXXXXXX 371
           FIPTSTNSK HQ+LSKAV R+ Q+++ GP TYI+ +DPE+E+KELEKKQ Q+        
Sbjct: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQ 297

Query: 372 XXXXXXXESPDAAFETGFRKQSSPTSYGISRRNXXXX---XXXXXXXXXXXXXXXXXXXX 428
                  E  D+   T   + +S   Y  +R +                           
Sbjct: 298 LREQQEREGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVDDEENESDGGVGGDGNED 357

Query: 429 XXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNET--------KRRRVAVI 480
                           NA RLR LKR+GAA Y  +E  D++ E+        KRR+VAV+
Sbjct: 358 EEDLLDDEEEEDDDDLNAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVL 417

Query: 481 EDDEDE 486
           +D++DE
Sbjct: 418 DDEDDE 423

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/359 (45%), Positives = 222/359 (61%), Gaps = 13/359 (3%)

Query: 138 QAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYARIPN 197
           QAMY RKFYG++A D +D+  +   F+E ++++V+H++P     +E      IFYA++P 
Sbjct: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137

Query: 198 FLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 257
           FLTID +PFDPP+F+ K+ +R    +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197

Query: 258 QIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 317
           QIVQWSDG++SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257

Query: 318 NSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXXXXXXXXXXXXXX 377
           NSK HQ+LSKAV R+ QR++ GP TYI+ +DPE+E+KELEKKQ Q+              
Sbjct: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE 317

Query: 378 XESPDAAFETGFRKQSSPTSYGISRRNXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXX 435
            E  D+       K +S   Y  SR +                                 
Sbjct: 318 REGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVDDENNETGEDDEGEDDEDDLLDDN 377

Query: 436 XXXXXXXQENAARLRNLKREGAAMYKEEEKDDDS--------NETKRRRVAVIEDDEDE 486
                    NA RLR LKR GA+ Y+ E  +DD         +  KRR+VAV++D++DE
Sbjct: 378 NEEEEDDDLNAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  305 bits (780), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 192/253 (75%), Gaps = 9/253 (3%)

Query: 112 DSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIV 171
           DSDD      S HR    +DD+E EEQAMY RKF GED    S+++      KE ++EIV
Sbjct: 48  DSDDSSA-GTSHHR---VIDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKY-KEVDVEIV 102

Query: 172 RHIIPNK-ANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLD 230
           +H++P K AN    A    I+YA++P FLTID VPFDPPSF+ KV +R    +SKEDQL 
Sbjct: 103 KHVVPYKTAN---GADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLG 159

Query: 231 DRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTV 290
           DRLI+ENT+RWRYSRDKD+ VFKESN QIV+WSDG++SLKVG+E TDILVN+T NT+LTV
Sbjct: 160 DRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTV 219

Query: 291 SHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPE 350
           SH++QELIQC EGGEI K++MF+PTSTNSK+H+ LSKAV RR++R   GP TYI   DPE
Sbjct: 220 SHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPE 279

Query: 351 VEKKELEKKQSQV 363
           +EK+ELEKK  Q+
Sbjct: 280 LEKRELEKKHDQI 292

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 30/43 (69%), Gaps = 6/43 (13%)

Query: 444 ENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVIEDDEDE 486
           ENA RLR +K+ GA  Y+E+       + K+R++AV++D++DE
Sbjct: 381 ENAKRLREVKQTGAQEYQED------AQAKKRKIAVLDDEDDE 417

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  306 bits (783), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 193/242 (79%), Gaps = 9/242 (3%)

Query: 130 LDDDEAEEQAMYTRKFYG-EDANDYSDQDEAAHTFKEENIEIVRHIIPNKA-------NV 181
           +D+DE EE AMYTRKFYG ED N Y D+DE  H FKE ++E+VRHI+P K        + 
Sbjct: 104 MDEDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162

Query: 182 NETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRW 241
           ++  S N  +YARIP FLTID VPFDPP FE++V ER  N+T+ +D++ DRLIDENT+RW
Sbjct: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222

Query: 242 RYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCY 301
           RYSRD +Q VFKESN QI+QWSDGSYSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC 
Sbjct: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282

Query: 302 EGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQS 361
           +GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q   + P + I+N+DPE+EKKELEKKQS
Sbjct: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342

Query: 362 QV 363
           Q+
Sbjct: 343 QI 344

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  296 bits (759), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 221/369 (59%), Gaps = 14/369 (3%)

Query: 129 GLDDDEAEEQAMYTRKFYGED---ANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETA 185
           GL  ++ EEQ MY RKFYG+D   A+D SD+DEA    KE ++E+V+H++P   N     
Sbjct: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYN-KPLE 130

Query: 186 SHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSR 245
               ++Y ++P FLTID VPFDPPSF+ ++ +R    +SKEDQL D LIDENT+RWRYSR
Sbjct: 131 GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSR 190

Query: 246 DKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGE 305
             DQ VFKESN Q+++WSDG+ SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG 
Sbjct: 191 GSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGT 250

Query: 306 IKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVXX 365
           I  +++FIPTSTNSKIH++L+KA+ RR  R++ GP TYIV  DPE+EK+EL+KK  QV  
Sbjct: 251 ISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLR 310

Query: 366 XXXXXXXXXXXXXESPDAAFETG---FRK---QSSPTSYGISRRNXXXXXXXXXXXXXXX 419
                        ++ +     G   F+K   +++P S  +                   
Sbjct: 311 ERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEDEYDDEDGFIDDDDDLEA 370

Query: 420 XXXXXXXXXXXXXXXXXXXXXXXQENAARLRNLKREGAAMYKEEEKDDDSNE---TKRRR 476
                                    NAARL+ LKREGAA Y        ++E    KRR+
Sbjct: 371 LSDNDDAADSLPGSPTASQDEEDDLNAARLQQLKREGAAKYAAAPPAPRADEEVALKRRK 430

Query: 477 VAVIEDDED 485
           VAV++ D++
Sbjct: 431 VAVLDSDDE 439

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  288 bits (737), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 141/252 (55%), Positives = 185/252 (73%), Gaps = 5/252 (1%)

Query: 116 EGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHII 175
           EG   ++R  E     DDE +++AMY +KFYGED  + SD D+  + +KE +IE+VRHI+
Sbjct: 35  EGFVRKNRRSEYDENSDDE-QDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIV 93

Query: 176 PNKANVN--ETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRL 233
           P K   +  E   H E++YA++P FL +D VPFD  +FE+ V ER  NS +++ Q+ DRL
Sbjct: 94  PYKTRPSNKELDKHRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRL 153

Query: 234 IDENTVRWRYSRDKDQH--VFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVS 291
            DENT+RWRYSRD + +  VFK+SN QI+QWSDGSYSLK+G + TDIL N+T N FLTVS
Sbjct: 154 RDENTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVS 213

Query: 292 HDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEV 351
           HDQQEL+QCY GGEI KTLMFIP+ST SKIHQ+L+ AV  R+++   GPG  ++N DPE+
Sbjct: 214 HDQQELMQCYNGGEITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEI 273

Query: 352 EKKELEKKQSQV 363
           EKK LEKKQ Q+
Sbjct: 274 EKKLLEKKQWQM 285

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 13/49 (26%)

Query: 448 RLRNLKREGAAMYKEEEKDDDSNE----------TKRRRVAVIEDDEDE 486
           RLRN KR+G   Y+E++ + D+            TKRR++AVI+D++DE
Sbjct: 383 RLRNAKRQG---YQEDDDERDARNEEEQSSSSEVTKRRKIAVIDDEDDE 428

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  287 bits (735), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 177/244 (72%), Gaps = 4/244 (1%)

Query: 108 INSEDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDA--NDYSDQDEAAHTFKE 165
           I   ++DDE     S     LGL D+E +EQ MY RKFYG+D     Y    E     KE
Sbjct: 58  IERGETDDENSGGTSVKPTGLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKE 116

Query: 166 ENIEIVRHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSK 225
            N++I++H++P     N +   + ++YA++P FLTID +PFDPP F++++ +R    +SK
Sbjct: 117 ANVQIMKHVVP-YYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSK 175

Query: 226 EDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSN 285
           EDQL DRLIDENT+RWRYSR  +Q VFKESN QI+QWSDG++SLK+G+E +DIL+ND  N
Sbjct: 176 EDQLGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIEN 235

Query: 286 TFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIV 345
           T++TVSH+Q+EL+QC EGGEIKK+++FIPTSTNSK HQ+LS A+ RR  R++ GP TYIV
Sbjct: 236 TYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIV 295

Query: 346 NMDP 349
            MDP
Sbjct: 296 RMDP 299

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 15/56 (26%)

Query: 445 NAARLRNLKREGAAMY---------------KEEEKDDDSNETKRRRVAVIEDDED 485
           NA RL+ LK EGAA Y               K++ +++D +  KRR+VAV++ D++
Sbjct: 406 NAERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5.500
          Length = 1509

 Score = 32.0 bits (71), Expect = 4.3,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 38/97 (39%), Gaps = 6/97 (6%)

Query: 104 PENSINSEDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDAN--DYSDQDEAAH 161
           P+ + NS   DD+    +S   E  G D D  +      R    +  N   YS+QD A  
Sbjct: 5   PDIAENSASIDDDASSSQSNLHEYHGFDYDAEQRVRDLARSLTHQSGNISTYSNQDAATE 64

Query: 162 TFKEENIEIVRHIIPNKANVNETASHNEIFYARIPNF 198
           +    ++E +  I  NK    E   +NE       NF
Sbjct: 65  SIFTPDMEGINPIFTNK----EAEEYNEKLDPTSENF 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,847,689
Number of extensions: 2083143
Number of successful extensions: 11795
Number of sequences better than 10.0: 103
Number of HSP's gapped: 12016
Number of HSP's successfully gapped: 125
Length of query: 487
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 373
Effective length of database: 40,409,475
Effective search space: 15072734175
Effective search space used: 15072734175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 68 (30.8 bits)