Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2835.434ON31231216650.0
Suva_8.1735.434ON31231215170.0
YOR120W (GCY1)5.434ON31231215110.0
Smik_15.2985.434ON31231214960.0
KNAG0C049105.434ON31331211791e-163
CAGL0I01100g5.434ON31030911751e-163
NDAI0C016005.434ON31331211741e-162
NCAS0H020605.434ON32230611421e-157
Skud_4.6375.434ON31231211251e-155
Suva_2.5405.434ON31231211241e-155
Smik_4.6345.434ON31231211221e-154
SAKL0G02530g5.434ON31231211211e-154
YDR368W (YPR1)5.434ON31231211211e-154
CAGL0A02816g5.434ON31030910891e-149
NDAI0B056705.434ON31831910591e-145
NCAS0F033805.434ON31331310561e-144
KAFR0E038405.434ON31031210561e-144
ZYRO0F10032g5.434ON31030910551e-144
TBLA0A02825singletonON31131210481e-143
Kpol_1062.295.434ON31130910481e-143
TBLA0A065105.434ON31231210441e-143
TDEL0E019105.434ON31131210421e-142
Kwal_47.18084na 1ON30930810371e-142
KLLA0B14707gsingletonON31030910291e-140
KAFR0E03850singletonON31131310281e-140
KLTH0E00220gsingletonON30630510271e-140
KLTH0A00528gsingletonON30630510271e-140
TPHA0E017605.434ON31030910091e-137
KLTH0A03476gna 1ON3083029921e-135
KLTH0E15532gsingletonON3093039761e-132
KLTH0F16060g5.434ON3093099481e-128
TDEL0D00230singletonON3123059461e-128
TPHA0G00210singletonON3113129431e-127
TBLA0A02835singletonON3113129221e-124
KLLA0D10109gsingletonON3093029201e-124
Kwal_55.214265.434ON3083099111e-122
AER401W5.434ON3133108401e-112
NDAI0A070003.108ON3202905853e-73
NCAS0I024203.108ON3202875723e-71
SAKL0C10626gsingletonON3222975463e-67
Kwal_56.226113.108ON3213025253e-64
KLTH0C10010g3.108ON3213115221e-63
Smik_2.289singletonON3443115203e-63
YBR149W (ARA1)3.108ON3443125152e-62
Smik_2.2883.108ON3442915143e-62
Suva_4.3983.108ON3443125143e-62
Skud_2.2763.108ON3443115143e-62
SAKL0C09922g3.108ON3222915071e-61
KNAG0K020703.108ON3232944975e-60
KAFR0G013503.108ON3242924967e-60
KLLA0F02728g3.108ON3303024924e-59
Ecym_55085.409ON3263274672e-55
TDEL0D051603.108ON3252844662e-55
ZYRO0B06138g3.108ON3283134602e-54
ACL107C5.409ON3543124596e-54
NCAS0A066605.409ON3263084393e-51
CAGL0I01122g5.409ON3263084253e-49
Ecym_7160na 2ON2712944203e-49
TBLA0F01720singletonON3263044211e-48
KLTH0F16610g5.409ON3293094202e-48
ZYRO0A06336g5.409ON3273064192e-48
KLLA0E21627g5.409ON3293074183e-48
KNAG0B03780singletonON3263094183e-48
KLLA0F03256g7.468ON2852804145e-48
TDEL0E021505.409ON3293114141e-47
KAFR0C05320singletonON3273064132e-47
SAKL0G01914g5.409ON3293084072e-46
KNAG0D013707.468ON2822774032e-46
Kwal_33.13276na 3ON3022734052e-46
KLTH0G02420gna 4ON2893144032e-46
SAKL0F14278g7.468ON2862803981e-45
Kwal_47.182197.468ON2932863981e-45
TPHA0E018605.409ON3263084001e-45
TDEL0C033207.468ON2832903962e-45
TBLA0A00630singletonON3283103992e-45
NDAI0D016005.409ON3273093958e-45
Kwal_47.18893na 4ON2892933921e-44
Kpol_1013.827.468ON2852773902e-44
YHR104W (GRE3)5.409ON3273053922e-44
Smik_8.1825.409ON3273053897e-44
CAGL0C04543g7.468ON2872813859e-44
KAFR0G009207.468ON2862873851e-43
KLTH0F01892gna 3ON3022753832e-43
Suva_15.3005.409ON3273053843e-43
Kwal_55.215365.409ON3293103811e-42
SAKL0F02574gna 4ON2893113781e-42
KLTH0G05786g7.468ON2862863771e-42
YJR096W7.468ON2822873771e-42
ZYRO0G17600g7.468ON2832913762e-42
Skud_10.3187.468ON2822893762e-42
Skud_8.1655.409ON3273053792e-42
NCAS0H005607.468ON2842913743e-42
Smik_10.3847.468ON2822873726e-42
KLLA0F05775g7.285ON3093023731e-41
ABL209Cna 2ON3102863703e-41
Suva_12.1847.468ON2822873658e-41
NCAS0A137407.285ON3093003521e-38
Smik_4.1137.285ON3123193408e-37
Skud_4.1317.285ON3123153363e-36
CAGL0J09394g7.285ON3113033353e-36
Kpol_1020.137.285ON3133293345e-36
YDL124W7.285ON3123223312e-35
Kwal_47.19278na 5ON3143283302e-35
KLTH0G00638gna 5ON3133093242e-34
KAFR0B012007.285ON3153113214e-34
SAKL0F09746g7.285ON3122963144e-33
NDAI0A023007.285ON3133343135e-33
Kpol_381.8singletonON3093233092e-32
SAKL0F00704gna 5ON3153223092e-32
TBLA0F019807.285ON3023193073e-32
TDEL0D02790singletonON3293043075e-32
ZYRO0E09614gna 5ON3083133065e-32
KNAG0C041107.285ON3113072952e-30
ZYRO0C09196g7.285ON3123222919e-30
Ecym_32647.285ON3113162883e-29
Kwal_33.13274singletonON108891964e-18
Suva_4.1227.285ON2061801064e-05
TBLA0G01120singletonON3433321068e-05
Suva_12.272singletonON2652051013e-04
Kpol_400.9singletonON3413291005e-04
NCAS0C02450singletonON343292960.002
TBLA0E05040singletonON342323910.006
KLLA0B09658g3.462ON342266900.009
Kpol_449.4singletonON34182900.009
Suva_9.17singletonON308207880.012
AAR033W3.462ON341242880.017
TBLA0B10110singletonON345256860.025
TBLA0G00960singletonON321236860.026
NCAS0C019908.565ON343220850.038
YDL243C (AAD4)singletonON32999820.093
Ecym_22962.604ON340181810.12
Skud_10.383na 6ON376143790.20
ZYRO0D02816gsingletonON34383790.22
KNAG0M023402.604ON309162780.23
Suva_14.10na 7ON37699770.37
YNL331C (AAD14)na 7ON376143760.43
YFL056C (AAD6)singletonON212145750.48
NCAS0A129502.604ON32382750.57
KLTH0D13750g3.462ON33875750.65
Smik_14.1na 7ON376143740.78
KAFR0C04240singletonON34383730.93
Kwal_33.13275singletonOFF6735670.94
KLTH0E01474gsingletonON313183721.4
TBLA0F00680singletonON212211711.5
ZYRO0F04840gsingletonON37983711.8
KLTH0E16852gsingletonON375143712.0
TDEL0C06010singletonON34486712.0
TPHA0C025602.604ON340112712.0
KLLA0F19360gsingletonON34473702.4
Skud_3.183singletonON21796692.5
ZYRO0F00858g2.604ON34699684.3
NDAI0B009305.76ON94073678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.283
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   645   0.0  
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   588   0.0  
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   586   0.0  
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   580   0.0  
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   458   e-163
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   457   e-163
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   456   e-162
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     444   e-157
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   437   e-155
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   437   e-155
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   436   e-154
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   436   e-154
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   436   e-154
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   424   e-149
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   412   e-145
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     411   e-144
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   411   e-144
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   410   e-144
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     408   e-143
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   408   e-143
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   406   e-143
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   405   e-142
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   404   e-142
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   400   e-140
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     400   e-140
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   400   e-140
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   400   e-140
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   393   e-137
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   386   e-135
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   380   e-132
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   369   e-128
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   369   e-128
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 367   e-127
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     359   e-124
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   358   e-124
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   355   e-122
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   328   e-112
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   229   3e-73
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   224   3e-71
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   214   3e-67
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   206   3e-64
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   205   1e-63
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   204   3e-63
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   202   2e-62
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   202   3e-62
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   202   3e-62
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   202   3e-62
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   199   1e-61
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   196   5e-60
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   195   7e-60
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   194   4e-59
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   184   2e-55
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   184   2e-55
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   181   2e-54
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   181   6e-54
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             173   3e-51
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   168   3e-49
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   166   3e-49
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     166   1e-48
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   166   2e-48
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   166   2e-48
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   165   3e-48
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               165   3e-48
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   164   5e-48
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   164   1e-47
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   163   2e-47
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   161   2e-46
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   159   2e-46
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   160   2e-46
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   159   2e-46
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   157   1e-45
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   157   1e-45
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   158   1e-45
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   157   2e-45
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     158   2e-45
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               156   8e-45
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   155   1e-44
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   154   2e-44
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   155   2e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   154   7e-44
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   152   9e-44
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   152   1e-43
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   152   2e-43
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   152   3e-43
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   151   1e-42
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   150   1e-42
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   149   1e-42
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   149   1e-42
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   149   2e-42
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   149   2e-42
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   150   2e-42
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   148   3e-42
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   147   6e-42
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   148   1e-41
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   147   3e-41
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   145   8e-41
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   140   1e-38
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   135   8e-37
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   134   3e-36
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   133   3e-36
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   133   5e-36
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   132   2e-35
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   131   2e-35
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   129   2e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   128   4e-34
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   125   4e-33
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     125   5e-33
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   123   2e-32
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   123   2e-32
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   122   3e-32
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     122   5e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   5e-32
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   118   2e-30
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   116   9e-30
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   115   3e-29
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    80   4e-18
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    45   4e-05
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    45   8e-05
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    44   3e-04
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    43   5e-04
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    42   0.002
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             40   0.006
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    39   0.009
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    39   0.009
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     39   0.012
AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic ho...    39   0.017
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    38   0.025
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      38   0.026
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     37   0.038
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    36   0.093
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    36   0.12 
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    35   0.20 
ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} simila...    35   0.22 
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    35   0.23 
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    34   0.37 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    34   0.43 
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    33   0.48 
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    33   0.57 
KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]...    33   0.65 
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    33   0.78 
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               33   0.93 
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    30   0.94 
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    32   1.4  
TBLA0F00680 Chr6 (175497..176135) [639 bp, 212 aa] {ON}                32   1.5  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    32   1.8  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    32   2.0  
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    32   2.0  
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    32   2.0  
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    32   2.4  
Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [...    31   2.5  
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    31   4.3  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    30   8.0  

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           VHPNWSPFEAFK
Sbjct: 301 VHPNWSPFEAFK 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/312 (89%), Positives = 298/312 (95%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M ATLQ ST+TL LNTGA+IPQVGLGTWQSKDNDAYKSV+AALKDGYRHIDTAAIY NED
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVGQAI+DSGVPRE+IFVTTKLWCTQHHEPAKALDQSL+RLGLDYVDLYLMHWPVRLDP+
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           YIKDG+ILS+PTK+DGSR VDITNWNFIKTWELMQELPKT K +AVGVSNFSINNLKDLL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           AS GN+LTPAANQVE+HPLLPQNELIDFC+ KGIM+E YSPLGSTDAPLLKEPV+LEIAK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           KNNVQP HVVISWHAQRGYVVLPKSVNPDR+K NRK+FTLSDEDFEAIN ISK KGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           V+P+WSPFEAFK
Sbjct: 301 VNPDWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/312 (88%), Positives = 294/312 (94%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATL DST+ LSLNTGAQIPQ+GLGTWQSK+NDAYK+VL ALKDGYRHIDTAAIYRNED
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVGQAI+DSGVPRE+IFVTTKLWCTQHHEP  ALDQSL+RLGLDYVDLYLMHWP RLDP 
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           YIK+ +ILSVPTK+DGSRAVDITNWNFIKTWELMQELPKTGK KAVGVSNFSINNLKDLL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           AS+GNKLTPAANQVEIHPLLPQ+ELI+FC+ KGI++E YSPLGSTDAPLLKEPVILEIAK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           KNNVQP HVVISWH QRGYVVLPKSVNPDR+K NRKIFTLS EDFEAIN ISK KGEKRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           VHPNWSPFE FK
Sbjct: 301 VHPNWSPFEVFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/312 (88%), Positives = 294/312 (94%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M  TL DST+TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALK GY+HIDTAAIYRNED
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVGQAI+DSGVPRE+IFVTTKLW TQHHEPAKALD+SL+RLGLDYVDLYL+HWP RLD +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           YIKDG+ILSVPTK DGSRAVD+TNWNFIKTWELMQELPKTGK KA+GVSNFSINNLKDLL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKLTPAANQVEIHPLLPQNELI+FC+ K IMIE YSPLGSTDAPLLKEP IL+IAK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           KNNVQP HVVISWHAQRGYVVLPKSVNPDR++ NRKIFTLS+EDFEAIN ISK KGEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           V+PNWSPFEAFK
Sbjct: 301 VNPNWSPFEAFK 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  458 bits (1179), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 215/312 (68%), Positives = 257/312 (82%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKD-NDAYKSVLAALKDGYRHIDTAAIYRNE 59
           M ATL  +T  L LNTGA I  +GLGTW+S    DAY SV+AAL+ GYRHIDTAAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
            +VG+AIR+SGVPR +IFVTTKLWCTQH EP  ALDQSL+RLGLDYVDLYLMHWPVR+  
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
           + + +G+ +  PT  +G R +DIT+WNF+KTWELMQ+LP+TGK +A+GVSNFSINNLKDL
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           LAS GNK+ PAANQVE+HPLLPQ EL+DFC GKGI+IE YSPLGS DAP+LKEPVI+EIA
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           KKN V  A VVISW+ QRGY+VLPKSVN +R++AN   FTL+ EDFEA+N ISK +G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVHPNWSPFEAF 311
           ++ P+W PF+ F
Sbjct: 301 IIDPDWEPFKPF 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  457 bits (1175), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 254/309 (82%), Gaps = 1/309 (0%)

Query: 3   ATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQV 62
           A L  +T TL LNTGA IP +GLGTWQS +N+ Y + L ALK GYRHIDTAAIY+NE+++
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122
           G+AIRDS +PR ++FVTTKLW TQH  P +ALDQSL+RLGLDYVDLYLMHWPV L  D I
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
           KDGN+L +P ++DGSR VD+ +WNF+KTWELMQELPK  KA+A+GVSNFSINNLK+LL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
           KGNK+ PAANQ+EIHPLLPQ+ELI+FC+ KGI++E YSPLGSTDAP+LKE  I EIAKKN
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302
            V    +VISWHAQRGYVVLPKSV P+R+  N++ F LSDEDF  ++  +K  GE+RVV 
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 PNWSPFEAF 311
           PNW PF+ F
Sbjct: 301 PNWGPFKPF 309

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  456 bits (1174), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 214/312 (68%), Positives = 259/312 (83%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNE 59
           M +TL++ST T  LNTGA IP VGLGTWQS  +N+ Y++V+ ALK GYRHIDTAAIY+NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
           DQVG+AI DSG+PRE+IFVTTKLW TQH +P  AL+QSL RLGLDYVDLYLMHWPV   P
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
           D IKDGN  ++P   +G R +D+T WNF+KTWELMQELPKTGK +AVGVSNFSINNLK L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L+S GNKL PAANQVE HPLLPQ+EL  FC+ KGI++E YSPLGST+AP+L EP I+EIA
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           KK+NVQPA VVISWH Q+G+VVLPKSV+ +R+KAN + F LS ++ +++N +SK KGE+R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVHPNWSPFEAF 311
           +V PNW+PF  F
Sbjct: 301 IVQPNWAPFVPF 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  444 bits (1142), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 249/306 (81%), Gaps = 1/306 (0%)

Query: 7   DSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQA 65
           +ST T  LNTGA I  VGLGTWQS  +N+ Y++V+AALK GYRHIDTAAIY NE QVG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           I DSGVPRE+IFVTTKLW TQHH+PA  L+ SL+RLGLDYVDLYLMHWPV L+P  IKDG
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGN 185
           N LS+P   DG R V+I  W+++KTWELMQELPKTGK +AVGVSNFSINNLK +L+S GN
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQ 245
           K+ PA NQVEIHPLLPQ EL+++C  KGI++E YSPLGST+AP+L EPV++ +AKK+ VQ
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNW 305
            A +VISWH QRGY+VLPKSV+ +R++AN K   LSDE+   IN ISK KGE+R+V P+W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 SPFEAF 311
            PF  F
Sbjct: 316 EPFVPF 321

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  437 bits (1125), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 253/312 (81%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATL++S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AI+DSG+ RE+IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            + DGN+L +PT +DG+  VD   WNFIKTW+LMQELPKTGK +AVGVSNFSINN+K+LL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PA NQVEIHPLLPQ+ELI FC+ KGI++E YSP GS +APLLKE  I+++AK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K+ V+P+ ++ISW  QRGYVVL KSVNP+RV +N KIFTL ++DF+AI  +SK  GEKRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           V+  W+ F  F+
Sbjct: 301 VNMKWASFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  437 bits (1124), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 252/312 (80%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATL++S+ TL LNTGA IP +G GTW+S DN  Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AI+DSGVPRE+IF+TTKLW T+  +P  ALD+SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            I DG+ L +PT +DG+  VD   WNF+KTW+LMQ+LPKTGK KAVGVSNFSINN+K+LL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PA NQ+EIHPLLPQ+ELI FC+ KGI++E YSP GS +APLLKE  I+++AK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K+ V+PA ++ISW  QRGYVVL KSVNP+RV +N KIFTL ++DF+ I+ +SK  GEKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           V+  W+ F  F+
Sbjct: 301 VNMQWNSFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  436 bits (1122), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 250/312 (80%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATL++S+ +L LNTGA IP +G GTW+S +N+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AI+DSGVPRE IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  +
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            I DGN+L +PT  DG+  VD   WNFIKTW+LMQELPKTGK KAVGVSNFSINN+K LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S  NKL PAANQ+EIHPLLPQNELI FC+ KGI++E YSP GS +APLL+E  I+++AK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K+ V PA ++ISW  QRGYVVL KSVNP+R+ +N KIFTL ++DF+ I+ +SK  GEKRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VHPNWSPFEAFK 312
           V   WS F  FK
Sbjct: 301 VDMKWSSFPIFK 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  436 bits (1121), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 253/312 (81%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M   L++S+ T+ LNTGA IPQ+GLGTW+S D +AY SVL+A+K GYRHID+AAIY NE+
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
            VG+AIRDSGVPR ++FVTTKLW TQ   P KALD SL+RLGLDYVDLYL+HWP+    D
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            IKD + L+VPT +DG   VD+ +WNF+KTWEL+QELP TGKAKAVGVSNFS+NNLK+LL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKL PA NQVE+HPLLPQ+ELI+F + KGI+IE YSPLGS  +PLLKEPVI+E+AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K  V+PA V+I+W  QRGYV+LPKSVNP RV++N K+F LS ED + I+ ISK +G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VHPNWSPFEAFK 312
           VHP+W  F  F+
Sbjct: 301 VHPDWPSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  436 bits (1121), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 251/312 (80%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPATL++S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AI+DSGVPRE+IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            + DGN+L +PT +DG+  +D   WNFIKTWELMQELPKTGK KAVGVSNFSINN+K+LL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S  NK+ PA NQ+EIHPLLPQ+ELI FC+ KGI++E YSP GS +APLLKE  I+++AK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K+ V+PA ++ISW  QRGYVVL KSVNP+R+ +N KIFTL ++DF+ I+ +SK  G KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VHPNWSPFEAFK 312
           V   W  F  F+
Sbjct: 301 VDMKWGSFPIFQ 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  424 bits (1089), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 200/309 (64%), Positives = 244/309 (78%)

Query: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63
           +L++ST TL LNTGA+IP VGLGTW+S  ND Y SVLAALK GYRHID AAIY NEDQVG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
           +AI+DSGVPR++IF+TTKLW T+H  PAKALD SL+RLGLDYVDLYLMHWPV L     +
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
           + ++L++P K DG   +DI +W+FIKTWELMQELPKTGK KA+GVSNFSINNLK L  S 
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNN 243
                PAANQVEIHPL PQ ELI++C+ + I+IE YSP GS DAP+LKEP + ++A+K N
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHP 303
           +  A ++ISW  QRGYVVLPKSV+ +R++AN K+ TL DED E I  +SK KGEKR+V  
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 NWSPFEAFK 312
           +WSPF  F+
Sbjct: 302 DWSPFPTFE 310

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 248/319 (77%), Gaps = 8/319 (2%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNE 59
           MP+  Q S   L L+TGA IPQ+GLGTW+S   NDAY SV+AALK+GYRHIDTAAIY NE
Sbjct: 1   MPSP-QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
            QVG+AIRDSGVPR +IFVT+KLWC Q H+P  AL+Q+L+RLGLDY+DLYLMHWPV  +P
Sbjct: 60  AQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNP 119

Query: 120 DYIKDGN-----ILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSIN 174
             IKD +      +++PT  +G+  V++  WNFIKTWELMQ LP++GK KAVGVSNFSIN
Sbjct: 120 RSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSIN 179

Query: 175 NLKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234
           NL DLLA+   K+ PAANQ+E+HPLL QNEL+ +C+ K I++E YSP GS +AP+LK+  
Sbjct: 180 NLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDET 239

Query: 235 ILEIAKKNNVQPAHVVISWHAQR-GYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISK 293
           I  IAKK ++Q   VV+SWH QR GYVVLPKSV+ +R+ ANRK+ TL DEDF+AIN + K
Sbjct: 240 INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVK 299

Query: 294 AKGEKRVVHPNWSPFEAFK 312
            KGE RVV P+WSPF  FK
Sbjct: 300 EKGELRVVDPDWSPFPLFK 318

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 248/313 (79%), Gaps = 1/313 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNE 59
           M  TL+ ST TL LNTGA IP++ LGTW+S    D Y SV+AALK GYRHIDTAAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
           DQVG+AIRDSG+PRE+IFVT+KLW TQ H PA AL  +L RLGLDY+DLYLMHWPV  + 
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
             +K  + + +P  ++G   +++  WNF+KTWELMQELP TG  KAVGVSNFSINNLK+L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L S GNKLTPAANQ+EIHPLLP+++LI FCR KGIMIE YSPLGS +AP+LKEP I+EI+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           KK +V PA ++ISWH QRGYVVL KS + +R+ ANRK+FTLS EDFEAI  ++K KG  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVHPNWSPFEAFK 312
           VV P+WSPF  FK
Sbjct: 301 VVDPDWSPFPLFK 313

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 246/312 (78%), Gaps = 4/312 (1%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDN-DAYKSVLAALKDGYRHIDTAAIYRNE 59
           M A L++ST+TL LN G+QIP VGLGTWQ+ D  DAY +V AAL  GYRHIDTAAIY+NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
            QVG+AIRDSGVPRE+IFVTTKLW  QHHEP  ALD+SL+RLGLDYVDLYLMHWPV LD 
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
            Y+K+   L +  + DG+R V+ T+W FI TWELMQ+LPK  K +++GVSNFS+NNLKDL
Sbjct: 121 SYMKESP-LELMKRPDGTRPVE-TDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L +    + P  NQVE+HPLLPQ EL+D+C+   I +E YSPLGST APLL EP+++++A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           KKN VQPAHVV+SW  QR  +VLPKSV+ +RV AN K FTL +EDF+AI  IS+ +GE+R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVHPNWSPFEAF 311
           + +PN+ PF+ F
Sbjct: 298 INNPNFEPFKTF 309

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/309 (62%), Positives = 240/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63
           TLQ+ST TL LNTG  IPQVGLGTW+SK+N+ YK+V+ ALK GYRHID AA+Y NE +VG
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
           +AI+DSGVPR +IF+TTKLWCTQ   P +ALDQSL+RLGLDYVDLYL+HWPV L  + IK
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
           DGN+     K DGS+ VD+  WNFIKTWELMQ+L ++GK KA+GVSNFS+NNLKDLLA+ 
Sbjct: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNN 243
             K+TPA NQVE+HPLLPQ +LI F +  GI+IE YSPLG  +AP+L +P + EIAK N 
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 244 VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHP 303
           V+  HVVISW  Q+G V LPKSV P R+  N K+ TLSD D   ++G+ KAKGE+R  + 
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 304 NWSPFEAFK 312
           ++SPF  F+
Sbjct: 302 DFSPFPIFQ 310

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M A L++ T T+ LNTGA IP +GLGTW+S++ND Y SV+AA K GYRHIDTAAIY NED
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVG+AI + GV R ++FVTTKLW TQ  +P  AL+QSL+RLGLDYVDLYL+HWPV    D
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            IKDGN+L++P K+DG   +D   WNFIKTWELMQ L KTGK KA+G+SNFSINN+K+LL
Sbjct: 121 TIKDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A+    +TPA NQVE+HPLLPQ+ELI FC+ KGI+IE YSPLG  +AP+LK+  I+EIAK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           +NNV    VV SWH QRGYVVLPKSV   R+ +N K FTLSD+D   IN + K KGE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VHPNWSPFEAFK 312
                  F  F+
Sbjct: 300 CDLGIKGFPMFQ 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 239/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63
           +L++    + LNTGA++P VGLGTWQS +NDAYK+VL ALK GYRHID AAIY NE +VG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
           +AIRDSGVPR +IFVTTKLW TQ   P  AL+QSL RLGLDYVDLYL+HWP+ L+P   +
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
           + GN L+ P   +G R VD+  WNF+KTWELMQELP TGK KAVGVSNFSINN+K+LL+S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
            GNKL PA NQ+E+HPLLPQ EL++FC+ KGI++E YSPLG T A +LKEP++ E+AKK 
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302
           N+  A++V+SW  QRG VVLPKSV   R+ +N +  TL+ ED E I  +SK KGEKR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 PNWSPFEAF 311
           P++SPF  F
Sbjct: 302 PDFSPFNTF 310

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 240/312 (76%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPA L++S   ++LN G +IP VGLGTW+S++ND Y SV+ ALK GYRHIDTAAIYRNE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AI+DSGVPR++IF+TTKLWCT+   P +AL+ SL+RLGLDYVDLYLMHWPV L+P 
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           YIKD + L VP   DG+R VD+  W++IKTWEL+QELP TG  ++VGVSNFSINNL+ +L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           +S GNKLTPA NQVE+HPLLPQ EL  +C  K I +E YSP GS +AP LK+  I++IA 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           KN V PA V+ SW  QR  VVLPKSV+ +RV +N K+F LS ED   I+ ++K  GEKR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VHPNWSPFEAFK 312
             P+W PF  F+
Sbjct: 301 NKPDWDPFPVFE 312

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  405 bits (1042), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 239/312 (76%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M ATL ++T T+ LNTG  IPQVGLGTW+SK+ D YK+V AALK GYRHID AAIY NE+
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AIRDSG+PRE++F+TTKLW TQ   P +AL+QSL RLGL+YVDLYLMHWPV L   
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            I DGN+LS P K+DG   VD T W+F+KTWELMQELPKT KA++VGVSNFSINNLK+LL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           AS GNKL PA  QVEIHPLLPQ  L DFC+   I +E YSPLG   AP+L +P+I +IA 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           ++N    +VV+SW  QRG V LPKS  P+RV +N + F LSDE+  +IN +SK++G+KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VHPNWSPFEAFK 312
             P+ SPF  F+
Sbjct: 300 NAPDMSPFPLFE 311

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  404 bits (1037), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/308 (62%), Positives = 237/308 (76%), Gaps = 2/308 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           MPA L+++T    LNTGA IP +G GTW+S + + Y +VL+A+KDGYRHID+AA+Y NE 
Sbjct: 1   MPA-LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
            VG+AIRDSGVPRE++FVTTKLW TQ  EPAKALDQSL+RLGLDYVDLYL+HWP+ +  D
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            I DGN+ S+PTK+DG   VD T W++IKTW+LMQELP TGK +AVGVSN S++ L+ LL
Sbjct: 120 RITDGNLFSIPTKEDGKPDVD-TEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLL 178

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A KGNK+ PA  QVE HPLLPQN+L+DFC    I++E YSPLGS  +PL+ EPVI EIAK
Sbjct: 179 ADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAK 238

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K N  PA ++ISW  +RGYVVLPKSV P R+K+N +   L DEDFE IN +   KGEKRV
Sbjct: 239 KYNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRV 298

Query: 301 VHPNWSPF 308
             P W  F
Sbjct: 299 NDPEWFTF 306

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/309 (60%), Positives = 236/309 (76%)

Query: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63
           +  + + +L LNTGA IP VGLGTW+S + DAY +V++AL++GYRHIDTAAIY NE+ VG
Sbjct: 2   STSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVG 61

Query: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
           + IRDSGVPRE+IFVTTKLW TQ  +P  ALD SL+RLGLDYVDLYL+HWPV L+   I 
Sbjct: 62  KGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSIT 121

Query: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
           DGN L+ P   DG   +DI  WNFIKTWE MQ LPK+GK KA+GVSNFSI N++ LLA+ 
Sbjct: 122 DGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAAN 181

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNN 243
            + + PAANQ+EIHP LPQ ELID+C+ KGI+IE YSPLGS+ + +L +P I  IA K N
Sbjct: 182 PDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYN 241

Query: 244 VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHP 303
            +PA+++ISW A RGYVVLPKSVNP R+K N K+  LS ED E IN ++++ G KR V P
Sbjct: 242 AEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAP 301

Query: 304 NWSPFEAFK 312
           ++SPF  F+
Sbjct: 302 DFSPFAIFE 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 196/313 (62%), Positives = 252/313 (80%), Gaps = 3/313 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDN-DAYKSVLAALKDGYRHIDTAAIYRNE 59
           M +TLQ++T TL LNTGA +P +GLGTW++ D+ + Y +V +AL+ GYRHIDTAAIY+NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119
           + VG+AIR+SG+PR++IFVTTKLW TQH +PA ALDQSL RLGLDYVDLYLMHWPV ++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
            Y K  ++L  P + DGS AV+ ++W+FIKTWELMQELPKT K +A+GVSNFSINN+ DL
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVE-SDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L S GNK+ PAANQVE+HPLLPQ EL+ FC+ KGI++E YSP GS  APLL E  I+E+A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           KK++V  A V++SWH +RG  VLPKSV+ +RV +N K F+L ++DF  IN +SK KGEKR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVHPNWSPFEAFK 312
           VV+ +WSPF+ F+
Sbjct: 299 VVNFDWSPFKIFE 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 239/305 (78%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR 67
           +T  L +NTG  IP +GLGTW++ D D Y++VLAAL+ GYRHIDTAAIYRNE  VG+AIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNI 127
           DSGVPREKIFVTTKLWCTQ  +P  AL+ SL RLGLDYVDLYLMH+PV L  D IKDGN+
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKL 187
           LS+P + DG+R VDI  W+F+KTW+LMQ+LPK+GK KA+GVSNFSI N++++L  +    
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 TPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQPA 247
            PAANQ+EIHP LPQ+ELI++C+ KGI++E YSPLGS+++ +L +P ++++A+K+ V+PA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 HVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWSP 307
            ++ISW   RGY +LPKSVN  RV++N KI  LS  D + I+ I +  G KR V P+W+P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FEAFK 312
           F  ++
Sbjct: 302 FPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 239/305 (78%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR 67
           +T  L +NTG  IP +GLGTW++ D D Y++VLAAL+ GYRHIDTAAIYRNE  VG+AIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNI 127
           DSGVPREKIFVTTKLWCTQ  +P  AL+ SL RLGLDYVDLYLMH+PV L  D IKDGN+
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKL 187
           LS+P + DG+R VDI  W+F+KTW+LMQ+LPK+GK KA+GVSNFSI N++++L  +    
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 TPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQPA 247
            PAANQ+EIHP LPQ+ELI++C+ KGI++E YSPLGS+++ +L +P ++++A+K+ V+PA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 HVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWSP 307
            ++ISW   RGY +LPKSVN  RV++N KI  LS  D + I+ I +  G KR V P+W+P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FEAFK 312
           F  ++
Sbjct: 302 FPMYE 306

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 235/309 (76%), Gaps = 2/309 (0%)

Query: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63
           TL +ST  ++LN G Q+P VGLGTWQSK+NDAYK+V+AALK GYRHIDTAAIY NE++VG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRL-DPDYI 122
           +AI+DSGV R +IFVTTKLW TQH  P  AL+QSL RLGLDYVDLYLMHWPV + D    
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
           KD N L +P  +DG+R +D+ +W+FIKTWELMQ LPK+ K K++GVSNFSINN+KDLLAS
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
            GNK  P  NQVE+HPLLPQ EL++FC+ K I++E YSPLGST AP+L+   I E++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302
            + PA+VV SW  QR  VVLPKSV   R+ +N +   L  E+F  +N IS   GEKR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 PNWSPFEAF 311
           PNW+PF  F
Sbjct: 301 PNWTPFIPF 309

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  386 bits (992), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 228/302 (75%), Gaps = 2/302 (0%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR 67
           ST    LNTGA IP VGLGT+ S+D   YK+VL A+K GYRHID AA+Y+NED VG+AIR
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAIR 66

Query: 68  DSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNI 127
           DSGVPRE++FVTTK+W TQH EPAKAL++SL RLGLDYVDL+LMHWP  L  + I DGN+
Sbjct: 67  DSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDGNM 126

Query: 128 LSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKL 187
           ++VP ++D    VD T WN+IKTW LMQ+LP +GK KAVGVSNFS+  L+ LLA  G+K+
Sbjct: 127 ITVPKREDEKPDVD-TEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSKV 185

Query: 188 TPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQPA 247
            PA NQVE+HPLLPQ  L DFC+ K IM+  YSPLGS  APLL +PVILEIA K+   PA
Sbjct: 186 VPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADPA 245

Query: 248 HVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWSP 307
            ++I W  +RGYV LPKSV P R+++N +I  L+D + E IN I K KGEKRVV P W  
Sbjct: 246 QIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEWFD 304

Query: 308 FE 309
           FE
Sbjct: 305 FE 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 228/303 (75%), Gaps = 1/303 (0%)

Query: 7   DSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI 66
           +S+    L TGA IP +G GTW+S + D Y +VL ALK GYRHIDTAA+Y NE  VG+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  RDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGN 126
           RDSGVPR+++FVTTKLW TQH +P  ALDQSL+RLGLDYVDLYL+HWP+ L    I DGN
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 ILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNK 186
           + +VPTK+DG   VD   W+++KTWE+MQ+LP T K +AVGVSNFS+  L++LLA+ G K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQP 246
           + PA NQVE HPLLPQ++L  FC    I++E YSPLGS  +PL++EP + EIA K+N  P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 AHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWS 306
           A V+ISW  +RGYV+LPKSV P R+++N KI  L+D+DF  IN I K KGEKR+  P+W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 PFE 309
            F+
Sbjct: 305 HFD 307

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 1/309 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M   L+  T T  LNTGAQIP +GLGTW+S   + Y + LAA+K GYRHID AA+  NE 
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
            VG+AIRDSGVPRE++FVTTKLWCTQH +P  AL QSL+RLGLDYVDLY+MHWPV    +
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            +K  N + +P ++DG   VD   W+++KTWELMQELP TGK  A+GV+NFS++ LK L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S GNK+ PAA+Q+E HP LPQN+++ FC+   I++E YSPLGS  APLL EPV+ EI+K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K +V+PA +++SW  QRG+ VL KS  P R++AN   F + + D   IN +++ +G KR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VHPNWSPFE 309
            +P W  FE
Sbjct: 300 HNPTWFSFE 308

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  369 bits (946), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 221/305 (72%), Gaps = 1/305 (0%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD 68
           T +  LNTGA +P +GLGTW+S + DAY +VL+ALK GY+HIDTAAIYRNE  VG+AIRD
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNIL 128
           SG+PR+++F+TTKLW TQH +P  ALD SL RLGLDYVDLYL+H+PV    D I+DGN  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 SVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLT 188
             P   +G R VDI +W+F+KTW L+Q LP++GK KAVGVSNFSINNLK LL S      
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKK-NNVQPA 247
           PA NQVEIHP LPQ ELIDFC+ K I++E YSPLGST + +L +  + +IA+K  + QPA
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 HVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWSP 307
            ++I+W   RGY VLPKSV P R++AN +I  +  ED   +  +    G KR + P+WSP
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FEAFK 312
           F  F+
Sbjct: 308 FPIFE 312

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  367 bits (943), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 224/312 (71%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M  T ++   T ++    +IP V LGTW++  N+ Y +VL ALK GYRHID AAIY NE+
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           +VG+AIRDSG+PR+ IFVTTKLW T+   P +ALD SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            I D ++L++P    G   +DI NWNFIKTWELMQELP T KAKA+GVSNFSINNL +LL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A+   K  PAANQ EIHPLLPQNELI +C+ K I++E Y PLG ++ PL+  PVI EIA 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K  V    ++ISW  QRGYVVLPKSV  +R+  N +  T+  E+FE +N ++K  G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VHPNWSPFEAFK 312
           V+ ++SPF  ++
Sbjct: 300 VNIDFSPFPTYQ 311

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 231/312 (74%), Gaps = 1/312 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M  TL++ T T++LN G +IP +GLGT+ SK N+ Y++V+ A K GYRH+DTAA Y+NE+
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           QVG+A++D GVPR +++VTTK+W T+  +P  ALD+SL+RLGL+Y+DLYLMHWPV L  D
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            IKDG ++ +P   DG+  VD  +W F++ WE MQ+L K+GK K++GVSNFSINN+K+LL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A+    + P  NQVE+ PLLP +ELI+FCR K I+ + Y P G ++APL+K+  ++EIAK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
            N V    V+ SWH QRGYVVLPKSV   R+ +N K FTLSD D   +N ISK +GEKR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VHPNWSPFEAFK 312
            + N+SPF  F+
Sbjct: 300 NNVNFSPFPIFE 311

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 175/302 (57%), Positives = 219/302 (72%), Gaps = 2/302 (0%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRDSG 70
           +L LNTGA IPQ+G GTW S   DAY +V+ ALK GYRHID AA+Y NE  VG+ IRDSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  VPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSV 130
           +PRE+IFVTTKLW TQ  +PA ALD+SL RLGLDYVDL+L+HWPV L P    + N+L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 131 PTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLTPA 190
           PT     + +D  +W+FIKTWELMQ LPKTGK +AVGVSNFSI NL+DLL S  + L PA
Sbjct: 129 PTPGIKPQ-IDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 ANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQPAHVV 250
            NQ EIHP LPQ ELI++C+ KGI++E Y PLGS+ + +L +P I EIA K +V+PA+V+
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 ISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHPNWSPFEA 310
           I+W   RGY VLPKS  P R+ +N+    LS ED E I  +S+  G KR VHP++ P+  
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FK 312
           F+
Sbjct: 308 FE 309

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 226/309 (73%), Gaps = 2/309 (0%)

Query: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60
           M   L+  T T +LNTGA+IP +GLGTW+      YK++LAALK GYRHID+AA+  NE 
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
            +G+AIRDSGV R+++FVTTKLW TQH +P+ ALDQSL+RLGL+YVDLY+MHWP+    D
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
            IK  N + +P   +G   VD T+W+++KTWELMQ+LP T K +A+GV+NFS+  L  LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
            S  NK+ PAA+Q+E HP LP +E++ FCR KGI++E YSPLG    PL+ EPVI EI+K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K +V+PA ++ISW  +RG  VLPKS    R+++N ++F LSDED+E I+ I++ +G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VHPNWSPFE 309
            +P W  FE
Sbjct: 299 HNPPWFSFE 307

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  328 bits (840), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 164/310 (52%), Positives = 226/310 (72%), Gaps = 1/310 (0%)

Query: 3   ATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQV 62
           ATL+ ST T++LNTGA+IP  GLGTWQS D+DA  +V AALK GY+HIDTA+ Y+NE+ V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122
           G+A+++SG+PRE++F+TTK+W  Q  +PA ALD SL++LG +YVDL LMHWPV       
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
              +   VP   DG    D   W+F+KTW LMQ+L  TGK KA+GVSNFSINNL++LL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
           +G  + PA NQVE+H  LPQ EL+++C+ KGI++E YSPLGS+ APLLK+  + ++A+K 
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302
            V PAHV++++ A RG VVLPKSV   R+ +N + F + +ED + +N I K +G +R V 
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 303 PNWSPFEAFK 312
           P++SPF  F+
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  229 bits (585), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 184/290 (63%), Gaps = 14/290 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            +LN G +IP +GLGT   KD   +  ++V AA++ GYRHIDTA  Y+ E  +GQA+++ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
              + + RE++F+TTK+W T  + P+ ++DQSL+ LG+DYVDL L HWPV         G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 126 NILSVPTKQDGSRAVDI-TNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDLLA 181
           NI+ +P  +DG+   +   +W F  T++ ++++   PK  + +A+GVSN+ I  L+ L  
Sbjct: 131 NIIGLPRDKDGNALFEKDADWLF--TYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLF- 187

Query: 182 SKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKK 241
            K  K+TPA NQVE+HP LPQ EL  FC    I++  YSPLGS  AP LK   + ++AKK
Sbjct: 188 -KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKK 246

Query: 242 NNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGI 291
             V+PA ++ S+H  +G VVLP+S+NP R+ AN     L+D+D   ++ +
Sbjct: 247 YKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQV 296

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  224 bits (572), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 184/287 (64%), Gaps = 12/287 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI--- 66
            +LN G +IP +GLGT   K    +  K+V AA++ GYR IDTA  Y+ E  +G+A+   
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 67  -RDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
            RD  + RE +F+TTK+W     +P+ ++++SL+ LG+DYVD+ L HWP+     Y ++G
Sbjct: 71  FRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDENG 130

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDLLAS 182
            I+  P  +DG + +     ++I T++LM+++   PK  + +A+GVSN+ I  L+ ++  
Sbjct: 131 TIIGKPLDKDG-KVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVI-- 187

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
           K  K+TP  NQVE+HP LPQ EL DFC   GI++  YSPLGS  AP  K P++ E AKK+
Sbjct: 188 KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
            V PA ++ S+H ++G VV+P+S+NP+RV +N     L+  + ++++
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLD 294

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  214 bits (546), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 186/297 (62%), Gaps = 20/297 (6%)

Query: 12  LSLNTGAQIPQVGLGTW-------QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQ 64
            +LNTGA+IP +GLGT        Q+KD     +V  A+K+GYR IDTA +Y +E  +G+
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKD-----AVKHAVKNGYRLIDTAWMYGSEPYIGE 65

Query: 65  AIRD----SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
           A+++      V RE +F+TTK+W   ++   ++L +SL++L LDYVDL L HWP+     
Sbjct: 66  ALQELFEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQ 125

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPK--TGKAKAVGVSNFSINNLKD 178
           Y + G + S P        V     +++ TW+ ++++ K  +G+ + +GVSN+ +  L+ 
Sbjct: 126 YDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLER 185

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEI 238
           LL  K  ++ P  NQVE+HPLLPQ EL ++C   GI++E +SPLGS+  P L+ P++ E+
Sbjct: 186 LL--KETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKEL 243

Query: 239 AKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAK 295
           +KK + +P  V++++H ++G VV+P+S+N  R+  N     LS+ED + ++G+ + K
Sbjct: 244 SKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  206 bits (525), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 189/302 (62%), Gaps = 18/302 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            +LN G ++P +GLGT    +      ++V AA+K GYRHIDTA  YR ED++G+A+++ 
Sbjct: 11  FTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPV---RL-DPDY 121
                + RE IF+TTK+W T      +++ +SL  LG+DYVDL L HWP+   RL DP+ 
Sbjct: 71  FEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRLQDPEG 130

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQE--LPKTGKAKAVGVSNFSINNLKDL 179
           I DG I   PT +DGS   +    ++++T++ +++  L K  + +++GVSN+ +  L+ L
Sbjct: 131 I-DG-ICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERL 187

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L  K  K+ PA NQVE+HP LPQ EL DFC    I +E +SP G+T +P++K  ++ ++A
Sbjct: 188 L--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVA 245

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           +K +  P  V+I++H ++G V +P+SVNP  + +N +   LS ED + +N     +  KR
Sbjct: 246 QKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG-VENPKR 304

Query: 300 VV 301
           +V
Sbjct: 305 LV 306

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  205 bits (522), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 189/311 (60%), Gaps = 21/311 (6%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            +LN G ++P +GLGT    +      ++V AA+K GYRHIDTA  Y+ ED+VG+A+++ 
Sbjct: 11  FTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPV---RL-DPDY 121
                V RE IFVTTK+W T      +++ +SL  LGLD+VDL L HWP+   RL DPD 
Sbjct: 71  FEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRLEDPDG 130

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL--PKTGKAKAVGVSNFSINNLKDL 179
           I DG +   P  +DGS   +    ++++T++ +++L   K  + +A+GVSN+ +  L+ L
Sbjct: 131 I-DG-VRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERL 187

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L  K  ++ PA NQVE HP LPQ EL DFC    I +E YSPLG+T+APL+   ++ +IA
Sbjct: 188 L--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKIA 245

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
            K      +V+I++H ++G V +P+SVNP  + +N +   LS ED + +N     +  KR
Sbjct: 246 GKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG-VENTKR 304

Query: 300 VVHPNWSPFEA 310
           +V     PF A
Sbjct: 305 IVD---EPFAA 312

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  204 bits (520), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 187/311 (60%), Gaps = 20/311 (6%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            SLN G +IP +GLGT   Q K  +  ++V AA+K GYRHIDTA  YR E  VG+AI++ 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKEL 84

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
                + RE +F+TTK+W     E  ++L++SL+ LGLDYVDL L HWP+  +   +KD 
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK--VKDP 142

Query: 126 NILSVPTK---QDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDL 179
             +S   K    D  + V  +N ++++T++ ++++       + +A+GVSNFSI  L+ L
Sbjct: 143 KGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERL 202

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           +  K  K+ P  NQVE HP LPQ EL  FC    I++  YSPLGS  AP LK P++ ++ 
Sbjct: 203 I--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLC 260

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           +K NV    ++IS+H ++G +V+P+S+NP R+ +N +   L+ ++ + +N      GEK 
Sbjct: 261 EKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEF----GEKY 316

Query: 300 VVHPNWSPFEA 310
            V     PF A
Sbjct: 317 PVRFIDEPFAA 327

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  202 bits (515), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 187/312 (59%), Gaps = 20/312 (6%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR-- 67
            SLN G +IP +GLGT     K  +  ++V AA+K GYRHIDTA  Y  E  VG+AI+  
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  --DSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
             D  + RE +F+TTK+W     E  ++L++SL+ LGL+YVDL L HWP+  +   IKD 
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK--IKDP 142

Query: 126 NILSVPTK---QDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDL 179
             +S   K    D  + +   + ++++T++ ++++   P   + +A+GVSNFSI  L+ L
Sbjct: 143 KGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERL 202

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           +  K  ++ P  NQVE HP LPQ EL  FC    I++  YSPLGS  AP LK P++ ++A
Sbjct: 203 I--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLA 260

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           +K NV    ++IS+H ++G +V+P+S+NP R+ ++ +  +L+ ++ + +N      GEK 
Sbjct: 261 EKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF----GEKY 316

Query: 300 VVHPNWSPFEAF 311
            V     PF A 
Sbjct: 317 PVRFIDEPFAAI 328

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  202 bits (514), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 178/291 (61%), Gaps = 18/291 (6%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            SLN G +IP +GLGT   Q K  +  ++V AA+K GYRHIDTA  Y  E  VG+AI++ 
Sbjct: 25  FSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRL----DPDY 121
                + RE +F+TTK+W     E  ++L++SL+ LGLDYVDL L HWP+      DP+ 
Sbjct: 85  LEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEG 144

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKD 178
           I     L V    D  + V  +N ++++T++ ++++       + +A+GVSNFSI  L+ 
Sbjct: 145 ISGYMKLPV---DDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEI 238
           L+  K  K+ P  NQVE HP LPQ EL  FC    I++  YSPLGS  AP LK P++ ++
Sbjct: 202 LI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
            +K NV    ++IS+H ++G +V+P+S+NP R+ +N +   L+ ++ + +N
Sbjct: 260 CEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN 310

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  202 bits (514), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 187/312 (59%), Gaps = 22/312 (7%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            +LN G ++P +GLGT     K  +  ++V AA+K GYRHIDTA  Y  E  VG+AI++ 
Sbjct: 25  FTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKD- 124
                + RE +F+TTK+W     E  ++L +SL+ +GLDYVDL+L HWP+  +   +KD 
Sbjct: 85  LEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEK--VKDP 142

Query: 125 ---GNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKD 178
                ++  P  + G  A+  +N ++++T++ ++++   P   + +A+GVSNFSI  L+ 
Sbjct: 143 KGISGLVKTPVHKSG-EAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLER 201

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEI 238
           L+  K  ++ P  NQVE HP LPQ EL  FC    I++  YSPLGS  AP LK P++ ++
Sbjct: 202 LV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKL 259

Query: 239 AKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEK 298
            +K NV    V+IS+H ++G +V+P+S+NP R+ ++ +   L+ ++ + +N      GEK
Sbjct: 260 VEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDF----GEK 315

Query: 299 RVVHPNWSPFEA 310
             V     PF A
Sbjct: 316 YPVRFIDEPFAA 327

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  202 bits (514), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 186/311 (59%), Gaps = 20/311 (6%)

Query: 12  LSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR-- 67
            SLN G +IP +GLGT     K  +  ++V AA+K GYRHIDTA  Y  E  VG+AI+  
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  --DSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
             D  + RE +F+TTK+W     E  ++L++SL+ LGLDYVDL+L HWP+  +   +KD 
Sbjct: 85  LEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK--VKDP 142

Query: 126 NILSVPTK---QDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDL 179
             LS   K    D  + +  +N ++++T++ ++++   P   + +A+GVSNFSI  L+ L
Sbjct: 143 KGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERL 202

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           +  K  ++ P  NQVE HP LPQ  +  FC    I++  YSPLGS  AP LK P++ ++ 
Sbjct: 203 I--KECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLT 260

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKR 299
           +K N+    V+IS+H ++G +V+P+S+NP R+ ++ +   L+ ++ + +N      GEK 
Sbjct: 261 EKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF----GEKY 316

Query: 300 VVHPNWSPFEA 310
            V     PF A
Sbjct: 317 PVRFIDEPFAA 327

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  199 bits (507), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 176/291 (60%), Gaps = 18/291 (6%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            +LN G +IP VGLGT   KD      ++V AA+K G+R IDTA  Y  E+ +G+A+++ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPV----RLDPDY 121
                V RE +F+TTK+W     +  K+L++SL+RL LDYVDL L HWP     + DP+ 
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPE- 129

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKD 178
              G +++ P  +DGS   D T  ++++T++ ++ +       + +A+GVSN+ I  L+ 
Sbjct: 130 -GSGQLVNHPQHEDGSPFYD-TAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLER 187

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEI 238
           L   K  K  PA NQVE+HP LPQ EL D+C   GI++  YSPLGS  AP L+ P++ E+
Sbjct: 188 LF--KECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQEL 245

Query: 239 AKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
           A K N     V++S+H ++G +V+P+S+N +R+        L+ E+ + +N
Sbjct: 246 ASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLN 296

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  196 bits (497), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 178/294 (60%), Gaps = 15/294 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
             LN G  +P +GLGT   +++  +  ++V AA+K GYRHIDTA  Y  E  +G A+++ 
Sbjct: 11  FKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP-DYIKD 124
                V R  +F+T+K+W     +   +L++SL+ LGLDYVDLYL HWP+     +  KD
Sbjct: 71  LENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKD 130

Query: 125 G--NILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDL 179
           G   +   P  +DG+ A+ +   +++ T++ M+++   PK  + +A+GVSN+ +  L  L
Sbjct: 131 GVNGLKGKPIDKDGN-ALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRL 189

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
           L  K   + PA NQVE+HP LPQ EL +FC    I +  YSPLGS+ APLLK P++ E++
Sbjct: 190 L--KVCTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELS 247

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISK 293
           +K  V    V+IS+H ++G  V+P+S+NP R+       TL++ + + ++ I +
Sbjct: 248 EKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGR 301

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  195 bits (496), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 107/292 (36%), Positives = 176/292 (60%), Gaps = 15/292 (5%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
             LN G  IP +G GT+  ++   +  ++V AA+K GYRHIDTA +Y +E  VG+AI++ 
Sbjct: 11  FKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEM 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPV---RLDPDYI 122
                V R  +FVTTK+W        K+L++SL  LGLDYVDL L HWP+   R++ +  
Sbjct: 71  IEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKN 130

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDL 179
               +++ P   +G   ++    +F++T+  ++++   P   + +A+GVSN++I  L+ L
Sbjct: 131 GVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEAL 189

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
              K  K+ P  NQVEIHP LPQ EL  FC   GI++  YSPLGS  AP LK P++ ++A
Sbjct: 190 F--KECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLA 247

Query: 240 KKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGI 291
           +K ++    ++IS+H ++G  V+P+S+NP R+ +  +    + E+ + ++ +
Sbjct: 248 EKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNV 299

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  194 bits (492), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 178/302 (58%), Gaps = 15/302 (4%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
            + N G ++P  GLGT    +   +  ++V AA+K GYRHIDTA  Y  E+ VG+A+++ 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 69  ---SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLD--PDYIK 123
                V RE + +T+K+W T  ++  K+L++SL RL +DYVDL+L HWP+     PD   
Sbjct: 71  FEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHG 130

Query: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLKDLL 180
              I   P    G+   D    ++I+T++ ++++       + +A+GVSNF I  LK +L
Sbjct: 131 VDKIAKEPVDDQGNPLYD-EKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVL 189

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
             K  +  PA NQVE+HP LPQ EL +FC    I++  YSPLG   APLL+ P++  + +
Sbjct: 190 --KECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCE 247

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           K N  P  ++ S+H ++G +V+P+S+N  R+ +N +   LS+ED   +N   + K +KR 
Sbjct: 248 KYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQ-KNKKRY 306

Query: 301 VH 302
           ++
Sbjct: 307 IN 308

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  184 bits (467), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 174/327 (53%), Gaps = 29/327 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG----Q 64
           TRT +LN G ++P VGLG W+   + A   V  A+K GYR  D A  Y NE ++G    Q
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIRDSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122
           AI +  V RE +F+ +KLWC  HH      AL ++L  LGLDYVDLY +H+P+ +    +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KDGNILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           ++     + T ++  R   ++      + T+  M++L   G  K++G+SNF    ++DLL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTD------------AP 228
             +G ++ P A QVE+HP L Q  L+ + + K I +  YS  G                P
Sbjct: 184 --RGARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 229 LLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANR---KIFTLSDEDF 285
           LL+  ++L IAKK++V P+ V++ W  QRG  V+PKS   +R+  N    K  TLSD + 
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 286 EAINGISKAKGEKRVVHP-NWSPFEAF 311
             I  ++K     R + P +W+    F
Sbjct: 302 SDIFSLNK---NLRFLDPWDWARLPGF 325

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  184 bits (466), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 169/284 (59%), Gaps = 18/284 (6%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDN--DAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD 68
           +  LN G ++P +GLGT    +   +  ++V AA+K GYR+IDTA  Y +E  VG+AI++
Sbjct: 10  SFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKE 69

Query: 69  ----SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPV----RLDPD 120
                 + RE +F+T+K+W     +  ++L +SL+ LG+DY+DL+L HWP+    R DP 
Sbjct: 70  LIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRREDPH 129

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINNLK 177
            I    +   P K DGS   +    +++ T++ M+ +   PK  + +A+GVSNF +  LK
Sbjct: 130 GI--NGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLK 186

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILE 237
            +L  K   + P  NQVE+HP LPQ EL +FC    I +  YSPLGS  AP++K P+I E
Sbjct: 187 RVL--KECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKE 244

Query: 238 IAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLS 281
           +++K       ++ S+H ++G  V+P+S+N  R+ +N +   LS
Sbjct: 245 MSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 186/313 (59%), Gaps = 27/313 (8%)

Query: 11  TLSLNTGAQIPQVGLGTW--QSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD 68
           + +LN G ++P +GLGT     +     ++V AA+K GYRHIDTA  Y +E  VG+AI++
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 69  ----SGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKD 124
                 + RE IF+T+K+W     +  ++L++SL  LG+DY+DL+L HWP+     Y+K 
Sbjct: 73  LMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPL----CYVKQ 128

Query: 125 GNILSV------PTKQDGSRAVDITNWNFIKTWELMQEL---PKTGKAKAVGVSNFSINN 175
            +   +      P   +G    ++   ++++T+  M+++   P   + +++GVSNF +  
Sbjct: 129 EDTHGINGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQY 187

Query: 176 LKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVI 235
           L+  L     K  PA NQVE+HP LPQ EL  FCR   I++E YSPLGS +AP +   ++
Sbjct: 188 LERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLV 245

Query: 236 LEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN--GISK 293
            ++A+K ++ P+ ++ S+H ++G  V+ +SVN  R+ +N +   L++E+ + ++  GI+K
Sbjct: 246 QDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK 305

Query: 294 AKGEKRVVHPNWS 306
               KR V+  W+
Sbjct: 306 P---KRFVNEKWN 315

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  181 bits (459), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 112/312 (35%), Positives = 174/312 (55%), Gaps = 33/312 (10%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR 67
           + RT+ LN GA +P VGLG W+  +  A + V  A+K GYR +D A  Y NE +VGQ IR
Sbjct: 29  NVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIR 88

Query: 68  ---DSG-VPREKIFVTTKLWCTQHHEP---AKALDQSLRRLGLDYVDLYLMHWP-----V 115
              D G V RE++FV +KLW   +H P    KAL ++L  LGLDY+DL+ +H+P     V
Sbjct: 89  RAIDEGLVRREELFVVSKLW-NNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFV 147

Query: 116 RLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINN 175
            L+  Y   G       +Q G  A +      I+T+  +++L   G+ +A+G+SNF    
Sbjct: 148 PLEERY-PAGLYTGAADEQAGRLAQEPV--PLIETYRALEQLVDEGRIRAIGLSNFQGCL 204

Query: 176 LKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------ 223
           ++DLL  +G ++ PAA Q+E HP L Q  L+ + + +G+ + GYS LG            
Sbjct: 205 VQDLL--RGCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAA 262

Query: 224 STDAPLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTL 280
              APLL+  V+  IA+++   PA V++ W  QR   V+PKS   +R+  N ++    TL
Sbjct: 263 QNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTL 322

Query: 281 SDEDFEAINGIS 292
           +D++   ++ ++
Sbjct: 323 ADDELRELSSLN 334

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  173 bits (439), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 174/308 (56%), Gaps = 27/308 (8%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR-- 67
           + L+LN G ++PQVGLG W+  ++     V  A+K GYR  D A  Y NE +VG+ ++  
Sbjct: 3   KLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRA 62

Query: 68  --DSGVPREKIFVTTKLWCTQHHEPAKALD--QSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
             D  V R+ +FV +KLW   HH     L+  ++L+ LGLDY+DLY +H+P+      ++
Sbjct: 63  MDDGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPME 122

Query: 124 DGNILSVPT-KQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           +     + T K D ++ + +T  N   + T+  ++E  + G  K++G+SNF+   + D+L
Sbjct: 123 ERYPPQMYTGKADEAKGI-LTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL 181

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAP 228
             +G  + P A Q+E HP L Q +L+++C+   + + GYS  G                P
Sbjct: 182 --RGCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPP 239

Query: 229 LLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDF 285
           L   PVI +IA+K+NV  A V++ W  QRG  ++PKS +  R+ +N  I    TL++ED 
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 286 EAINGISK 293
           ++I+G+++
Sbjct: 300 KSISGLNQ 307

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  168 bits (425), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 166/308 (53%), Gaps = 25/308 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR- 67
           +  ++LN G ++P VGLG W+  ++   + V  A+K GYR  D A  Y NE +VGQ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122
             D G V RE +FV +KLW + HH      AL ++L  +GLDY+DL+ +H+P+       
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 KDGNILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           ++       T ++  +   IT  +   I T+  +++  + G  K++G+SNFS + ++DLL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYS------------PLGSTDAP 228
             +  K+ P A QVE HP L Q  L+++C+  GI +  YS            PL      
Sbjct: 182 --RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 229 LLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDF 285
           L     I +IA  +NV  + V++ W  QRG  ++PKS   +R++ N  I    TL+ ++ 
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 286 EAINGISK 293
           EAI+ ++K
Sbjct: 300 EAISKLNK 307

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  166 bits (420), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 151/294 (51%), Gaps = 38/294 (12%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           +T +L  G  +P +GLG +    N   + V  ALK GYRH DTA  Y NE +VG+ I   
Sbjct: 4   KTYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAW 63

Query: 69  -----SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120
                S   R+ +F  TKLW +Q  + E   A+ Q L+++  L Y+DL L+H P      
Sbjct: 64  LAEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA----- 118

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                                  +   + T+E MQE    G  K++GVSN+  ++L++L 
Sbjct: 119 ---------------------CGSAKRLATYEAMQESVDAGIVKSIGVSNYERHHLQELY 157

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A    K  P  NQ+E+ P LP+N+L+D+C+  G+ I+ YSPLG  D   + +P I  +A 
Sbjct: 158 AMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLAT 215

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKA 294
           + N  PA ++I+W   +GY  LPK+ N  R+++N   + +S    E  N I KA
Sbjct: 216 QKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEELTN-IEKA 268

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  166 bits (421), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 161/304 (52%), Gaps = 25/304 (8%)

Query: 13  SLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR----D 68
           +LN G ++P VGLG W+  +    + V  A+K GYR  D A  Y NE +VGQ IR    +
Sbjct: 6   ALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 69  SGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGN 126
             V R  +F+ +KLW T HH      A+ ++L  LGLDY+DLY +H+P+      I++  
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEKY 125

Query: 127 ILSVPT-KQDGSRA-VDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKG 184
                T K+D ++  + +    ++ T+  M+ L + G  K++GVSN     L+D+L   G
Sbjct: 126 PPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM--G 183

Query: 185 NKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGST-----------DAP-LLKE 232
            K+ P   Q+E HP L Q+ L+D+C+ + I++  YS  G             D P L   
Sbjct: 184 CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNLFDH 243

Query: 233 PVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEAIN 289
           PVI  IA K NV  + V++ W  Q G  V+PKS   +R+  N  I    TLS+E+   I+
Sbjct: 244 PVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELVEIS 303

Query: 290 GISK 293
            I++
Sbjct: 304 NINR 307

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  166 bits (420), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 27/309 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR- 67
           + T+ LN G ++P VGLG W+  +      V  A+K GYR  D A  Y NE +VGQ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREKIFVTTKLWCTQHHEP---AKALDQSLRRLGLDYVDLYLMHWPV--RLDP 119
             D G V RE +FV +KLW   +H+P    KAL ++L+ LGL+Y+DL+ +H+P+  +  P
Sbjct: 65  AIDEGIVKREDLFVVSKLW-NSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVP 123

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
              +         + +    + +     + T+  +++    G  KA+GVSNF    L DL
Sbjct: 124 FEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDL 183

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDA 227
           LA  G K+ PA  Q+E HP L Q +L+++C+ +GI +  YS  G             +  
Sbjct: 184 LA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTP 241

Query: 228 PLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDED 284
            L +  V+ ++A  + V  + V++ W  QR   ++PKS   +R+  N +I    TLSDE+
Sbjct: 242 TLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 285 FEAINGISK 293
            + I+ ++K
Sbjct: 302 LQEISSLNK 310

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  166 bits (419), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 169/306 (55%), Gaps = 25/306 (8%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQ----AI 66
            ++LN G ++P VGLG W+  +    + +  A+  GYR  D A  Y NE +VG+    AI
Sbjct: 4   VVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRAI 63

Query: 67  RDSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKD 124
           +D  V RE++FV +KLW + HH      AL ++L  +GLDY+DL+ +H+P+ L P   ++
Sbjct: 64  KDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFEE 123

Query: 125 GNILSVPTKQDGSRAVDITN--WNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
                + T +  ++A  ++      + T+  ++E  + G  K++GVSNFS + + DLL  
Sbjct: 124 KYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL-- 181

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAPLL 230
           +G ++ PAA Q+E+HP L Q   + + + KGI +  YS  G                PL 
Sbjct: 182 RGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPPLF 241

Query: 231 KEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
           +  V+ +IA K+NV  + V++ W  Q+   V+PKS   +R++ N  +    TL+ ++ + 
Sbjct: 242 EHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEIKE 301

Query: 288 INGISK 293
           I+G++K
Sbjct: 302 ISGLNK 307

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 166/307 (54%), Gaps = 25/307 (8%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQ----A 65
            T++LN G ++P VGLG W+  ++     +  A+K GYR  D A  Y NE +VGQ    A
Sbjct: 6   ETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRA 65

Query: 66  IRDSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123
           I++  V RE + V +KLW + HH     +AL+++L  L LDYVD++ +H+P+   P    
Sbjct: 66  IKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFD 125

Query: 124 DGNILSVPT-KQDGSRA-VDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLA 181
           +       T K+D ++  ++      + TW  +++L   GK K++G+SNFS   ++DLL 
Sbjct: 126 EKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL- 184

Query: 182 SKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGST------DAPLLKEPVI 235
            +G ++ P A Q+E HP L Q  LI + +  GI +  YS  G        +   L  P +
Sbjct: 185 -RGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTL 243

Query: 236 LE------IAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFE 286
            E      IA K+ V P  V++ W  Q G  ++PKS   +R+  N +I    TL+D++ +
Sbjct: 244 FEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELK 303

Query: 287 AINGISK 293
            I+G+++
Sbjct: 304 QISGLNQ 310

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 165/309 (53%), Gaps = 27/309 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR- 67
           + T++LN G  +P VGLG W+   +   + V  A+K GYR  D A  Y NE QVG  IR 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSG-VPREKIFVTTKLWCTQHHEPAK---ALDQSLRRLGLDYVDLYLMHWPVRLDPDY 121
             D G V RE +FV +KLW T +H+P     AL ++L  + L+Y+DLY +H+P+      
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 IKDGNILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
            ++       T  + ++   +T      I T+  M+EL   G  K++G+SN++   ++D 
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTD------------A 227
           L  +G ++ P   Q+E HP L Q +L+++C+  GI +  YS  G                
Sbjct: 181 L--RGCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDED 284
           PL   PVI +IA+++ V  + V++ W  QRG  V+PKS +  R+  N +I    TL+ +D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 FEAINGISK 293
            E I+ ++K
Sbjct: 299 LEEISSLNK 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  164 bits (414), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           ++  L++G  IP VGLGT++   N     V  AL+ GYRH DTA +Y NE +VGQ I+  
Sbjct: 7   KSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKW 66

Query: 69  -----SGVPREKIFVTTKLWCTQH-HEPA-KALDQSLRRL-GLDYVDLYLMHWPVRLDPD 120
                +   R  +F TTKLW +QH +E A KA+D  L+ +  L Y+DL L+H P+     
Sbjct: 67  LNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL----- 121

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                          G + +       ++T+E MQE    GK +++GVSN+   ++++LL
Sbjct: 122 ---------------GGKKLR------LETYEAMQEAVDAGKVRSIGVSNYGFQHIEELL 160

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
             +  K  P  NQ+EI P   + EL DFC+ KGI++E Y+PL  T    LK+P ++++A 
Sbjct: 161 NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVAN 218

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTL 280
           +        +I W  Q+GY+ LPK+ +  R+ +N  +F+ 
Sbjct: 219 EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 166/311 (53%), Gaps = 29/311 (9%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR- 67
           +R ++LN G ++P VGLG W+  +      V  A+K GYR  D A  Y NE +VGQ IR 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREKIFVTTKLWCTQHHEPAK---ALDQSLRRLGLDYVDLYLMHWPVRLD--P 119
             D G V RE++FV +KLW    H+P     AL ++L  + LDY+DL+ +H+P+ L   P
Sbjct: 62  AIDEGIVKREELFVVSKLW-NSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVP 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
              K    L   ++ +    +   N   I T+  +++L   G  K++G+SNFS + + DL
Sbjct: 121 FKEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDL 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDA 227
           L  +G ++ P A Q+E HP L Q  L+ + + +G+ +  YS  G             T  
Sbjct: 181 L--RGCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTP 238

Query: 228 PLLKEPVILEIAKKN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSD 282
           PL + P I+EIAK +   + P+ V++ W  Q    V+PKS   +R+  N  I    TL+D
Sbjct: 239 PLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTD 298

Query: 283 EDFEAINGISK 293
           ++ + I+ ++K
Sbjct: 299 QELKEISALNK 309

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  163 bits (413), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 166/306 (54%), Gaps = 26/306 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---D 68
           ++LN G ++P VGLG W+  ++   + V  A+K GYR  D A  Y NE +VGQ I+   D
Sbjct: 5   VTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAID 64

Query: 69  SG-VPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
            G V R  +FV +KLW + HH      AL ++L+ LGLDY+DLY +H+P+       ++ 
Sbjct: 65  EGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEK 124

Query: 126 NILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
                 T  D +R   ++      + T+  ++E    G  K++G+SNF+   ++DLL   
Sbjct: 125 YPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLL--N 182

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAPLLK 231
           G ++ P A Q+E HP L Q +L+++C+ KGI +  YS  G             +   LL+
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLE 242

Query: 232 EPVILEIAKKN-NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
            P+I +IA  + +  P+ V++ W  QRG  V+PKS   +R+  N  +    TL++E+   
Sbjct: 243 HPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELNE 302

Query: 288 INGISK 293
           I+ ++K
Sbjct: 303 ISSLNK 308

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  161 bits (407), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/308 (32%), Positives = 163/308 (52%), Gaps = 25/308 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQ---- 64
           ++T++LN G ++P +GLG W+  ++     V  A+K GYR  D A  Y NE +VGQ    
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 65  AIRDSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPV--RLDPD 120
           AI +  V RE +FV +KLW + HH      AL ++L  +GLDY+DL+ +H+P+  +  P 
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
             K         + + +  +   +   I T+  +++    G  K++G+SNF+ + ++DLL
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLL 184

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAP 228
             +G ++ P A Q+E HP L Q  L+ +C+  GI +  YS  G             T   
Sbjct: 185 --RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPT 242

Query: 229 LLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDF 285
           L +   +  IA  + V  + V++ W  QRG  V+PKS   +R+  N  I    TLSD++ 
Sbjct: 243 LFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKEL 302

Query: 286 EAINGISK 293
           +AI+ ++K
Sbjct: 303 KAISALNK 310

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 147/277 (53%), Gaps = 36/277 (12%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           ++  L +G  IP +GLGT+    ++    V AAL+ GYRH+DTA +Y NE +V Q     
Sbjct: 5   KSYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNF 64

Query: 67  --RDSGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRLG-LDYVDLYLMHWPVRLDPDY 121
             R   V RE IF TTKLW +Q  + +  +A+ + +  +G L Y+DL LMH P+      
Sbjct: 65  LGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI------ 118

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLA 181
                         G + V         TW+ MQE    G  +++GVS++   +L+DL  
Sbjct: 119 --------------GGKQVRR------GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFE 158

Query: 182 SKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKK 241
               K  PA NQ+EI P + + +L D+C+ KGI++E YSPL  T    L +P +L++A++
Sbjct: 159 WSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEE 216

Query: 242 NNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIF 278
               P  V++ W  Q GYV LPK+    R++ N  +F
Sbjct: 217 TGKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  160 bits (405), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 149/273 (54%), Gaps = 33/273 (12%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR----DS 69
           LN G QIP +G G ++    D    V +ALKDGYRHIDTA +Y+N+ +  Q +R    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDET 74

Query: 70  GVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRLG--LDYVDLYLMHWPVRLDPDYIKDG 125
           G  RE I+ TTKLW +Q    E  KAL +    +   + YVDL L+H P       ++  
Sbjct: 75  GEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRRLETW 134

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGN 185
            IL    ++ GS+A++I                     K++GVSNF +++L++LL  K  
Sbjct: 135 AILEQAVQEPGSKALEI---------------------KSIGVSNFGVDHLEELL--KVA 171

Query: 186 KLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQ 245
           K+ P  +Q+E+HP LP+ EL  + + K I  E YSPL  T    L++P +L +  K  + 
Sbjct: 172 KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAKTGIN 229

Query: 246 PAHVVISWHAQRGYVVLPKSVNPDRVKANRKIF 278
            A +++ W   +G+VVL KS NP+R++ N  + 
Sbjct: 230 KAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 170/314 (54%), Gaps = 44/314 (14%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI- 66
           ++ T +L  G +IP +G GT+++    A   V AA K GYRH+DTA +Y NE +   A+ 
Sbjct: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64

Query: 67  ----RDSGVPREKIFVTTKLWCTQH-HEPA-KALDQSLRRLG-LDYVDLYLMHWPVRLDP 119
                   V R+++F TTK+    H +E A K++ +SL     L+YVDL+L+H P     
Sbjct: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC---- 120

Query: 120 DYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
                    +   K+ G             T++ +QE  K GK KA+GVS++SI +L++L
Sbjct: 121 ---------AETEKRLG-------------TYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIA 239
            + +G ++ P  NQ E++P L + +L+ +C+ + ++IE +SP+  T +    +PV+ ++ 
Sbjct: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLL 216

Query: 240 KKN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAINGISKAK 295
           K++     PA ++I W  Q G+V LPKSV+ DR ++N     F +S ED + +       
Sbjct: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----D 272

Query: 296 GEKRVVHPNWSPFE 309
           GE  +  P + P E
Sbjct: 273 GEHFLAQPGFDPIE 286

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 148/280 (52%), Gaps = 37/280 (13%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           +   L++G  +P +GLGT+    N   + V  ALK GYRH+DTA +Y NE +VG+ I   
Sbjct: 8   KAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67

Query: 67  ---RDSGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRLDPD 120
                S   RE +F  TKLW +Q  ++   +A+ +   ++ GL Y+DL L+H P+     
Sbjct: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL----- 122

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  +++GVSN+ ++++ +LL
Sbjct: 123 --------------SGSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
                K  P  NQ+EI P L + EL D+C+ +G+++E Y+PL  T    +  P +L +AK
Sbjct: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTL 280
           +       V+I W  Q GYV LPK+ +  R+ +N  ++ +
Sbjct: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 152/286 (53%), Gaps = 42/286 (14%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           +   L++G  +P +GLGT+     +  + V  ALK GYRH+DTA +Y NE +VGQ I+  
Sbjct: 15  KAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74

Query: 69  -----SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120
                    R+ +F TTKLW +Q  +    +A+ + + ++  L Y+DL L+H P+     
Sbjct: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL----- 129

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  +++GVSN+  +++ +LL
Sbjct: 130 --------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELL 168

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
             K  K  P  NQ+EI P + + +L D+C+ KG+++E +SPL  T    LK P +L +AK
Sbjct: 169 TWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAK 226

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFE 286
           +       V+I W  Q GYV LPKS + +R+K N K +     DFE
Sbjct: 227 ETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  158 bits (400), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 165/308 (53%), Gaps = 27/308 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG----Q 64
           ++ ++LN G ++P VGLG W+  ++     V  A+K GYR  D A  Y NE +VG    Q
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIRDSGVPREKIFVTTKLWCTQHHEPAK---ALDQSLRRLGLDYVDLYLMHWPVRLDPDY 121
           AI +  V RE++FV +KLW   +H+P     AL ++L  + LDY+DLY +H+P+      
Sbjct: 62  AISEGIVKREELFVISKLW-NSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 122 IKDGNILSVPT-KQDGSRAVDITNWN-FIKTWELMQELPKTGKAKAVGVSNFSINNLKDL 179
            ++       T K+D  + +        I T+  M++L   G  K++G+SNF+   ++DL
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDL 180

Query: 180 LASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG-----------STDAP 228
           L S   K+ P   Q+E HP L Q  LI++C+   I +  YS  G           + DA 
Sbjct: 181 LRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAK 238

Query: 229 LLKE-PVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDED 284
           +L E  VI  IA  ++V+P+ V++ W  QRG  ++PKS   +R+  N  I    TLS+++
Sbjct: 239 VLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQE 298

Query: 285 FEAINGIS 292
              I+ ++
Sbjct: 299 LSTISDLN 306

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 158/290 (54%), Gaps = 39/290 (13%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           +  +L+ G +IP + LGT+    +     V  ALK GYRH DTA +Y NE +VG+ I   
Sbjct: 5   KFYTLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQW 64

Query: 69  -----SGVPREKIFVTTKLWCTQH-HEPAK-ALDQSLRRL-GLDYVDLYLMHWPVRLDPD 120
                    RE +F TTKLW +Q+ ++PAK A+ + L+++  L Y+DL L+H P+     
Sbjct: 65  LQEDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL----- 119

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                          GSR         ++T++ MQE    G  K++GVSN+  ++L++LL
Sbjct: 120 --------------SGSR-------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELL 158

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           + +G K  P  NQ+EI P   + EL  +C+ +GI++E Y+PL  T    LK+P ++++A+
Sbjct: 159 SWEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAE 216

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAI 288
           +       V+I W  Q GY+ LPK+ N DR+  N  +  F L++   +A 
Sbjct: 217 EVGKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAF 266

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  158 bits (399), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 163/310 (52%), Gaps = 27/310 (8%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQ---- 64
           T  ++LN G ++P VGLG W+  ++     V  A+K GYR  D AA Y NE +VGQ    
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIRDSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122
           A+ +  V R  +F+ +KLW T HH      AL ++L  LGLDY+DLY +H+P+       
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 KDGNILSVPTKQDGSR--AVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
           ++       T  + ++   + + N  ++ T+  M++L   G  K++GVSN   + L+D+L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG-----------STDAP- 228
              G ++ PAA Q+E HP L Q  L+ FC+ + I +  YS  G           + D P 
Sbjct: 182 M--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 229 LLKEPVILEIAKKN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDE 283
           L   PVI +IA  +  +V  + V++ W  QR   ++PKS   +R+  N  +    TL++ 
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 284 DFEAINGISK 293
           +   I+ ++K
Sbjct: 300 ELLEISALNK 309

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  156 bits (395), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 164/309 (53%), Gaps = 32/309 (10%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---D 68
           ++LN G ++P VGLG W+   +   + +  A+K GYR  D A  Y NE +VGQ I+   D
Sbjct: 5   VTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKRAID 64

Query: 69  SG-VPREKIFVTTKLWCTQHHEPAKALD--QSLRRLGLDYVDLYLMHWPVRL---DPDYI 122
            G V RE +F+ +KLW   HH     L+  ++L+ LGLDYVDLY +H+P+      PD  
Sbjct: 65  EGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSPDER 124

Query: 123 KDGNILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
               + +   K+D ++ + +T  N   I T+  M++L   G  K++G+SN++   + D L
Sbjct: 125 YPPGMYT--GKEDEAKGI-LTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAP 228
             +G ++ P A Q+E HP L Q +L+++C+   + +  YS  G                P
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 229 LLKEPVILEIAKK-NNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDED 284
           L   P I +IA K   V  + V++ W  QRG  ++PKS   +R+  N  I    TL++ED
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 285 FEAINGISK 293
              I+ +++
Sbjct: 300 LREISALNQ 308

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 156/293 (53%), Gaps = 40/293 (13%)

Query: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI-- 66
           + T +L  G +IP + LG +++   +   +V  ALK GYRH+D A +Y NE +VG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---RDSGVPREKIFVTTKLWCTQH-HEPA-KALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120
                  V R +IF TTK+    H +E A K++ +SL  +  ++Y+DL L+H P+    +
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                                      + TW+ +QE    GK +A+GVSN+SI +L++L 
Sbjct: 126 R--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
             +G K+ P  NQ E++P L + EL ++C  KG+++E +SPL  T      +P + E+ K
Sbjct: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIK 217

Query: 241 KN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
            +  N  PA ++I W  Q G++ LPKS N  R  +N +   F +SD+D +A+ 
Sbjct: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 143/277 (51%), Gaps = 37/277 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD----- 68
           L+ G  IP VGLGT+   +N     V  ALK GYRH DTA +Y NE++VGQ I       
Sbjct: 11  LSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLED 70

Query: 69  -SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRLDPDYIKD 124
                RE +F TTKLW +Q  + +  KA+   L ++  L+Y+DL L+H P+         
Sbjct: 71  PENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL--------- 121

Query: 125 GNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKG 184
                      G++         ++TW+ MQE    G  K++GVSN+ ++++ +LL  + 
Sbjct: 122 ----------GGTKLR-------LETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQY 164

Query: 185 NKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNV 244
            K  P  NQ+EI P L + EL D+C+   I +E YSPL  T    L +  + ++A +   
Sbjct: 165 LKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETGK 222

Query: 245 QPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLS 281
               V+I W  Q GY+ LPK+   +R+K N  ++  +
Sbjct: 223 NVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 158/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---- 67
           ++LN G ++P VGLG W+         +  A+K GYR  D A  Y NE +VG+ IR    
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 68  DSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           +  V R+ IFV +KLW   HH      AL ++L  +GLDY+DLY +H+P+       ++ 
Sbjct: 65  EGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 NILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
                 T  D  +   IT  +   I T+  ++E    G  K++GVSNF  + ++DLL  +
Sbjct: 125 YPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL--R 182

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG-----STDAPLLK-EPVILE 237
           G ++ P A Q+E HP L Q  L++FC+   I +  YS  G       D  L K  P + E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 238 ---IAKKNNVQP----AHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
              I K +   P    + V++ W  QRG  V+PKS   +R+  N +I   FTL++++ + 
Sbjct: 243 NDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKD 302

Query: 288 INGIS 292
           I+ ++
Sbjct: 303 ISALN 307

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  154 bits (389), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 97/305 (31%), Positives = 157/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---- 67
           ++LN G ++P VGLG W+         +  A+K GYR  D A  Y NE +VG+ IR    
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRRAIS 64

Query: 68  DSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           +  V R+ +FV +KLW   HH      AL ++L  +GLDY+DLY +H+P+       ++ 
Sbjct: 65  EGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 NILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
                 T  D  +   IT  +   + T+  ++E    G  K++G+SNF  + ++DLL  +
Sbjct: 125 YPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLL--R 182

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAPLLK 231
           G ++ P A Q+E HP L Q  L++FCR   I +  YS  G             T   L +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 232 EPVILEIAKKN-NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
             VI +I+  +     + V++ W  QRG  V+PKS   +R+  N +I   FTL++++ + 
Sbjct: 243 NDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKE 302

Query: 288 INGIS 292
           I+ ++
Sbjct: 303 ISALN 307

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 149/281 (53%), Gaps = 37/281 (13%)

Query: 7   DSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI 66
           D  +   L  G +IP + LGT+   ++   K V  ALK GYRH DTA +Y NE +VGQ I
Sbjct: 6   DVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGI 65

Query: 67  RD------SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRL 117
            +      +   RE +F TTKLW +Q  ++E  +A+ + ++++ GL Y+D+ L+H P+  
Sbjct: 66  VNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL-- 123

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                             G R         ++TW+ MQE    G  K++GVSN+  ++++
Sbjct: 124 -----------------SGQR-------RRLETWKAMQEAVDEGIVKSIGVSNYGKHHIE 159

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILE 237
           +LL     K  P  NQ+EI P + + EL D+C+   +++E Y+P+       + +P + E
Sbjct: 160 ELLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMNDPGLRE 217

Query: 238 IAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIF 278
           I+K+  + P  ++I W  Q GY+ LPK+    R+ +N  ++
Sbjct: 218 ISKETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  152 bits (385), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 148/287 (51%), Gaps = 43/287 (14%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQA---- 65
           +T  L++   IP V LGT+    ++  + V  AL  GYRH DTA +Y NE++V Q     
Sbjct: 7   KTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNW 66

Query: 66  -IRDSGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRLDPDY 121
            IR     R++IF TTKLW +Q  +    +A+ + + ++  L Y+DL LMH P+      
Sbjct: 67  LIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------ 120

Query: 122 IKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLA 181
                         G +  +       +TW  MQE    G  K++GVSNF I +LK+L  
Sbjct: 121 -------------GGPQIRE-------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQ 160

Query: 182 SKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKK 241
             G K  P  NQ+EI P L + EL DFC+ +G+++E Y+PL  T    +  P +++I+ +
Sbjct: 161 WDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNE 218

Query: 242 --NNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFE 286
             N      ++I W  Q GYV LPK+    R+++N  ++     DFE
Sbjct: 219 LNNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVY-----DFE 260

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 142/275 (51%), Gaps = 37/275 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI----RDS 69
           LN G ++P +G G +     +  + V  AL++GYRHIDTA +Y N+ Q  Q +     ++
Sbjct: 15  LNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEET 74

Query: 70  GVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLD------YVDLYLMHWPVRLDPDYIK 123
           G PRE+++ TTKLW TQ    A    ++L  +  D      YVDL L+H P+      ++
Sbjct: 75  GTPREEVWFTTKLWNTQQGRDATP--RALEEIAADVKEFIGYVDLLLLHSPLTDAQRRLE 132

Query: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
              +L    ++  S A++I                     +A+GVSNF + +L++LL   
Sbjct: 133 TWAVLERAVQEPASSALEI---------------------RAIGVSNFGVRHLQELLEVA 171

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNN 243
             K  P  +Q+E+HP LP+ EL  F R  GI+ E YSPL  T    L++P +L +  K+ 
Sbjct: 172 TVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELLALEAKSG 227

Query: 244 VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIF 278
           +    +++ W   +G+ VL KS NP R++ N  + 
Sbjct: 228 LSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  152 bits (384), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 158/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---- 67
           ++LN G ++P VGLG W+  +      +  A+K GYR  D A  Y NE +VG+ IR    
Sbjct: 5   VTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 68  DSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           +  V R+ IFVT+KLW   HH      AL ++L  +GLDY+DLY +H+P+       ++ 
Sbjct: 65  EGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPFEEK 124

Query: 126 NILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
                 T  +  +   IT  +   I T+  ++     G  K++G+SNF  + ++DLL  +
Sbjct: 125 YPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL--R 182

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG-----------STDAPLLKE 232
           G ++ P A Q+E HP L Q  L+D+C+   I +  YS  G           +   P L E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTLFE 242

Query: 233 PVILEIAKKNN--VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
             +++   +N+     + V++ W  QRG  V+PKS   +R+  N +I    TL+D++ + 
Sbjct: 243 NDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQELKE 302

Query: 288 INGIS 292
           I+ ++
Sbjct: 303 ISSLN 307

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  151 bits (381), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 160/310 (51%), Gaps = 27/310 (8%)

Query: 8   STRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR 67
           ++ T+ LN G Q+P VGLG W+  +      V  A+K GYR  D A  Y NE +VGQ I 
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 68  ---DSG-VPREKIFVTTKLWCTQHHEP---AKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120
              D G V RE +FV +KLW   +H+P    KAL ++L  + L+Y+DL+ +H+P+     
Sbjct: 64  KAIDEGIVKREDLFVVSKLW-NSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYV 122

Query: 121 YIKDGNILSVPTKQDGSR--AVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKD 178
             ++       T  + ++   + +     I T+  ++E  K G  K++G+SNF    + D
Sbjct: 123 PFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHD 182

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG-----STDAPLLKE- 232
           LLA  G  + P   Q+E HP L Q +LI++C  + I +  YS  G       D+ L K  
Sbjct: 183 LLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKST 240

Query: 233 PVILE------IAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDE 283
           P + E      IA  + V  + V++ W  QR   ++PKS   +R+  N +I    TL++ 
Sbjct: 241 PTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTEA 300

Query: 284 DFEAINGISK 293
           + + I+ ++K
Sbjct: 301 ELQEISALNK 310

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 165/311 (53%), Gaps = 44/311 (14%)

Query: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI---- 66
           T +L  G ++P +GLG +Q+   +    V  ALK GYR +D+A +Y NE +    I    
Sbjct: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67

Query: 67  -RDSGVPREKIFVTTKLWCT-QHHEPAK-ALDQSLRRLG-LDYVDLYLMHWPVRLDPDYI 122
                V R  IF TTK+    Q +E AK ++++SL R+  LDY+DL+L+H P        
Sbjct: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP-------- 119

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182
                L+   K+ G             TW+  QE  +TGK KA+GVSN+ I +L+++   
Sbjct: 120 -----LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242
            G K+ P  NQ E++P L + EL ++C  KG++I+ YSPL  T A  L++P ++++ + +
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219

Query: 243 NVQ--PAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAINGISKAKGEK 298
             +   A ++++W  Q G+V L K+V+ DR+K N K   F LS  D + +        + 
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT----HDDQY 275

Query: 299 RVVHPNWSPFE 309
            +  P W P +
Sbjct: 276 YLSQPKWDPIK 286

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  149 bits (377), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 152/286 (53%), Gaps = 42/286 (14%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           R   L++G  +P +GLGT+     +  + V  ALK GYRH+DTA +Y NE +VG+ +   
Sbjct: 8   RAYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKW 67

Query: 69  -----SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120
                    R  +F TTKLW +Q  +    +A+ + L ++  L Y+D+ L+H P+     
Sbjct: 68  LKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL----- 122

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                          G+R         ++T++ MQE    G  +++GVSN+  +++ +LL
Sbjct: 123 --------------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELL 161

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
           A +  K  P  NQ+EI P + + +L D+C+ KG+++E +SPL  T    +K P ++ +A+
Sbjct: 162 AWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAE 219

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFE 286
           +       V+I W  Q GYV LPKS + +R+K N +++     DFE
Sbjct: 220 EVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY-----DFE 260

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  149 bits (377), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 151/287 (52%), Gaps = 39/287 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI-----RD 68
           L+ G +IP + LGT+    +   + V   +K GYRH DTA +Y NE +VG  I      D
Sbjct: 8   LSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

Query: 69  SG-VPREKIFVTTKLWCTQH-HEPAKA-LDQSLRRL-GLDYVDLYLMHWPVRLDPDYIKD 124
            G   RE+IF TTKLW +Q+ ++ AKA + Q L  + GL Y+DL L+H P+         
Sbjct: 68  PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL--------- 118

Query: 125 GNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKG 184
                     +GS+         ++TW  MQE    G  K++GVSN+   ++ +LL    
Sbjct: 119 ----------EGSKLR-------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPE 161

Query: 185 NKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNV 244
            K  P  NQ+EI P + + EL D+C+ KG+++E ++PL       +  P +L++ K+ + 
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKEVDR 219

Query: 245 QPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
            P  V+I W  Q GY+ LPK+    R++ N     F LSDE  + ++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLD 266

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 154/291 (52%), Gaps = 39/291 (13%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           +  ++  G +IP + LG +    +     V  ALK GYRH DTA +Y NE +VG+ I   
Sbjct: 5   KYYTMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKW 64

Query: 69  -----SGVPREKIFVTTKLWCTQH-HEPAK-ALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120
                +   RE +F TTKLW +Q+ + PAK  + + + ++  L Y+DL L+H P      
Sbjct: 65  LKEDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSP------ 118

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                  LS P ++             ++T++ MQE    G  K++GVSN+   ++++L 
Sbjct: 119 -------LSGPRRR-------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELY 158

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
                K  P ANQ+EI P   + +L  +C+ KG+++E +SPL  T    LKEP ++ +AK
Sbjct: 159 KWDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAK 216

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
           K       V+I W  QRG + LPK+ NP R+ +N ++  F L+ ED + ++
Sbjct: 217 KLGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELD 267

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 150/289 (51%), Gaps = 42/289 (14%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI--- 66
           +  +L+ G +IP + LGT+    +   + V   +K GYRH DTA +Y NE +VG  I   
Sbjct: 4   KFYNLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  ---RDSGVPREKIFVTTKLWCTQH-HEPAKA-LDQSLRRL-GLDYVDLYLMHWPVRLDPD 120
                    REKIF TTKLW +Q+ ++ AKA + Q L  + GL Y+DL L+H P+     
Sbjct: 64  LNENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                         +GS+         ++TW+ MQE    G  K++GVSN+   ++ +LL
Sbjct: 119 --------------EGSKLR-------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELL 157

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
                   P  NQ+EI P + + EL D+C+ KG+++E ++PL       +  P +L++ K
Sbjct: 158 TWPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCK 215

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
           + +  P  V+I W  Q GY+ LPK+    R++ N     L+  DFE ++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGN-----LAAYDFELLD 259

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  150 bits (379), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 157/305 (51%), Gaps = 26/305 (8%)

Query: 12  LSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR---- 67
           ++LN G ++P VGLG W+   N     +  A+K GYR  D A  Y NE +VG+ IR    
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIY 64

Query: 68  DSGVPREKIFVTTKLWCTQHH--EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           +  V R+ +FV +KLW   HH      AL ++L  +GLDY+DLY +H+P+       ++ 
Sbjct: 65  EGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPFEEK 124

Query: 126 NILSVPTKQDGSRAVDITNWN--FIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183
                 T  +      IT  +   I T+  +++    G  K++G+SNF  + ++DLL  +
Sbjct: 125 YPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDLL--R 182

Query: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLG------------STDAPLLK 231
           G ++ P A Q+E HP L Q  L++FC+   I +  YS  G                 L +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQTLFE 242

Query: 232 EPVILEIAKKNN-VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI---FTLSDEDFEA 287
             VI ++++ +     + V++ W  QRG  V+PKS   +R+  N +I   F+L++++ + 
Sbjct: 243 NDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQELKK 302

Query: 288 INGIS 292
           I+ ++
Sbjct: 303 ISALN 307

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  148 bits (374), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 150/291 (51%), Gaps = 39/291 (13%)

Query: 10  RTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD- 68
           +  + N G QIP + LGT+    +   K V  ALK GYRH DTA +Y NE QVG+ I   
Sbjct: 6   KYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQW 65

Query: 69  -----SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRLDPD 120
                    R  +F TTKLW +Q  +H+   A+ + L ++ GL Y+D+ L+H P      
Sbjct: 66  IQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSP------ 119

Query: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180
                  L   TK+             ++TW  MQE  ++G  K +GVSN+   ++++LL
Sbjct: 120 -------LEGRTKR-------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELL 159

Query: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240
             +   + P  NQ+EI P + ++EL D+C+  G+++E ++PL  T    L +  ++ ++K
Sbjct: 160 QWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSK 217

Query: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
           +       V+I W  Q GY+ LPK+    R++ N +   F L+ E  + I+
Sbjct: 218 EVGRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLID 268

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  147 bits (372), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 145/287 (50%), Gaps = 39/287 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD----- 68
           L+ G +IP + LGT++   +   + V   +K GYRH DTA +Y NE +VG  I       
Sbjct: 8   LSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNED 67

Query: 69  -SGVPREKIFVTTKLWCTQ--HHEPAKALDQSLRRL-GLDYVDLYLMHWPVRLDPDYIKD 124
                R  IF TTKLW +Q  + +   A+ Q L  + GL+Y+DL L+H P+         
Sbjct: 68  PKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL--------- 118

Query: 125 GNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKG 184
                     +GS+         ++TW  MQE    G  K++GVSN+   ++ +LL    
Sbjct: 119 ----------EGSKLR-------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSE 161

Query: 185 NKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNV 244
            +  P  NQ+EI P + + EL D+C+ KG+++E ++PL       +  P +L + K+ + 
Sbjct: 162 LRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEVDR 219

Query: 245 QPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
            P  V+I W  Q GY+ LPK+    R++ N     F LSDE  + ++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLD 266

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  148 bits (373), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 162/302 (53%), Gaps = 59/302 (19%)

Query: 8   STRTLSLNTGAQIPQV---GLGT--WQSKDNDAYKS-----VLAALKD---GYRHIDTAA 54
           + +  +L+ G +IP V   G GT  ++S++ DA  S     ++    D   G  HID A 
Sbjct: 3   TQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAE 62

Query: 55  IYRNEDQVGQAIRDSGVPREKIFVTTKLWCTQH--HEPAKALDQSLRRLGLDYVDLYLMH 112
           IYR   ++G A++D+  PR++IF+T K    +     P  AL+ SL++LG+DYVDLYL+H
Sbjct: 63  IYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLH 122

Query: 113 WPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFS 172
            P+      IK+  +                  +    W+ ++EL K+GKAK +GVSNF+
Sbjct: 123 SPI------IKESKL------------------DVEANWKYLEELYKSGKAKNIGVSNFA 158

Query: 173 INNLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPL 229
           + +L+ LLA    ++ P  NQ+E  P L QN+   +++F +  GI++E YSPLG    PL
Sbjct: 159 VKDLEKLLAVA--EVKPQVNQIEFSPFL-QNQTPGIVEFSQKNGILLEAYSPLG----PL 211

Query: 230 LKEP----------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT 279
            + P           I E++KK N   A +++SW  +RG + +  S   +R++  + IF+
Sbjct: 212 QRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFS 271

Query: 280 LS 281
            S
Sbjct: 272 FS 273

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  147 bits (370), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 146/286 (51%), Gaps = 38/286 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI-----RD 68
           L+ G QIP VGLG +Q  +      V  AL+ GYR  D+A  Y NED V + I       
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 69  SGVPREKIFVTTKLWCTQHHEPA--KALDQSLRRLG-LDYVDLYLMHWPVRLDPDYIKDG 125
            G  RE ++ TTK+    H   A  K+L++SL   G L Y+DL L+H P           
Sbjct: 75  PGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAP----------- 123

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGN 185
             +S  T++ G             TW+ ++E    G+ +++GVSN+   +L +LL  +G 
Sbjct: 124 --MSDRTRRLG-------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGL 168

Query: 186 KLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQ 245
           K+ P  NQVEI+P L + EL+ +CR   I ++ +SPL       L +P++ ++A + +  
Sbjct: 169 KIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDKG 226

Query: 246 PAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
            A +++ W  Q G++VLPK+   +R+  N  I  F LS E    + 
Sbjct: 227 VAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELT 272

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  145 bits (365), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 149/287 (51%), Gaps = 39/287 (13%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRD----- 68
            + G ++P + LGT+    +   + V   +K GYRH DTA +Y NE +VG  I       
Sbjct: 8   FSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHED 67

Query: 69  -SGVPREKIFVTTKLWCTQH-HEPAK-ALDQSLRRL-GLDYVDLYLMHWPVRLDPDYIKD 124
                RE +F TTKLW +Q+ ++ AK A+ Q L  + GL Y+DL L+H P+         
Sbjct: 68  PENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL--------- 118

Query: 125 GNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKG 184
                     +GS+         ++TW+ MQE    G  K++GVSN+   ++ +LL    
Sbjct: 119 ----------EGSKLR-------LETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQ 161

Query: 185 NKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNV 244
            K  P  NQ+EI P + + EL D+C+ K +++E ++PL       + +P +L++ K+ + 
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEVDR 219

Query: 245 QPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289
            P  V+I W  Q GY+ LPK+    R+++N     F LSD+  + ++
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILD 266

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  140 bits (352), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 155/300 (51%), Gaps = 53/300 (17%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDAYKSV-------LAALKDGYRHIDTAAIYRNE 59
            +LN G +IP +   G GT  +++++ DA  S        +A    G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMHWPVR 116
            +V  A+R+S  PR++IF+T K + TQ     +P   L+ SL+ LGLDYVDLYL+H P  
Sbjct: 68  PEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSP-- 124

Query: 117 LDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNL 176
               +IK+G+ L                    + W+ M++L K+GKAK +GVSNF + +L
Sbjct: 125 ----FIKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDL 161

Query: 177 KDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGS----TDAPL 229
           + +L  K   + P  NQ+E +  L QN+   ++ FC+   I +E Y+PLG      D P 
Sbjct: 162 EKIL--KIATIKPQINQIEFNAAL-QNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPE 218

Query: 230 LK--EPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEA 287
            K     I E++KK N   A +++ W  +RG + +  S  P R+   + +F+   E  E 
Sbjct: 219 AKPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEV 278

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  135 bits (340), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 164/319 (51%), Gaps = 51/319 (15%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDAYKS------VLAALK-DGYRHIDTAAIYRNE 59
           ++LN G +IP +   G GT  ++ ++ DA  S      ++ ALK  G  HID A IYR  
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMHWPVR 116
            +VG+A+  +  PR +IF+T K + TQ      PA  LD +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 117 LDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNL 176
                        V  + +G        +   + W+ M++L ++GKAK +GVSNF++ +L
Sbjct: 126 -------------VSKETNG--------FTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLG------STDA 227
           + +L  K  ++ P  NQ+E  P L QN+   +  FC+   I++E YSPLG      + D 
Sbjct: 165 ERIL--KVAEIRPQVNQIEFSPFL-QNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDE 221

Query: 228 PLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEA 287
            L     + E+++K     A + + W  +RG + +  S  P R+   + +F+    D E 
Sbjct: 222 SLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTD-EE 280

Query: 288 INGISKAKGEKRVVHPNWS 306
           +N I++   E   +   W+
Sbjct: 281 VNQITELGLEHEPLRLYWN 299

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 165/315 (52%), Gaps = 60/315 (19%)

Query: 10  RTLSLNTGAQIPQV---GLGT--WQSKDNDAYKS------VLAALK-DGYRHIDTAAIYR 57
           + + LN G +IP +   G GT  +++ + DA  S      ++ AL+  G  HID A IYR
Sbjct: 6   KFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYR 65

Query: 58  NEDQVGQAIRDSGVPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMHWP 114
              +VG+A+  +  PR++IF+T K + TQ      PA  L+ SL+++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSP 124

Query: 115 VRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSIN 174
                          V  + +G        +   + W+ M++L K GKAK +GVSNF++ 
Sbjct: 125 F--------------VSKEANG--------FTLEEAWKDMEQLYKAGKAKNIGVSNFAVK 162

Query: 175 NLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLK 231
           +L+ +L  K  ++ P  NQ+E  P L QN+   +  FC+   I++E YSPL    APL K
Sbjct: 163 DLEKIL--KIAEVKPQVNQIEFSPFL-QNQTPGIYKFCQDNNILLEAYSPL----APLQK 215

Query: 232 EPV----------ILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT-- 279
           +            + E+++K     A +++ W ++RG + +  S  P R+   + +F+  
Sbjct: 216 KTAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFD 275

Query: 280 LSDEDFEAINGISKA 294
           L+DE+ + I  +  A
Sbjct: 276 LTDEEVDEITELGLA 290

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 147/303 (48%), Gaps = 56/303 (18%)

Query: 12  LSLNTGAQIPQV---GLGTWQSKDNDAYKSVLAALKD---------GYRHIDTAAIYRNE 59
             LN G ++P V   G GT   K N+  ++    L D         G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQH--HEPAKALDQSLRRLGLDYVDLYLMHWPVRL 117
            +VG+A+ ++  PR++IF+T K W        P   L+  L+RLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                K+ N  S+                  + W +M+EL  +GKAK +GVSNF+  +L+
Sbjct: 125 ---ISKETNGFSLE-----------------EAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234
            +L  K  K+ P  NQ+E +  L QN+   + +FC+   I +  YSPLG    PL K+P 
Sbjct: 165 RVL--KVCKVKPQVNQIEFNAFL-QNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPA 217

Query: 235 ----------ILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDED 284
                     I ++A+  N  P  V++ W  +RG V +  S   +R+K  ++IF    +D
Sbjct: 218 DGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKD 277

Query: 285 FEA 287
            E 
Sbjct: 278 DEV 280

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  133 bits (334), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 164/329 (49%), Gaps = 58/329 (17%)

Query: 8   STRTLSLNTGAQIPQVGL-----------GTWQSKDNDAYKSVLAALK-DGYRHIDTAAI 55
           + +   LN G QIP + +           G+  +  ++  + +  AL   G  HID A  
Sbjct: 4   TQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAEC 63

Query: 56  YRNEDQVGQAIRDSGVPREKIFVTTKLWCTQH---HEPAKALDQSLRRLGLDYVDLYLMH 112
           Y    ++ +A+++S  PR +IF+T K + TQ    ++P + L+  L+ LGLDYVDLYL+H
Sbjct: 64  YGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIH 122

Query: 113 WPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFS 172
            P   DP++              GS  ++       K W+ M+ L K GKAK++GVSNFS
Sbjct: 123 SPF-FDPEF-------------KGSLTLE-------KVWKDMETLYKEGKAKSIGVSNFS 161

Query: 173 INNLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPL 229
           + N++++L   G K  P  NQ+E +  L QN+   ++++C+   I +E YSPLG    PL
Sbjct: 162 VKNIEEILKIAGIK--PQVNQIEFNAFL-QNQTPGIVNYCQKNNIQLEAYSPLG----PL 214

Query: 230 LKEP----------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT 279
            K P           I E+A K     + ++++W   RG + +  S    R+   + IF+
Sbjct: 215 QKRPENSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFS 274

Query: 280 LSDEDFEAINGISKAKGEKRVVHPNWSPF 308
            +    E ++ ++K   E+  +   W+ F
Sbjct: 275 FNLTKDE-VDTLTKLGLEQPALRIYWTNF 302

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  132 bits (331), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 163/322 (50%), Gaps = 57/322 (17%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDAYKS------VLAALK-DGYRHIDTAAIYRNE 59
            +LN G +IP +   G GT  +++++ DA  S      ++ ALK  G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTKL--WCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRL 117
            +VG+A+  +  PR  IF+T K          PA  LD +L+++G DYVDLYL+H P   
Sbjct: 68  PEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF-- 125

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                K+ N LS+                  + W+ M++L K+GKAK +GVSNF++ +L+
Sbjct: 126 ---VSKEVNGLSLE-----------------EAWKDMEQLYKSGKAKNIGVSNFAVEDLQ 165

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234
            +L  K  ++ P  NQ+E  P L QN+   +  FC+   I++E YSPLG    PL K+  
Sbjct: 166 RIL--KVAEVKPQVNQIEFSPFL-QNQTPGIYKFCQEHDILVEAYSPLG----PLQKKTA 218

Query: 235 ----------ILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDED 284
                     + E+++K     A +++ W  +RG + +  S  P R+   + +F+  D  
Sbjct: 219 QDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSF-DLT 277

Query: 285 FEAINGISKAKGEKRVVHPNWS 306
            E ++ I++   E   +   W+
Sbjct: 278 AEEVDKITELGLEHEPLRLYWN 299

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  131 bits (330), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/328 (29%), Positives = 165/328 (50%), Gaps = 57/328 (17%)

Query: 11  TLSL-NTGAQIPQVGLGT---WQ-----SKDNDAYKSVLA-----ALKDGYRHIDTAAIY 56
           TL L  +G +IP +G G+   W+      +  D + + LA     A+  G+ HID A  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  RNEDQVGQAIRDSGVPREKIFVTTKL--WCTQHHE---PAKALDQSLRRLGLDYVDLYLM 111
           +   +VG+ +++SGVPR+K+++T K   W     +   P ++L  SL ++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNF 171
           H P             ++V T       +D+      + W  M+E+   G AK +GVSNF
Sbjct: 127 HVP------------FITVQTA-----GIDLK-----EAWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SINNLKDLLASKGNKLTPAANQVEIHPLLPQNE--LIDFCRGKGIMIEGYSPLGSTDAPL 229
            + +L+ +  +K  K  P  NQ+E +  L Q    +I +C+   I++EGYSPL     PL
Sbjct: 165 DVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL----VPL 218

Query: 230 LK------EPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLS 281
            K      + ++  +A+K +     +++ W  Q G VV+  S    RVK +  I  F L+
Sbjct: 219 TKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELT 278

Query: 282 DEDFEAINGISKAKGEKRVVHPNWSPFE 309
            EDF++I  I + K  +  +   +S ++
Sbjct: 279 AEDFDSITKIGREKIFRGFMGEQYSKYD 306

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  129 bits (324), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 150/309 (48%), Gaps = 56/309 (18%)

Query: 15  NTGAQIPQVGLGT---W-----QSKDNDAYKSVLA-----ALKDGYRHIDTAAIYRNEDQ 61
            +G ++P +G G+   W     + +  D +   LA     A+K G+ HID A  Y+   +
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGQAIRDSGVPREKIFVTTKL----WCTQHHE-PAKALDQSLRRLGLDYVDLYLMHWPVR 116
           VG  I +SGVPREK++VT K     W  +  + P ++L+ SL ++ + YVDLYL+H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPF- 130

Query: 117 LDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNL 176
           ++P+                +  +D+      + W  M+E+   G AK +GVSNF + +L
Sbjct: 131 INPE----------------TAGIDLK-----EAWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KDLLASKGNKLTPAANQVEIHPLLPQNE--LIDFCRGKGIMIEGYSPLGSTDAPLLK--- 231
           + +      K  P  NQ+E    + Q    +I +C+  GI IEGYSPL     PL K   
Sbjct: 170 EYIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 232 ---EPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFE 286
              + ++  +AKK       +++ W  Q G + +  S    R+  +  I  F LS EDF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 287 AINGISKAK 295
           +I  + K K
Sbjct: 284 SITEVGKTK 292

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 157/311 (50%), Gaps = 62/311 (19%)

Query: 13  SLNTGAQIPQV---GLGTWQSKDNDAYKSVLAALKD---------GYRHIDTAAIYRNED 60
           +LN G ++P +   G GT   K  +  ++    L D         G  HID A +YR   
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYP 69

Query: 61  QVGQAIRDSG--VPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMHWPV 115
           +VG+A+R+S    PR++IF+T K + TQ      P   L   L++LGLDYVDLYL+H P 
Sbjct: 70  EVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPF 128

Query: 116 RLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINN 175
                         +  +++G        +   + W+ M++L K GK K +GVSNFS+ +
Sbjct: 129 --------------ISKEKNG--------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMAD 166

Query: 176 LKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKE 232
           L+ +L  K  ++ P  NQ+E +  L QN+   +++FCR   I +  Y+PLG    PL ++
Sbjct: 167 LQRIL--KSCEVKPQVNQIEFNAFL-QNQTPGIVNFCRENDIQVVAYTPLG----PLQRK 219

Query: 233 P----------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT--L 280
                       + ++A+K +   A +++ W ++RG + +  S    R+K  + +FT  L
Sbjct: 220 SKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDL 279

Query: 281 SDEDFEAINGI 291
           +D + E I  +
Sbjct: 280 TDSEVEKITQL 290

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  125 bits (314), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 146/296 (49%), Gaps = 56/296 (18%)

Query: 12  LSLNTGAQIPQV---GLGT-WQSKDNDAYK-------SVLAALK-DGYRHIDTAAIYRNE 59
            +LN G +IP V   G GT W   + +A K        V  AL   G  HID A IYR  
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQH--HEPAKALDQSLRRLGLDYVDLYLMHWPVRL 117
            ++G+A+R++  PR +I++T K   +      P    +  L+ LG+DY+DLYL+H P   
Sbjct: 68  PELGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSP--- 124

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
              +I +G                   +   + W+ ++EL K+GKAK +GVSNF+  +L+
Sbjct: 125 ---FITEGR----------------NGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLE 165

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKEP- 233
            +L  K  ++ P  NQ+E    L QN+   + +F +   I++E YSPLG    PL + P 
Sbjct: 166 RIL--KIAEIKPQVNQIEYSAFL-QNQTPGIYNFAKENDILLEAYSPLG----PLQRRPE 218

Query: 234 ---------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTL 280
                     I E+A+K     A V++ W ++RG + +  S  P RV   + IFT 
Sbjct: 219 EADSLPFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTF 274

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  125 bits (313), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 103/334 (30%), Positives = 161/334 (48%), Gaps = 60/334 (17%)

Query: 8   STRTLSLNTGAQIPQV---GLGT-WQ------SKDNDAYKSVL--AALKDGYRHIDTAAI 55
           S    +LN G +IP +   G GT W        K +D     L  A    G  HID A +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 56  YRNEDQVGQAIRDSGVPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMH 112
           Y    +V +A++ +   R++IF+T K +         P   L +SL+ L LDYVDLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 113 WPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFS 172
            P                 TK+     ++       + W+ M++L K GKAK +GVSNFS
Sbjct: 124 SPF---------------ITKESCGYTME-------EAWKQMEKLYKDGKAKNIGVSNFS 161

Query: 173 INNLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPL 229
           +++LK +L  K  ++ P  NQ+E +  L QN+   ++ FC+   I++E YSPLG    PL
Sbjct: 162 VDDLKRIL--KICEIKPQINQIEFNAFL-QNQTPGIVKFCQDHDILVEAYSPLG----PL 214

Query: 230 LKEPV----------ILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT 279
            K+P           I E+AKK       V++ W  +R  + +  S   +R+K  + +F+
Sbjct: 215 RKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFS 274

Query: 280 --LSDEDFEAINGISKAKGEKRVV-HPNWSPFEA 310
             L+ E+ E I  +  A    R+    N+S F++
Sbjct: 275 FDLTSEEVEKITKLGLAHEPSRLYWKNNYSQFDS 308

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 160/323 (49%), Gaps = 58/323 (17%)

Query: 12  LSLNTGAQIPQV---GLGT-WQSK------DNDAYKSVLAALK-DGYRHIDTAAIYRNED 60
            +LN G +I  V   G GT W+++       N+       AL   G  H+D A  YR   
Sbjct: 8   FTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYP 67

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQH--HEPAKALDQSLRRLGLDYVDLYLMHWPVRLD 118
           ++ +A+++S  PR +IF+T K          P +AL+ +L  LGLDYVDLY++H+P   D
Sbjct: 68  ELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP-EFD 126

Query: 119 PDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKD 178
           P+Y KD   LS+ T                  W  M+ L K GKAK +GVSNFSI +L+ 
Sbjct: 127 PEY-KD---LSIET-----------------AW--MELLYKEGKAKNIGVSNFSIEHLER 163

Query: 179 LLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKEP-- 233
           ++  K   + P  NQ+E +  L QN+   ++ +C+  G  +E YSPL    APL ++P  
Sbjct: 164 VM--KIADVKPQVNQIEFNAFL-QNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKN 216

Query: 234 --------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDF 285
                    I E++ K     + +++ W  +RG V +  S   +R+   + +F+    D 
Sbjct: 217 FNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTD- 275

Query: 286 EAINGISKAKGEKRVVHPNWSPF 308
           E ++ I+K   E+  +   W+ F
Sbjct: 276 EEVDKITKLGLEQPALRLYWNEF 298

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 154/322 (47%), Gaps = 56/322 (17%)

Query: 16  TGAQIPQVGLGT---WQ-----SKDNDAYKSVLA-----ALKDGYRHIDTAAIYRNEDQV 62
           +G  +P +G G+   W+      K    Y   LA     A++ G+ HIDTA  Y+   +V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GQAIRDSGVPREKIFVTTKL--WCTQHHE---PAKALDQSLRRLGLDYVDLYLMHWPVRL 117
           G  I ++ VPRE +++T K   W  +  +   P ++L  SL+ + LDYVDLY++H P   
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVP--- 130

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                      ++ TK  G   +D+      + W  M+E+     A+ +GVSNF + +L+
Sbjct: 131 -----------NITTKTAG---IDLK-----EAWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE--LIDFCRGKGIMIEGYSPLGSTDAPLLK---- 231
            + +    K  P  NQ+E    + Q    ++ +CR   I++EGYSPL     PL K    
Sbjct: 172 YIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLTKGKPG 225

Query: 232 --EPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEA 287
             + ++  IA K       V++ W  Q G VV+  +   +R+  +  I  F LS EDF+ 
Sbjct: 226 PLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQ 285

Query: 288 INGISKAKGEKRVVHPNWSPFE 309
           I  + + K  +  +H  +  ++
Sbjct: 286 ITNVGREKILRNYMHMLYEKYD 307

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  122 bits (307), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/319 (28%), Positives = 157/319 (49%), Gaps = 45/319 (14%)

Query: 9   TRTLSLNTGAQIPQV---GLGTWQSKDN--DAYKSVLA-----ALK-DGYRHIDTAAIYR 57
           T  ++LN G +IP +   G GT   K N  D Y   L      AL+  G  HID A +Y+
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 58  NEDQVGQAIRDSGVPREKIFVTTKLWCTQHHE--PAKALDQSLRRLGLDYVDLYLMHWPV 115
              +VG+A+R+S  PR++IF+T K    +     P + L  +L ++GL+YVDLYL+H+P+
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 116 RLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINN 175
            +DP                      + ++   + W++M++L   G AK +GVSNF + +
Sbjct: 125 -IDP---------------------KLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVED 162

Query: 176 LKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYS---PLGSTDAPL 229
           L+ L  SK   + P  NQ+E +  L QN+   + D+C    I +E +    PL   +   
Sbjct: 163 LEQL--SKSWVIKPQINQIEFNAYL-QNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKD 219

Query: 230 LKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
           L    + ++A+K +     +++ W +QR  + +  S  P+RV+    IF+      E + 
Sbjct: 220 LLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDE-VE 278

Query: 290 GISKAKGEKRVVHPNWSPF 308
            I+K   +   +   W+ +
Sbjct: 279 FITKLGSQHDTIRKYWNVY 297

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  122 bits (307), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 157/304 (51%), Gaps = 56/304 (18%)

Query: 12  LSLNTGAQIPQV---GLGT-W---QSKDNDAYKSVLAALK-----DGYRHIDTAAIYRNE 59
            +LN G +IP V   G GT W   +  +++  K ++  +K      G  H+D A  Y   
Sbjct: 27  FTLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTY 86

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCT--QHHEPAKALDQSLRRLGLDYVDLYLMHWPVRL 117
            ++GQA+R+S  PR++IF+T K   T   H    +  +  ++++G+DYVDLYL+H P+  
Sbjct: 87  QELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL-- 144

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                       +  +++G    ++        W+ +++L + GKAK +GVSNF + +L+
Sbjct: 145 ------------IEKEKNGVTLEEV--------WKDLEKLYEAGKAKNIGVSNFRVEDLQ 184

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKEP- 233
            +L  K  K+ P  NQ+E H  L QN+   ++ F +   I +E Y+PLG    PL ++  
Sbjct: 185 RIL--KVAKVKPQVNQIEFHVFL-QNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQS 237

Query: 234 -------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFT--LSDED 284
                   + E+AKK     A V++ W  +R  + +  S  P R++A + +F+  L+DE+
Sbjct: 238 DAGDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEE 297

Query: 285 FEAI 288
            + I
Sbjct: 298 VKKI 301

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (306), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/313 (29%), Positives = 145/313 (46%), Gaps = 64/313 (20%)

Query: 15  NTGAQIPQVGLGT---WQSKDNDA----------YKSVLAALKDGYRHIDTAAIYRNEDQ 61
            T   IP +G GT   W+    +              ++ A+  G+ HIDTA  Y   ++
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGQAIRDSGVPREKIFVT--------TKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHW 113
           VG+A+R S +PR+K+F+T        T L C+    P +A  + L  LG+ Y DLY++H 
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSG---PIQAAKKGLEALGIKYFDLYMLH- 128

Query: 114 PVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSI 173
                PD  K+            +  +D+      + W  ++EL + G AKA+GVSNF +
Sbjct: 129 ----RPDITKE------------NAGIDLQ-----EAWRQVEELYEAGIAKAIGVSNFPL 167

Query: 174 NNLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLL 230
             LK +      +  P  +QVE HP L QN+   ++++C+ K I++E YSPL    APL 
Sbjct: 168 ETLKQM--ESYCRYLPMVHQVEFHPYL-QNQSPGVVEWCQNKHIVVEAYSPL----APLF 220

Query: 231 K------EPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKA--NRKIFTLSD 282
           +      + ++  + KK       +V+ W   RG V L  S   +R+        F L  
Sbjct: 221 RARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEK 280

Query: 283 EDFEAINGISKAK 295
            D E IN +   K
Sbjct: 281 SDVELINEVGSKK 293

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  118 bits (295), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 146/307 (47%), Gaps = 53/307 (17%)

Query: 12  LSLNTGAQIPQV---GLGT-W---QSKDNDAYKSVLAALK-----DGYRHIDTAAIYRNE 59
           ++LN G ++P V   G GT W   + KD+     ++  L+      G  HID A +Y   
Sbjct: 8   VTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTK--LWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWP--V 115
            ++  A+R +  PR +IF+T K  L      +P   L+ SL+   LDYVDLYL+H P   
Sbjct: 68  PELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSPFVA 127

Query: 116 RLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINN 175
           +  P    +G                         W  M++L K GKAK +GVSNFS+ +
Sbjct: 128 KEKPGLTLEG------------------------AWRQMEQLYKDGKAKNIGVSNFSVED 163

Query: 176 LKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLGSTDAPLLKE 232
           LK +L+    ++ P  NQ+E HP L QN+   ++ FC+ + I +E ++PLG       ++
Sbjct: 164 LKRVLSVA--EIKPQVNQIEFHPFL-QNQTPGILKFCQDENIELEAFTPLGPLQVKTQED 220

Query: 233 P------VILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFE 286
                   I  ++ K     A +++ W  +RG + +  S   DR+   + +F    ED E
Sbjct: 221 ENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLED-E 279

Query: 287 AINGISK 293
            +  I++
Sbjct: 280 EVTKITR 286

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  116 bits (291), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 158/322 (49%), Gaps = 53/322 (16%)

Query: 12  LSLNTGAQIPQV---GLGT--WQSKDNDA------YKSVLAALK-DGYRHIDTAAIYRNE 59
            +LN G +IP V   G GT  ++ ++ DA       K +  AL   G  H+D A +YR  
Sbjct: 8   FTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTY 67

Query: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQH--HEPAKALDQSLRRLGLDYVDLYLMHWPVRL 117
            +  +A++++  PR +IFVT K    +   ++P + LD  L+R GL+YVDLYL+H P   
Sbjct: 68  PEFSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFA- 126

Query: 118 DPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLK 177
                K+ N  ++                  + W  ++EL   GKAK +GVSNF + +L+
Sbjct: 127 ----SKEKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDLE 165

Query: 178 DLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPLG---STDAPLLK 231
            +L  K  K+ P  NQ+E    L QN+   ++ F +   I +E Y+PLG     D     
Sbjct: 166 KIL--KVAKVKPQVNQIEFSAFL-QNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQA 222

Query: 232 EPV---ILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFE 286
           +P    I ++ +K +   A +++ W ++RG + +  S  P R++  + +  F L+ ++ +
Sbjct: 223 KPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVD 282

Query: 287 AINGISKAKGEKRVVHPNWSPF 308
            I  +  A    R+    W+P 
Sbjct: 283 EITKLGLAHPALRLY---WNPL 301

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  115 bits (288), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 101/316 (31%), Positives = 155/316 (49%), Gaps = 62/316 (19%)

Query: 8   STRTLSLNTGAQIP---QVGLGTWQSKD---NDAYKSVLAALKD-----GYRHIDTAAIY 56
           + R  +LN G  IP    VG+G   +K     D  K+++  LK+     G+ HI TA  Y
Sbjct: 5   TKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFY 64

Query: 57  RNEDQVGQAIRDSGVPREKIFVTTKLWCTQ---HHEPAKALDQSLRRLGLDYVDLYLMHW 113
            N   +  A++ S  PR +I++T K +C+Q      P +AL++SL RLG DYVDLYL+H 
Sbjct: 65  PNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHN 123

Query: 114 PVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSI 173
           P  LD       N +S+                  K W+ M+ L KTGK K +GVSNF I
Sbjct: 124 PC-LD----SSPNGISLE-----------------KAWKQMELLYKTGKVKNIGVSNFRI 161

Query: 174 NNLKDLLASKGNKLTPAANQVEIHPLLPQNE---LIDFCRGKGIMIEGYSPL-------- 222
            +L+ L   K  ++ P  N++E H  L QN+   + ++ +   +++ GYSPL        
Sbjct: 162 EDLERL---KDAEIKPQVNEIEFHAFL-QNQTPNIYEYAKTHDLLLCGYSPLFPLETKTE 217

Query: 223 GSTDAPLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI----- 277
              D P  +   I+ +A+K N   A +++ W    G  VLP   N  +VK  ++      
Sbjct: 218 DFMDFPFYR--YIIGLAEKYNKTEAQILLHWMNCLG--VLPVITN-TKVKWYKEASDIIS 272

Query: 278 FTLSDEDFEAINGISK 293
           F L+ E+ + I  + K
Sbjct: 273 FELTSEELDMITELGK 288

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 80.1 bits (196), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (60%), Gaps = 6/89 (6%)

Query: 14  LNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIR----DS 69
           LN G QIP +G G ++    D    V +ALKDGYRHIDTA +YRN+ +  Q +R    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLDET 74

Query: 70  GVPREKIFVTTKLWCTQ--HHEPAKALDQ 96
           G  RE I+ TTKLW +Q    E  KAL +
Sbjct: 75  GEARENIWFTTKLWDSQFGREETKKALQE 103

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 32/180 (17%)

Query: 50  IDTAA--IYRNE-DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKAL--DQSLRRLGLD 104
           ID AA  IY+    +VG+A+  +  P+ +IF+T K           A+  D +L+++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 105 YVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAK 164
           YVD++ +H P        K  N+L+                  +K       L ++ KA 
Sbjct: 67  YVDMHFLHSPF-----VFKQANVLN------------------LKDAMHTDHLRRSNKAN 103

Query: 165 AVGVSNFSINNLKDLLASKGNKLTPAANQVEIHPLLPQNE--LIDFCRGKGIMIEGYSPL 222
             G S+ ++  L+ +L ++  +  P  NQ+++   L      +   C+   I++  YS L
Sbjct: 104 NRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 72/332 (21%), Positives = 123/332 (37%), Gaps = 102/332 (30%)

Query: 15  NTGAQIPQ--VGLGTWQSKD---------NDAYKSVLAALKDGYRHIDTAAIYRN---ED 60
           NTG +I    VG  ++ SKD         N+ +K +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 61  QVGQAIRDSGVPREKIFVTTKLWC--------TQHHEPA--------------------K 92
            +G+ +++  +PRE + + TK+W          Q   P                     +
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE 130

Query: 93  ALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWE 152
           A   S+RRLG  Y+D+Y +H   R D D          P ++               T  
Sbjct: 131 ACKNSVRRLG-TYIDVYQIH---RADQD---------TPMEE---------------TMR 162

Query: 153 LMQELPKTGKAKAVGVSNFSINNLKDL-LASKGNKLTPAANQVEIHPLL---PQNELIDF 208
            + ++ + G  + +G S+       +    ++ N  +   N  + + LL    + E+I +
Sbjct: 163 ALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPY 222

Query: 209 CRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNNVQPAHVVISWHAQRGYVVLPKSVNP 268
            +  GI    +SPL      LL  PV +   +++N                         
Sbjct: 223 IKKHGIAQTPWSPL---QRGLLSRPVEVSSYREDN------------------------- 254

Query: 269 DRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300
           DRV   R++    D + E IN + +   +K +
Sbjct: 255 DRVLKGRRLNQYEDFEIEIINRVEQVAVKKGI 286

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 88/205 (42%), Gaps = 40/205 (19%)

Query: 27  TWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRDSGVPREKIFVTTKL---- 82
           T+    N     ++  LK G + IDTA IY + ++   AI +  +P ++  + TK     
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNEK---AIGELQLP-DRFTIHTKASGFS 64

Query: 83  -WCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVD 141
             C       K++++SL  LG+  V+ +L+H P   DP+         +P ++       
Sbjct: 65  GGCLTRDNINKSIEESLSLLGVPSVETFLLHSP---DPE---------IPLEE------- 105

Query: 142 ITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL--LASKGNKLTPAANQVEIHPL 199
                   T + +  L + GK +  G+SNFS  ++K +   A   + + P   Q   + L
Sbjct: 106 --------TLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNAL 157

Query: 200 LPQ--NELIDFCRGKGIMIEGYSPL 222
                N+L    +   I +  YSP+
Sbjct: 158 SRAIVNDLFPLLKELHISLYAYSPI 182

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 116/329 (35%), Gaps = 100/329 (30%)

Query: 15  NTGAQIPQVGLGT----------WQSKDNDA-YKSVLAALKDGYRHIDTAAIYRN---ED 60
           NTG ++  + +G           W   D +  +K +  A   G R  DTA +Y N   E 
Sbjct: 11  NTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEI 70

Query: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHE---------PAKALDQ--------------- 96
            +G+ +++  +PRE + + TKL+   +           P   L+                
Sbjct: 71  ILGEFLKNYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSA 130

Query: 97  --SLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELM 154
             S+RRLG  Y D+  +H   R DPD          P               F +T   +
Sbjct: 131 RDSVRRLG-TYADIIQIH---RADPD---------TP---------------FEETMRAL 162

Query: 155 QELPKTGKAKAVGVSNFSINNLKDL-LASKGNKLTPAANQVEIHPLL---PQNELIDFCR 210
            ++   G  + +G S+       ++   ++ N      N    + LL    + ELI F +
Sbjct: 163 NDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAK 222

Query: 211 GKGIMIEGYSPL---------GSTDAPLLKEPV-------------------ILEIAKKN 242
              I +  +SPL         G T     K+                     + EIAKK 
Sbjct: 223 RHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKR 282

Query: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRV 271
           N + A V + W  Q+G   +      DR+
Sbjct: 283 NTKMATVALYWVIQKGCFPIVGMSKIDRI 311

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 117/292 (40%), Gaps = 68/292 (23%)

Query: 23  VGLGTWQSKD---------NDAYKSVLAALKDGYRHIDTAAIYRN---EDQVGQAIRDSG 70
           VG  T+ SK+          + +K +     +G R  DTA +Y N   E  +G+ ++   
Sbjct: 21  VGCMTYGSKNWANWVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFN 80

Query: 71  VPREKIFVTTKLW-----CTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDG 125
           + RE + + +K++         H+ +K +DQ       +Y+DL L  +   L+  +I  G
Sbjct: 81  IKRETVVIMSKIFFPVDESLDLHQGSK-VDQ-------EYIDLQL-SFQQGLNRKHIMAG 131

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKT-------GKAKAVGVSNFSINNLKD 178
              SV   +     +DI   + +     M+E+ ++       G+ + +G S+       +
Sbjct: 132 VANSV---ERLGTYIDILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAE 188

Query: 179 L-LASKGNKLTPAANQVEIHPLL---PQNELIDFCRGKGIMIEGYS---------PLGST 225
           L   +K N      N    + +L    +NELI FC+  G+ +  +S         P   T
Sbjct: 189 LQFIAKQNGWFQFINVQSYYNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKT 248

Query: 226 DAPLLKEP-------------------VILEIAKKNNVQPAHVVISWHAQRG 258
              +L +P                   V+  IAKK  +  A V ++W   +G
Sbjct: 249 GTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKG 300

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 123/323 (38%), Gaps = 93/323 (28%)

Query: 28  WQSKDNDAYKSVLAALKD-GYRHIDTAAIYRN---EDQVGQAIRDSGVPREKIFVTTKLW 83
           W   D +    +L    D G R  DTA +Y N   E  +G+ +R   +PRE + + TK++
Sbjct: 34  WVLDDKEEIFGILKHAYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVF 93

Query: 84  -----------------------CTQHHEPAK----ALDQSLRRLGLDYVDLYLMHWPVR 116
                                    Q H   K    A+  S++RLG  Y+D+Y +H   R
Sbjct: 94  FPVDDKMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH---R 149

Query: 117 LDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNL 176
            D +          P               F +T   + ++ + G  + +G S+      
Sbjct: 150 CDHE---------TP---------------FEETMRALNDVVEQGDVRYLGASSMLAVEF 185

Query: 177 KDL-LASKGNKLTPAANQVEIHPLL---PQNELIDFCRGKGIMIEGYSPLG--------- 223
            ++   ++ +      N    + L+    + E+I FC+  GI +  +SP+          
Sbjct: 186 AEMQFIAEKHGWHKFVNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLG 245

Query: 224 ------STDAPLL-----------KEPV--ILEIAKKNNVQPAHVVISWHAQRGYVVLPK 264
                 STD  L+           KE +  + ++A K N++   + + W  Q+G + +  
Sbjct: 246 SHTHRESTDGVLIARKLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILG 305

Query: 265 SVNPDRVKANRKIFT--LSDEDF 285
             + +RV    K  T  L+++D 
Sbjct: 306 MSSIERVDEAIKTLTTKLTEDDM 328

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 96/266 (36%), Gaps = 70/266 (26%)

Query: 73  REKIFVTTK----LWCTQHHEPAKALDQSLR---RLGLDYVDLYLMHWPVRLDPDYIKDG 125
           REK+ ++ K    L        AK++  S+    ++   YVD+Y    P RLD + IK  
Sbjct: 81  REKVIISAKGAVDLQTLSPAGDAKSVSASIENTLKVFNGYVDIY---EPARLDLELIKKT 137

Query: 126 NILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGN 185
                P +                T++ + E  K GK   + +S  +   ++ +    G 
Sbjct: 138 GESVFPRE----------------TFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGE 181

Query: 186 KLTPAANQVEIHPL-LPQNELIDFCRGKGIMIEGYSPLG----------STDAP------ 228
            L     ++ +    +  N ++D C   G+ I  YSPLG          S+D P      
Sbjct: 182 YLVCVEVELSMFSAEILSNGIVDTCNELGLPIVAYSPLGRGLLTGALAKSSDIPAGDFRI 241

Query: 229 ------------------LLKEPVILEIAKKNNVQPAHVVISW-------HAQRGYVVLP 263
                              L+  +I +  + +NV    V I W       +     + +P
Sbjct: 242 QLKRFQDDAFAHNKSLVEFLENEIIAK--RSDNVTLPQVAIGWIRAISKNYPNTKIIPIP 299

Query: 264 KSVNPDRVKANRKIFTLSDEDFEAIN 289
                D+V +N     LSDE+   I+
Sbjct: 300 SGTTVDKVTSNYSFIELSDEELAKID 325

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
          (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 14/82 (17%)

Query: 15 NTGAQIPQVGLG-------TW----QSKDNDAYKSVLAALKDGYRHIDTAAIYRN---ED 60
          NTG ++  + +G       TW    Q    +A+K +  A   G R  DTA +Y N   E 
Sbjct: 11 NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61 QVGQAIRDSGVPREKIFVTTKL 82
           +G+ +R   +PRE + + TKL
Sbjct: 71 ILGEFLRKYNIPRETVVIMTKL 92

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 42/207 (20%)

Query: 25  LGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAIRDSGVPREKIFVTTKL-- 82
           L   Q  D D   ++L   K G + IDTA IY + +++   I +  +P  +  + TK   
Sbjct: 14  LNLLQRSDIDEISAILE--KAGVKDIDTARIYPDSEKI---IGELQLPN-RFTIHTKASG 67

Query: 83  ---WCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRA 139
               C       K++++SL  LG+  V+ + +H P   DP+          P ++     
Sbjct: 68  FSGGCLTKDNINKSIEESLSLLGVPSVETFFLHSP---DPE---------TPIEE----- 110

Query: 140 VDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL--LASKGNKLTPAANQVEIH 197
                     T   +  L + GK K  G+SNF+  ++K +   A   N + P   Q   +
Sbjct: 111 ----------TLGAINSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYN 160

Query: 198 PL--LPQNELIDFCRGKGIMIEGYSPL 222
                 +N+L    R        YSP+
Sbjct: 161 AFSRAIENDLFPLLRELHFSFYAYSPI 187

>AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR127W
          Length = 341

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 92/242 (38%), Gaps = 66/242 (27%)

Query: 92  KALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTW 151
           K++D  LR +G  Y+D++      R DP  +  G +          RA          + 
Sbjct: 107 KSMDNCLREIG-GYIDIFEC---ARFDPKAVAPGELYP--------RA----------SI 144

Query: 152 ELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLTPAANQVEIHPL---LPQNELIDF 208
           E + E  K GK  A+G+S  +   ++ +    G  L  A  +VE   L   +  N L   
Sbjct: 145 EAVVEYVKAGKIGAIGLSEVTAEQVRAISRDYGEYL--ACVEVEFSMLSRDILHNGLAQT 202

Query: 209 CRGKGIMIEGYSPLG--------ST--DAPLLKEPVIL----EIAKKNNVQPA-----HV 249
           C   GI I  YSPL         ST  D P      +L      A  NN+Q A     H+
Sbjct: 203 CAELGIPILCYSPLARGLLTNAISTPDDVPAGDLRRLLARFGHDALANNLQAATFLQEHI 262

Query: 250 -----------------VISW---HAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAIN 289
                            + SW   H    ++ +P +  P RV+ +  I  L+ E+ ++IN
Sbjct: 263 IKPRAPPPPLPAVALAWIRSWSGTHKGTHFLPIPGATTPQRVEESLSICELTPEELDSIN 322

Query: 290 GI 291
             
Sbjct: 323 AF 324

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 95/256 (37%), Gaps = 76/256 (29%)

Query: 15  NTGAQIPQVGLGT--WQSKDN---------DAYKSVLAALKDGYRHIDTAAIYRN---ED 60
           NTG +I     GT  + +K N         DAYK +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  QVGQAIRDSGVPREKIFVTTKLWC----TQHHEPA------------------------- 91
            +G  ++   +PRE + + TK++     T    P                          
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 92  -KALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKT 150
            +A   S+RRLG  Y+D+Y +H   R D +          P               F +T
Sbjct: 131 LEAAKNSVRRLG-TYIDVYQIH---RCDHE---------TP---------------FEET 162

Query: 151 WELMQELPKTGKAKAVGVSNFSINNLKDL-LASKGNKLTPAANQVEIHPLL---PQNELI 206
              + ++ + G A+ +G S+       +    ++ +      N    + LL    + E++
Sbjct: 163 MRALNDVVEQGYARYIGASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREML 222

Query: 207 DFCRGKGIMIEGYSPL 222
            FC+   + I  +SPL
Sbjct: 223 PFCKKNNVAITPWSPL 238

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 90/236 (38%), Gaps = 67/236 (28%)

Query: 35  AYKSVLAALKDGYRHIDTAAIYRNEDQ----VGQAIRDSGVPREKIFVTTKLWC------ 84
           +YK +  A   G R  DTA +Y N       +G+ +++  + RE + + TKL+       
Sbjct: 19  SYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVIMTKLFAPVDDTL 78

Query: 85  -------------TQHHEPAKALDQ---------SLRRLGLDYVDLYLMHWPVRLDPDYI 122
                        T H    + L +         SLRRLG  Y+D+Y +H   R DPD  
Sbjct: 79  PDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLG-TYIDVYQVH---RADPD-- 132

Query: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDL-LA 181
                   P ++               T   + ++ + G  + +G S+       +    
Sbjct: 133 -------TPMEE---------------TMRALNDVVQQGLTRYIGASSMLGTKFAEYQFI 170

Query: 182 SKGNKLTPAANQVEIHPLL---PQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234
           ++ N  +   N  + + LL    + E+I + +  GI    +SPL      LL  PV
Sbjct: 171 AEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGLLSRPV 223

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 44/220 (20%)

Query: 28  WQSKDNDAYKSVLAALKD-GYRHIDTAAIYRN---EDQVGQAIRDSGVPREKIFVTTKLW 83
           W  +D D    +L    D G R  DTA +Y N   E  VG+ ++   + RE + + TK++
Sbjct: 34  WVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF 93

Query: 84  ------CTQHH-----EPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPT 132
                    HH     + A  L  +L+R                L   +I DG   SV  
Sbjct: 94  FPVDESLDLHHGSNVNQEAMELQLTLQR---------------GLSRKHIIDGVANSV-- 136

Query: 133 KQDGSRAVDITNWNFIKTWELMQELPKT-------GKAKAVGVSNFSINNLKDL--LASK 183
            +     +D+   + +     M+E+ ++       G+ + +G S+       +L  +A K
Sbjct: 137 -ERLGTYIDVLQIHRLDEETSMEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEK 195

Query: 184 GN--KLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSP 221
               K   A +   +     + ELI FC+  G+ +  +SP
Sbjct: 196 NGWFKFISAQSYYNLINREDERELIPFCKKHGVGLIPWSP 235

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKDGYRHIDTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL--------- 82
           A++ + A  + G   IDTA  Y+NE+    +G+ ++   + R++I + TK          
Sbjct: 9   AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEV 67

Query: 83  -------WCTQH-HEPAKALDQSLRRLGLDYVDLYLMHW 113
                  +C  H H    ++  SLR+L  D++D+  +HW
Sbjct: 68  GGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 73/181 (40%), Gaps = 51/181 (28%)

Query: 42  ALKDGYRHIDTAAIYR-NEDQVGQAIRD--SGVPREKIFVTTKLWCTQHHE-------PA 91
           A+  G   IDT+  Y  +E   G+A+++     PRE+ F+ TK+      E         
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  KALDQSLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTW 151
            ++ +S  RL  DY+DL  +H                            DI    + K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKIW 141

Query: 152 ELMQELPK---TGKAKAVGVSNFSINNLKDLLASKGNKLTPAANQVEIHPLLPQNELIDF 208
           E ++EL K    G  + +G+S + ++ L  L  SK     P     EI PL   + ++ +
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLSY 191

Query: 209 C 209
           C
Sbjct: 192 C 192

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 32/143 (22%)

Query: 2   PATLQDSTRTLSLNTGAQIPQVGLGTWQSKD-----------NDAYKSVLAALKDGYRHI 50
           P T     R LS   G ++  + LG     D             A++ + A  + G   I
Sbjct: 11  PPTELGRLRVLSKTAGIRVSPLILGGMSIGDAWSGFMGSMNKERAFELLDAFFEAGGNFI 70

Query: 51  DTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL----------------WCTQH-HEP 90
           DTA  Y+NE     +G+ +    + R++I + TK                 +C  H H  
Sbjct: 71  DTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYEVGKGRSANFCGNHKHSL 129

Query: 91  AKALDQSLRRLGLDYVDLYLMHW 113
             ++  SLR+L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYVHW 152

>ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} similar
          to uniprot|Q02895 Saccharomyces cerevisiae YPL088W
          Putative aryl alcohol dehydrogenase transcription is
          activated by paralogous transcription factors Yrm1p and
          Yrr1p along with genes involved in multidrug resistance
          Length = 343

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 14/83 (16%)

Query: 15 NTGAQIPQVGLGT----------WQSKDNDAYKSVLAALKD-GYRHIDTAAIYRN---ED 60
          NTG +I  + +G           W  +D     S+L    D G R  DTA +Y N   E 
Sbjct: 12 NTGLKISPILVGCMSYGSKSWSEWVVEDKQRIFSILKHCYDRGLRTFDTADVYSNGMSER 71

Query: 61 QVGQAIRDSGVPREKIFVTTKLW 83
           VG+ +R   + RE + + TK++
Sbjct: 72 LVGEFLRHYNINRETVVILTKVY 94

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 70/162 (43%), Gaps = 33/162 (20%)

Query: 37  KSVLAALKDGYRHIDTAAIYRN-EDQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALD 95
           +  L   +  +  +DT+  Y + E  VGQA+R+  +PR +I+V TK+             
Sbjct: 31  RKCLITHRRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVG------------ 78

Query: 96  QSLRRLG---LDY----VDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDIT-NWNF 147
               R+G    DY    V + +M    RL    + +G  L V    D    V+       
Sbjct: 79  ----RVGVSEFDYSRENVRMSVMRSVERL----VGEGGYLDVVYLHD----VEFQPQEAC 126

Query: 148 IKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLTP 189
           +   + +Q+L + G  + VGVS + ++ L  L++   +  TP
Sbjct: 127 LAALDELQKLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTP 168

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 35  AYKSVLAALKDGYRHIDTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL--------- 82
           A+K + A  + G   IDTA  Y+NE     +G+ +    + R++I + TK          
Sbjct: 55  AFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDV 113

Query: 83  -------WC-TQHHEPAKALDQSLRRLGLDYVDLYLMHW 113
                  +C    H    ++  SLR+L  D++D+  +HW
Sbjct: 114 GKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 58/143 (40%), Gaps = 32/143 (22%)

Query: 2   PATLQDSTRTLSLNTGAQIPQVGLG------TWQS-----KDNDAYKSVLAALKDGYRHI 50
           P T     R LS   G ++  + LG       W           A++ + A  + G   I
Sbjct: 11  PPTELGRLRVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCI 70

Query: 51  DTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL----------------WCTQHHEPA 91
           DTA  Y+NE+    +G+ +    + R++I + TK                 +C  H    
Sbjct: 71  DTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSL 129

Query: 92  K-ALDQSLRRLGLDYVDLYLMHW 113
             ++  SLR+L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYIHW 152

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 60/145 (41%), Gaps = 36/145 (24%)

Query: 2   PATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAAL-------------KDGYR 48
           P+T     R LS + G ++  + LG       DA+  +L ++             + G  
Sbjct: 11  PSTELGRLRVLSKSAGIRVSPLILGG--MSIGDAWSEILGSMSKERAFELLDAFYEAGGN 68

Query: 49  HIDTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL----------------WCTQHHE 89
            IDTA  Y+NE     +G+ +    + R++I + TK                 +C  H  
Sbjct: 69  FIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDVGGGKSANYCGNHKR 127

Query: 90  PAK-ALDQSLRRLGLDYVDLYLMHW 113
               ++  SLR+L  D++D+  +HW
Sbjct: 128 SLHVSVRDSLRKLQTDWIDILYVHW 152

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 41  AALKDGYRHIDTAAIYRN-EDQVGQAIRDSG--VPREKIFVTTKL-------WCTQHHEP 90
            A ++G   IDT+  Y N E  +G+A+ + G   PR+   + TK+       +       
Sbjct: 32  VAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNV 91

Query: 91  AKALDQSLRRLGLDYVDLYLMH 112
            +++ +S +RL  DY+DL  +H
Sbjct: 92  RRSVVRSCKRLNSDYLDLVYLH 113

>KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]
           {ON} similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W Hypothetical ORF
          Length = 338

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 149 KTWELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLTPAANQVEI-HPLLPQNELID 207
           +T+E + E  K G    + +S  +   ++ + A  G  +     +  + HP +  N ++D
Sbjct: 141 ETFETLVEYIKKGSLGGLSLSEVNAEQIRAIHAKYGEYICCVEVEFSLYHPEILTNGIVD 200

Query: 208 FCRGKGIMIEGYSPL 222
            C   GI I  YSPL
Sbjct: 201 ACNELGIPIVCYSPL 215

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 59/143 (41%), Gaps = 32/143 (22%)

Query: 2   PATLQDSTRTLSLNTGAQIPQVGLG------TWQS-----KDNDAYKSVLAALKDGYRHI 50
           P T     R LS + G ++  + LG       W           A++ + A  + G   +
Sbjct: 11  PPTELGRLRVLSKSAGIRVSPLILGGASIGNAWSEFMGAMNKEQAFELLDAFYEAGGNCV 70

Query: 51  DTAAIYRNEDQ---VGQAIRDSGVPREKIFVTTKL----------------WCTQHHEPA 91
           DTA  Y+NE     +G+ ++   V R++I + TK                 +C  H    
Sbjct: 71  DTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSANYCGNHRRSL 129

Query: 92  K-ALDQSLRRLGLDYVDLYLMHW 113
             ++  SLR+L  D++D+  +HW
Sbjct: 130 HVSVRDSLRKLQTDWIDILYIHW 152

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 15 NTGAQIPQVGLGT-------WQSKDND----AYKSVLAALKDGYRHIDTAAIYRN---ED 60
          NTG +I  + +G        WQ+   D    A+K +      G R  DTA +Y N   E 
Sbjct: 11 NTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESEK 70

Query: 61 QVGQAIRDSGVPREKIFVTTKLW 83
           +G+ ++   + RE + + TK++
Sbjct: 71 FLGEFLKRYNIRRETVVILTKVY 93

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 30.4 bits (67), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 253 WHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEA 287
           W   +G+VVL KS NP+R++ N  +    D+ ++ 
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLPSKDDSWKV 36

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 75/183 (40%), Gaps = 38/183 (20%)

Query: 48  RHIDTAAIYRNEDQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRR----LGL 103
             +DTA IY   ++   AI    +P+  I  T      +     +++++S+      LG+
Sbjct: 35  EELDTARIYPGSEE---AIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGV 91

Query: 104 DYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKA 163
           + V+++ +H P   DP         + P ++               T + +  L K GK 
Sbjct: 92  ESVEIFYLHCP---DP---------ATPLEE---------------TLDAIDALYKEGKF 124

Query: 164 KAVGVSNFSINNLKDLLASKGNK--LTPAANQVEIHPLLPQNE--LIDFCRGKGIMIEGY 219
           K  GVSNFS  +++ + +    K  + P   Q   + +  + E  L    R  G+    Y
Sbjct: 125 KKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLRELGLSFYAY 184

Query: 220 SPL 222
           SP+
Sbjct: 185 SPI 187

>TBLA0F00680 Chr6 (175497..176135) [639 bp, 212 aa] {ON} 
          Length = 212

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 64/211 (30%)

Query: 57  RNEDQVGQAIRDSGVPREKIFVTTKLW----------------CTQ----HHEPAKALDQ 96
           R+E  +G+ +++  +PRE + + +K++                 T+    H    K L +
Sbjct: 6   RSELILGEFLKEYKIPRETVVILSKVYNPVDDTVPAFRPGVNPFTEDEKLHFANQKGLSR 65

Query: 97  ---------SLRRLGLDYVDLYLMHWPVRLDPDYIKDGNILSVPTKQDGSRAVDITNWNF 147
                    S+RRLG  Y+D+Y +H   R DPD          P ++             
Sbjct: 66  KHIIDACKNSVRRLG-TYIDVYQIH---RADPD---------TPIEE------------- 99

Query: 148 IKTWELMQELPKTGKAKAVGVSNFSINNLKDL-LASKGNKLTPAANQVEIHPLL---PQN 203
             T   + ++ + G  + +G S+       +    ++ N  +   N  + + LL    + 
Sbjct: 100 --TMRALNDVVQEGLTRYIGASSMLATEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEER 157

Query: 204 ELIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234
           E+I F +  GI +  +SPL      LL  PV
Sbjct: 158 EMIPFVKKHGITLTPWSPLQRG---LLTRPV 185

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 15  NTGAQIPQVGLGT----------WQSKD-NDAYKSVLAALKDGYRHIDTAAIYRN---ED 60
           NTG +I  + +G           W  +D  + +K +  A   G R  DTA +Y N   E 
Sbjct: 48  NTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSER 107

Query: 61  QVGQAIRDSGVPREKIFVTTKLW 83
            +G+ +R   + RE + + TK++
Sbjct: 108 ILGEFLRHYNINRETVVILTKVF 130

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 32/143 (22%)

Query: 2   PATLQDSTRTLSLNTGAQIPQVGLGT------WQ----SKDNDAYKSVLAALKD-GYRHI 50
           P T     R LS N G ++  + LG       W+    S D      +L A  + G   I
Sbjct: 11  PPTELGRLRILSKNAGIRVSPLVLGAMSIGDAWEETLGSMDKQRSFELLDAFYEAGGNFI 70

Query: 51  DTAAIYRN---EDQVGQAIRDSGVPREKIFVTTKL----------------WCTQHHEPA 91
           DTA  Y+N   E+ +G+ +    + R++I + TK                 +   H    
Sbjct: 71  DTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFSGNHRRSL 129

Query: 92  K-ALDQSLRRLGLDYVDLYLMHW 113
           + ++  SLR+L  D++D+  +HW
Sbjct: 130 QLSVRDSLRKLQTDWIDILYVHW 152

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
          {ON} 
          Length = 344

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query: 12 LSLNTGAQIPQVGLGT----------WQSKDNDAYKSVLAALKD-GYRHIDTAAIYRNED 60
          L  N+G +I  + +G           W  +D +   S+L    D G R  DTA +Y N  
Sbjct: 11 LGKNSGLKISPILVGCMSYGCKQWAEWVLEDKEKIFSILKHCYDHGLRTFDTADVYSNGA 70

Query: 61 Q---VGQAIRDSGVPREKIFVTTKLW 83
              VG+ ++   + RE + + TKL+
Sbjct: 71 SGRLVGEFLKKYNIDRETVVILTKLF 96

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 18/112 (16%)

Query: 19  QIPQVGLG--TWQSKDNDAYKSV------LAALKDGYRHIDTAAIYRNEDQV-GQAIRDS 69
            +P + LG  T  S+ ND   S+        A ++G   IDT+  Y + + + G+A++  
Sbjct: 19  NLPNLILGGATLSSQYNDDPNSIPIADMIRFAFRNGITAIDTSPYYGDSEIIYGKALKSI 78

Query: 70  GV--PREKIFVTTKLWCTQHHE-------PAKALDQSLRRLGLDYVDLYLMH 112
            +  PR+  F+ TK+     +E         K++ +S +RL  +Y+D+  +H
Sbjct: 79  KIEFPRDTYFICTKVGRIGSNEFDYSANNVRKSILRSCKRLNTNYLDVVYLH 130

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON}
          highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 344

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 23 VGLGTWQSKD-----NDAYKSVLAALKDGYRH----IDTAAIYRN---EDQVGQAIRDSG 70
          +G  ++ SKD      D  + + + LK  Y H     DTA  Y N   E  VG+ ++   
Sbjct: 21 IGCMSYGSKDWAAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKYN 80

Query: 71 VPREKIFVTTKLW 83
          + RE + + TK++
Sbjct: 81 IRRETVVILTKVY 93

>Skud_3.183 Chr3 (296810..296845,296849..297115,297116..297466) [654
           bp, 217 aa] {ON} YCR107W (REAL)
          Length = 217

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 22/96 (22%)

Query: 39  VLAALKDGYRHIDTAAIYRNE---DQVGQAIRDSGVPREKIFVTTKL------------- 82
           +L A  +    ID A  Y NE   + +G+  +   + REKI + TK              
Sbjct: 4   LLDAFYEACNFIDAANNYENEQWEEWIGEWTKSRKL-REKIVICTKYAGDYKKCEADEGK 62

Query: 83  ---WCTQH--HEPAKALDQSLRRLGLDYVDLYLMHW 113
              +C  H  H    ++  SL +L  D++D+  +HW
Sbjct: 63  SANYCGYHQKHSLHVSVRDSLHKLQTDWIDILYVHW 98

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 16/99 (16%)

Query: 29  QSKDNDAYKSVLAALKDGYRH----IDTAAIYR-NEDQVGQA---IRDSGVPREKIFVTT 80
           Q  D+     ++  LK G+ H    IDT+  Y  +E   GQA   IRD   PR   ++ T
Sbjct: 32  QYNDDPTKVPLVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICT 90

Query: 81  KLWCTQHHEPAKALD-------QSLRRLGLDYVDLYLMH 112
           K+   Q  E   + +       +S +RL  DY+DL  +H
Sbjct: 91  KVGRIQLDEFDYSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 15/73 (20%)

Query: 151 WELMQELPKTGKAKAVGVSNFSINNLKDLLASKGNKLTPAANQV---------------E 195
           W  ++E    GK K + + NF INN+K       NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 196 IHPLLPQNELIDF 208
           + PL+P  E++ +
Sbjct: 351 LLPLIPDFEILSY 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,522,803
Number of extensions: 1530186
Number of successful extensions: 4047
Number of sequences better than 10.0: 157
Number of HSP's gapped: 3779
Number of HSP's successfully gapped: 159
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)