Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2825.432ON48539921440.0
Smik_15.2975.432ON48639920490.0
YOR119C (RIO1)5.432ON48439920290.0
Suva_8.1725.432ON48639920140.0
NCAS0F033605.432ON50943216370.0
SAKL0G02486g5.432ON50040016360.0
Kpol_1062.315.432ON51342616360.0
KAFR0E039205.432ON49741316320.0
CAGL0L11594g5.432ON50741115910.0
Kwal_55.214335.432ON47640015880.0
KNAG0C049305.432ON49641015860.0
KLTH0F16104g5.432ON54039815840.0
TPHA0E017805.432ON50842015800.0
TDEL0E019305.432ON50238915770.0
KLLA0E21121g5.432ON52642215660.0
TBLA0A037605.432ON50441015640.0
AER257W5.432ON47739815360.0
NDAI0B056505.432ON46238215160.0
Ecym_47635.432ON53841614860.0
ZYRO0F09988g5.432ON46039413660.0
CAGL0H08019g2.44ON4252341373e-08
TPHA0H009202.44ON4292351302e-07
NCAS0G015802.44ON4242321284e-07
Smik_14.1252.44ON4202321251e-06
Suva_14.1362.44ON4262321241e-06
KNAG0F010602.44ON4282361222e-06
NDAI0F036002.44ON4212331223e-06
KAFR0A077602.44ON4252321204e-06
ZYRO0C10340g2.44ON4162331196e-06
TDEL0A008602.44ON4192331152e-05
Ecym_64492.44ON4172341116e-05
Skud_14.1292.44ON4252321116e-05
KLTH0B07722g2.44ON4282361107e-05
Kwal_23.45632.44ON4252531098e-05
Kpol_400.72.44ON4252321072e-04
SAKL0E13552g2.44ON4192321072e-04
YNL207W (RIO2)2.44ON4252331062e-04
ABL166W2.44ON4142361044e-04
KLLA0D19008g2.44ON4222351026e-04
Ecym_11191.104ON79149761.1
YPR171W (BSP1)7.527ON57691761.1
KLLA0F15576g5.200ON51251732.5
Kpol_1029.172.199ON133460732.6
Suva_14.3856.341ON1581190714.3
Smik_14.3606.341ON1583190689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.282
         (485 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   830   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   793   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   786   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   780   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   635   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   634   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   634   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   633   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   617   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   616   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   615   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   614   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   613   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   612   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   607   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   607   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   596   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   588   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   577   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   530   0.0  
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    57   3e-08
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    55   2e-07
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      54   4e-07
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    53   1e-06
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    52   1e-06
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    52   2e-06
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    52   3e-06
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    51   4e-06
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    50   6e-06
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    49   2e-05
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    47   6e-05
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    47   6e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    47   7e-05
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    47   8e-05
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    46   2e-04
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    46   2e-04
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    45   2e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    45   4e-04
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    44   6e-04
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   1.1  
YPR171W Chr16 (883828..885558) [1731 bp, 576 aa] {ON}  BSP1Adapt...    34   1.1  
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    33   2.5  
Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON} (32401...    33   2.6  
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    32   4.3  
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    31   9.3  

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/399 (100%), Positives = 399/399 (100%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240
           PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL
Sbjct: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300
           VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV
Sbjct: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300

Query: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/399 (95%), Positives = 393/399 (98%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MSLED FD+LTVSQRASDHINNQLLEKYSHKIKTDELSF++AKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETG+YEVLETDG R 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGKYEVLETDGPRP 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240
           PAP+P+EVKNNVLVMEFLSRGNGFASPKL+DYPYRDR EIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300
           VHADLSEYNTIIH+DKL+MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMG+SIFPERV
Sbjct: 241 VHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISESLEKFK DYHNV DLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/399 (93%), Positives = 390/399 (97%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MSLED+FD L+VSQ ASDHINNQLLEKYSHKIKTDELSFS+AKTSKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120
           RTMRFLKSMV RGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG R 
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QSGVI
Sbjct: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 180

Query: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240
           PAP+P+EVKNNVLVMEFLSRGNGFASPKL+DYPY++R+EIFHYYHTMVAYMRLLYQVCRL
Sbjct: 181 PAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300
           VHADLSEYNTI+H+DKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMG+SIFPERV
Sbjct: 241 VHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERV 300

Query: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKFKGDY+N+  LV YIA NLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/399 (92%), Positives = 393/399 (98%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MS ED+F++LTVSQRASDHINNQLL+K+SHKIKTDELSFSKAKTSKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120
           RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV+DEETG+YEVLETDGLR 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVVDEETGKYEVLETDGLRA 120

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           EYAIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRIHQSGVI
Sbjct: 121 EYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180

Query: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240
           PAP+PVEVKNNVLVMEFLSRG+GFASPKL+DYPY+DREEIFHYY+TMVAYMRLLYQVCRL
Sbjct: 181 PAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRL 240

Query: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300
           VHADLSEYNTIIH+D+LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMG++IFPERV
Sbjct: 241 VHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERV 300

Query: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE LEKFKGDY NV DL+GYI+KNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE
Sbjct: 301 IFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADH 399
           RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEF++ DH
Sbjct: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFNDNDH 399

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/432 (71%), Positives = 359/432 (83%), Gaps = 34/432 (7%)

Query: 1   MSLEDRFDRLTVSQRA-SDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLD 59
           MSLED+FDRL +S    ++H NN++L+KY HK KTDE+SF+++KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--APVIDEETGQY------- 110
           PRTMRFLK++ +RGVI+D NGCLSTGKEANVYHAFAG  K  A V+ E   +        
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 111 --------------EVLETD----------GLRKEYAIKIYKTSILVFKDRERYVDGEFR 146
                         E LET+            +KEYA+KI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 147 FRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFAS 206
           FRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP P+P+EVKNNVLVMEFL RG+GFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 207 PKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSV 266
           P+L+D+PY+DREEIFHYYHT+VAYMRL+YQ+CRLVHADLSEYN +IH DK+Y+IDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 267 EPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGY 326
           EPEHPMSLDFLRMDIKN+N YFEKMG+ IFPERVIFQF+IS++LE F GDY +  DL  Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 327 IAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNF 386
           +A+NLPIK +EQDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKSLIAHDNE+NF
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 387 AASEQFEFDNAD 398
           +A+EQF+    D
Sbjct: 421 SAAEQFDLKAQD 432

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/400 (75%), Positives = 353/400 (88%), Gaps = 10/400 (2%)

Query: 1   MSLEDRFDRLTVSQRAS---DHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57
           MS+E  F +L +        DH+N+++L+KYSH+IKTDELS ++ KT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+ +V+RGV++DLNGCLSTGKEANVYHAFAG    P  + E    + L    
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDEL---- 116

Query: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177
           +++EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS
Sbjct: 117 VKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 176

Query: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237
           GVIP P+P+EV++NVLVMEFL+RGNGFASP+L+D+PY+DREEI +YYHTMVAYMRLLYQV
Sbjct: 177 GVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQV 236

Query: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297
           C+LVHADLSEYNTI+H+D+LYMIDVSQSV+PEHPMSLDFLRMDIKN+N YFEK G+ IFP
Sbjct: 237 CQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFP 296

Query: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQF+ISE+L+KF+GDYHN  DL  Y++KNLP+KST +DEAEDE+FRSLHLVR+L G
Sbjct: 297 ERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+TDGKFDLLKSLIAHDN++   NF ASEQFE 
Sbjct: 357 LEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEI 396

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/426 (72%), Positives = 354/426 (83%), Gaps = 31/426 (7%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MS +++FDRL +S    + +N ++LEKY HKIKTDELSF+K KT+KDKANRATVENVLDP
Sbjct: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102
           RTMRFLK++ NRGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117

Query: 103 --IDEETG-QYEVLETDG-------LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152
              +E+ G    V + DG       LRKEYAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177

Query: 153 QHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDY 212
           QHNPRKMIKIWAEKEFRNL+RIHQSGVIPAP+PVEVK+NVLVMEFL+RGNGFASP+L+DY
Sbjct: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237

Query: 213 PYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPM 272
           PY+DR+EIF YYH +VAYMRLLYQVCRLVHADLSEYNTI+H  KLYMIDVSQSVEPEHPM
Sbjct: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297

Query: 273 SLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLP 332
           SLDFLRMDIKNVN YFEKMG+ IFPER+IFQFVISE LE FKGD ++  DL  ++  NLP
Sbjct: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357

Query: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417

Query: 393 EFDNAD 398
             ++ D
Sbjct: 418 GMEDLD 423

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/413 (73%), Positives = 357/413 (86%), Gaps = 18/413 (4%)

Query: 1   MSLEDRFDRLTVS--QRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVL 58
           MS+ED+FD L +S  + +SDHINNQ+L+KY HKIKT+E S S+ KT+KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK--------------APVID 104
           DPRTM+FL+++++RGVI+  +GCLSTGKEANVYHAFAGTG+               PV  
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 105 EETGQYEVLETDGL--RKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 162
            E    E  + +    R+EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 163 WAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFH 222
           WAEKEFRNLKRI+QS VIPAP+P+E+KNNVLVMEFL+RG+GFASP+L+D+PY+DREEIFH
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 223 YYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIK 282
           YYHT+VAY+RLLYQVC LVHADLSEYNT++H  +LY+IDVSQSVEPEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 283 NVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAE 342
           NVN YFEKMG+ IFPER+IFQFVISE+L+KF GDY +  DL  Y+ +NLPIK+T QDEAE
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 343 DEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFD 395
           DEIFRSL+LVR+L GLEERDFDRYT+G+FDLLKSL+AHDNE+NFAASEQ+E +
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQYELE 413

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/411 (72%), Positives = 345/411 (83%), Gaps = 27/411 (6%)

Query: 3   LEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDPRT 62
           L D+F  + VS   +DHINNQ+++KY HKIKTDELS +KAKT+KDKANRATVENVLDPRT
Sbjct: 4   LSDKFRNVKVS---TDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRT 60

Query: 63  MRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGT-----------------------GK 99
           MRFL ++VNRGVIA LNGCLSTGKEANVYHAFAG+                       G 
Sbjct: 61  MRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGN 120

Query: 100 APVIDEETGQYEVLETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKM 159
             + +      E L  +G RKEYAIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKM
Sbjct: 121 IDISENRAKTAEDLIREG-RKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKM 179

Query: 160 IKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREE 219
           IKIWAEKEFRNLKRI+Q GVIP+P P+EVKNNVLVMEFL+RG+GFASPKLRDYPY+DREE
Sbjct: 180 IKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREE 239

Query: 220 IFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRM 279
           I++YYH +V+YMRLLYQVCRLVHADLSEYNTI+H +KLYMIDVSQSVEPEHPMSLDFLRM
Sbjct: 240 IYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRM 299

Query: 280 DIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQD 339
           DIKNVNLYFEKMG+ IF E+ IFQFVI+++L+KF GD ++  DL  Y+A N+PIK T++D
Sbjct: 300 DIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQED 359

Query: 340 EAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE 390
           EAEDE+FRSLHLVR+L GLEERDFDR+TDGKFDLLKSL+A DN++N+ A++
Sbjct: 360 EAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/400 (74%), Positives = 342/400 (85%), Gaps = 10/400 (2%)

Query: 1   MSLEDRFDRLTVS---QRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57
           MSL+DR D L +    +   DHIN Q+L+K++H IK DELS S+ KTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+++ +RGVI+  NGC+STGKEANVYHAFA  G      EE G  EVL    
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNT--EEAG--EVLPNLE 116

Query: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177
            R+E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 117 ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 176

Query: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237
           G++PAP PVEV++NVLVMEFLSRGNGFASP+L+DYPY+DREE  HYY+TMVAY+RLLYQ 
Sbjct: 177 GLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQC 236

Query: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297
           C+LVHADLSEYN I+HN +LY+IDVSQSV+PEHPMSLDFLRMDIKNVN YFE+M V +FP
Sbjct: 237 CQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFP 296

Query: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ERVIFQFVISE+L+KF GDY + +DL  Y++KNLP+KS  QDEAEDE+FRSLHLVR+LGG
Sbjct: 297 ERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGG 356

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           LEERDFDR+T GKFDLLKSLIAHDNER    F ASEQFE 
Sbjct: 357 LEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/410 (71%), Positives = 350/410 (85%), Gaps = 14/410 (3%)

Query: 1   MSLEDRFDRLTVSQRASDHI-NNQLLEKYSHKIKTDELSFSKAK-TSKDKANRATVENVL 58
           MS+E++F++L++     D   NN+LL+KY+HKIK D+ SFSK K T+KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTG----KAPVIDEET------- 107
           DPRTMRFL++++NRG+I+D NGCLSTGKEANVYHAFAG G       + DEE+       
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 108 GQYEVLETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 167
            +  V  + G +KEYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE
Sbjct: 121 EERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 180

Query: 168 FRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTM 227
           FRNLKRI+QSG +P P+PVEVKNNVLVMEFL+RG+GFASP+LRDYPY+D + I  YY T+
Sbjct: 181 FRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTL 240

Query: 228 VAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLY 287
           VAYMRL+YQVC LVHADLSEYN ++HND+LY+IDVSQSV+PEHPMSLDFLRMDIKNVNLY
Sbjct: 241 VAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLY 300

Query: 288 FEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFR 347
           F KMG+ IFPER+IFQFVISESL+KF+GDY +  DL  Y+  NLP+K TEQDE EDE+FR
Sbjct: 301 FGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFR 360

Query: 348 SLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASE-QFEFDN 396
           SL+LVR+L GLEERDFDR+T+GKFDLLKSL+AHD E+NF A+E QFEFD+
Sbjct: 361 SLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQQFEFDD 410

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/398 (73%), Positives = 345/398 (86%), Gaps = 10/398 (2%)

Query: 1   MSLEDRFDRLTVSQRAS---DHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENV 57
           MSLED   +L++ ++     DHIN Q+L+K++H IKTDELS ++AKTSKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 58  LDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDG 117
           LDPRTMRFL+++ +RGVI++ NGCLSTGKEANVYHAFAG G     +E+    +VL   G
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQ----KVLPNQG 168

Query: 118 LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQS 177
            R+EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI+QS
Sbjct: 169 ERREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 228

Query: 178 GVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQV 237
           GV+PAP P+EVK+NVLVMEFL+RG+GFASPKL+D+PY+DR+E  +YYHTMVAY+RLLYQ 
Sbjct: 229 GVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQC 288

Query: 238 CRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297
           C+LVHADLSEYNTI+HN KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M + IFP
Sbjct: 289 CQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFP 348

Query: 298 ERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGG 357
           ER IFQFVIS+ LEKF+G+Y N  DL  Y+AK L  KS  +DEAEDE+FRSLHLVR+LGG
Sbjct: 349 ERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGG 408

Query: 358 LEERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQF 392
           LEERDFDR+T GKFDLLKSLIAHDN++   NF ASEQ+
Sbjct: 409 LEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/420 (72%), Positives = 347/420 (82%), Gaps = 26/420 (6%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MSLE +FD+L V +  S+HIN+++LEKY HKIKTDELS +K KT+KDKANRATVENVLDP
Sbjct: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDEE------- 106
           RTM+ LK+++NRGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118

Query: 107 --TGQYEVLETDG--------LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156
              GQ EV              RKEYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178

Query: 157 RKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRD 216
           RKMIKIWAEKEFRNL+RI QSG+IPAP PVEVK N+LVMEFL RG+GFASP+LRD+ Y+ 
Sbjct: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238

Query: 217 REEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDF 276
           REEI +YYHT+VAY+RLLYQVCRLVHADLSEYNTI+H+DKLY+IDVSQSVEPEHPMSLDF
Sbjct: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298

Query: 277 LRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKST 336
           LRMDIKNVN YFEKMG+ IFPER+IFQFVIS  L+KF GD  + +DL  YIA  LP+K T
Sbjct: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358

Query: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS QF+F+N
Sbjct: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQFDFNN 418

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/389 (76%), Positives = 341/389 (87%), Gaps = 9/389 (2%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           MSLED+FDRL +S    +H N Q+L+K+S+ IKTDELSF+++K+SKDKANRATVENVLDP
Sbjct: 1   MSLEDQFDRLDISH-GREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRK 120
           RTMRFLKSM+NRGVI++ NGCLSTGKEANVYHAFAG     + D + G  +     G +K
Sbjct: 60  RTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGES---IEDSKDGHVQ-----GEKK 111

Query: 121 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVI
Sbjct: 112 ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVI 171

Query: 181 PAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRL 240
           PAP+PVEVKNNVLVMEFLSRG+GFASP+L+D+ + DR EI+HYYHTM+AY+RLLYQVCRL
Sbjct: 172 PAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRL 231

Query: 241 VHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERV 300
           VHADLSEYN I+H+ KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMG+ IFPER+
Sbjct: 232 VHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERL 291

Query: 301 IFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEE 360
           IFQFVISE+LEKF G+  +  DL  Y++K LP+KST  D  EDEIFRSLHLVR+L GLEE
Sbjct: 292 IFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEE 351

Query: 361 RDFDRYTDGKFDLLKSLIAHDNERNFAAS 389
           RDFDR+TDGKFDLLKSLIAHDNER+  A+
Sbjct: 352 RDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/422 (69%), Positives = 352/422 (83%), Gaps = 31/422 (7%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           M+++D+ ++L ++ R  +H+N Q+LE+Y++ IKTDELS ++ KTSKDKANRATVENVLDP
Sbjct: 2   MNIDDKLEKLNLANR-DEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG--------------TGKAPVIDEE 106
           RTMRFLKSM+NRG+++  NGCLSTGKEANVYHAFAG              T  AP   E 
Sbjct: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120

Query: 107 TGQYEVLE-----------TDGLR--KEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153
           T Q  +             TD  +  KEYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 121 TKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180

Query: 154 HNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYP 213
           HNPRKMIKIWAEKEFRNLKRI+QSGVIP P+P+EV++NVLVMEFL+RG+GFASP+L+D+P
Sbjct: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240

Query: 214 YRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMS 273
           Y+DREEI HYY+ M+AYMRLLYQVCRLVHADLSEYN+I+H DKLY+IDVSQSV+PEHPMS
Sbjct: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300

Query: 274 LDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPI 333
           LDFLRMDIKNVN YF+K+G+ IFPERVIFQF+ISE L+KFKGDY +  DL  Y+A NLP+
Sbjct: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360

Query: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAASE 390
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF ASE
Sbjct: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASE 420

Query: 391 QF 392
           Q+
Sbjct: 421 QY 422

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/410 (70%), Positives = 345/410 (84%), Gaps = 17/410 (4%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           M L+D F +L +S   ++H NN++L+K+ HKIKTDE S S+ KT+KDKANRATVENVLDP
Sbjct: 1   MVLDDDFQKLDLS---NNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDP 57

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVL------- 113
           RTMRFLK++ +RG+I+D NGC+STGKEANVYHAFAG   +P   +    +E L       
Sbjct: 58  RTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPY 117

Query: 114 ----ETDGL---RKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 166
                 D +   RKEYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEK
Sbjct: 118 SNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEK 177

Query: 167 EFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHT 226
           EFRNLKRI+QS VIP P+P+EVKNNVLVMEFL+RG+GFASP+L+DYPY+D  +I HYYHT
Sbjct: 178 EFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHT 237

Query: 227 MVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNL 286
           M+ Y+RLLYQVCRLVHADLSEYNT++H +KLY+IDVSQSVEPEHPMSLDFLRMDIKN+N 
Sbjct: 238 MIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINN 297

Query: 287 YFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIF 346
           YFE+MGV+IF ER+IFQF ISE+L+ F G+Y N  DL  Y+  NLP+K   +D+AEDEIF
Sbjct: 298 YFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIF 357

Query: 347 RSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDN 396
           RSLHLVR+LGGLEERDFDRYTDGKFDLLKSLIAHDNE+NF+ASEQ+ F++
Sbjct: 358 RSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQYNFED 407

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/398 (70%), Positives = 339/398 (85%), Gaps = 21/398 (5%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           M LED+  +L +    +DH N ++LEK++++IKTDELS +K KT+KDKANRATVENVLDP
Sbjct: 1   MDLEDQLRKLKLRD-DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGQYEVLETDGLR 119
           RTMRFL+++VNRGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE----------------K 103

Query: 120 KEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGV 179
            EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRI+QSGV
Sbjct: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163

Query: 180 IPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCR 239
           IP P+PVE+K+NVLVMEFL+RG+GFASP+L+DYP++DR+EI+HYYH MV+Y+RLLYQVC+
Sbjct: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223

Query: 240 LVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPER 299
           LVHADLSEYN+I+H  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MG+ IFPER
Sbjct: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283

Query: 300 VIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           VIFQFVISE+L+KF+GD  +  DL  Y+A NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEF 394
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ++ 
Sbjct: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDL 381

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/382 (73%), Positives = 327/382 (85%), Gaps = 21/382 (5%)

Query: 37  LSFSKAKTSKDKANRATVENVLDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG 96
           +SF+K KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 97  TGKAPV-----------IDEETGQYEVLETD---------GLRKEYAIKIYKTSILVFKD 136
             K              IDEE  + E LET            +KEYA+KI+KTSILVFKD
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119

Query: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVME 196
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QS VIP P+P+EVKNNVL+ME
Sbjct: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179

Query: 197 FLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDK 256
           FL+RG+GFASP+LRDYPY+DREE+ HYYH  +AYMRL+YQVCRLVHADLSEYN +IHN+ 
Sbjct: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239

Query: 257 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGD 316
           +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MG+ IFPERVIFQF+ISE+L+KF G+
Sbjct: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299

Query: 317 YHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376
           Y++  DL  Y+AK LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359

Query: 377 LIAHDNERNFAASEQFEFDNAD 398
           LIAHDNE+NF+A+EQFE  + D
Sbjct: 360 LIAHDNEKNFSAAEQFEIQDDD 381

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/416 (67%), Positives = 342/416 (82%), Gaps = 23/416 (5%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60
           M LE++  RL +    S+H N+++L+K++++IKTDELS ++ KTSKDKANRATVENVLDP
Sbjct: 33  MDLENKLGRLKLLDH-SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91

Query: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVL------- 113
           RTMRFL+S+++RG+I + NGCLSTGKEANVYHAF        +D    Q++V+       
Sbjct: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGN-----AVDIVEKQHKVIRQSSICS 146

Query: 114 --ETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 171
             E D  + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 147 DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 206

Query: 172 KRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYM 231
           KRI+ +GVI  P+P+E+K+NVLVMEFL+RG+GFASPKL+DYPY DR+EI+++YH MVAY+
Sbjct: 207 KRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYI 266

Query: 232 RLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKM 291
           RLLYQVC+LVHADLSEYN+I+H  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+
Sbjct: 267 RLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKI 326

Query: 292 GVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHL 351
           G+++F ER IFQFVISE LEKFKGDY +   L  Y ++ LP+K TE+DE EDEIFRSLHL
Sbjct: 327 GINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHL 386

Query: 352 VRSLGGLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEF-----DNADH 399
           VR+LGGLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE      D+ DH
Sbjct: 387 VRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDH 442

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/394 (65%), Positives = 310/394 (78%), Gaps = 25/394 (6%)

Query: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKA-KTSKDKANRATVENVLD 59
           MSLE  FDRL VS+      N ++LEKY ++I+    +  K  KT KDK++RATVENVLD
Sbjct: 1   MSLETEFDRLHVSKHQD---NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLD 57

Query: 60  PRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLR 119
           PRTM+FL ++ NRGVI++ NGC+S+GKEANVYHAF   G+                    
Sbjct: 58  PRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEGQ-------------------- 97

Query: 120 KEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGV 179
            E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIH SGV
Sbjct: 98  -ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGV 156

Query: 180 IPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCR 239
           +P   PVEVK+NVLVM+FL+RG+G  SP+L+DY Y+D  E+ HYY+  +AYMRLLYQVCR
Sbjct: 157 VPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCR 216

Query: 240 LVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPER 299
           LVHADLSEYN ++H + L++IDVSQSVEP HPMSLDFLRMDIKN+N YF KMGVS+F ER
Sbjct: 217 LVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQER 276

Query: 300 VIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359
           +IFQF+I+E+LE F+GDY    DLV Y+ ++LP+K+  +   EDEIFRSLHLVRSLGGLE
Sbjct: 277 MIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLE 336

Query: 360 ERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFE 393
           ERDFDR+TDGKFDLLKSLIA+DNERN    +Q E
Sbjct: 337 ERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQE 370

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 103/234 (44%), Gaps = 43/234 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           L++++N+ V+  +   +  GKE+++Y      G A V+                     +
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+      RNSR   N   + K+ A KEF  +  ++  G I  P+ 
Sbjct: 127 LGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQA 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
                +V+VM+ +   +G+   +LR++     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 YGCSRHVVVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLIHCDF 230

Query: 246 SEYNTIIHNDK---------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I ND+           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 100/235 (42%), Gaps = 47/235 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LKS++N+  +  + G +  GKE+++Y             ++ G   VL+          +
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG----------SDKNGNKRVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+      R S    N   + K+ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYP---YRDREEIFHYYHTMVAYMRLLYQVCRLVH 242
            +   +V+VME            +R YP    R  ++I   Y  ++ ++  L     L+H
Sbjct: 180 FDNSRHVIVMEL-----------IRGYPMRRLRKHKDIPKLYSDLMKFILQLAN-SGLIH 227

Query: 243 ADLSEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N +I ++          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 228 CDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  I  + G +  GKE+++Y   A  G   V+                     +
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNPRVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      RN++   N   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLIHCDF 230

Query: 246 SEYNTII------HND-KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I       ND    +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 99/232 (42%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y      GK  V+                     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGKPRVMK------------------IHR 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      RNS    N   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFIVELAN-SGLIHCDF 230

Query: 246 SEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I N+          +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 98/232 (42%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y      G   VI                     +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKVSDKDGNPRVIKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      R S    N   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHTVRNNRDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +   NGF   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELI---NGFPMRRLRKH-----KNIPKLYSDLMCFIVQLGN-SGLIHCDF 230

Query: 246 SEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I ++          +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 106/236 (44%), Gaps = 46/236 (19%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAI- 124
           LK+M+NR  +  +   +  GKE+++                   Y+V + +G+ K   I 
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDI-------------------YKVSDKNGVEKVMKIH 125

Query: 125 KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPR 184
           ++ +TS    ++   Y+      +NS++  N   + K+ A KE++ +  +H  G    P 
Sbjct: 126 RLGRTSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPE 179

Query: 185 PVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++ME +    GF   +LR +     + +   Y  ++ ++  L     L+H D
Sbjct: 180 PFDHSRHIIIMELIK---GFPMTRLRKH-----QNVPKLYSDLMKFILELGN-SGLIHCD 230

Query: 245 LSEYNTIIHNDKL----------YMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N +I  DKL           +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 FNEFNIMI-KDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 105/233 (45%), Gaps = 42/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAI- 124
           LK+M+NR  +  + G +  GKE+++                   Y+V + +G+ K   I 
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDI-------------------YQVSDKNGVSKVMKIH 125

Query: 125 KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPR 184
           ++ +TS    ++   Y+      +N ++  N   + ++ A KE++ +  ++  G    P 
Sbjct: 126 RLGRTSFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPE 179

Query: 185 PVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++M  +    G+   +LR +       I   Y+ ++ ++  L     L+H D
Sbjct: 180 PFDNSRHIIIMGLIE---GYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCD 230

Query: 245 LSEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N +I ++          +ID  Q +  +HP +  + + D+  +  +F+K
Sbjct: 231 FNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 105/232 (45%), Gaps = 40/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  + G +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYR----------VSDRNGTEKVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K++  Y+      +N+++  N   + KI A KE++ +  +   G    P  
Sbjct: 127 LGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEA 180

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   + +VME +    G+   +LR +     + I   Y  +++++  L     L+H D 
Sbjct: 181 FDCSRHCIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLIHCDF 231

Query: 246 SEYNTII------HNDKLY-MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I       ND  + +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 232 NEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 100/233 (42%), Gaps = 42/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           +K+M+NR  +  +   +  GKE+++Y           + +  G  +V++          +
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYK----------VSDRNGNAQVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      ++SR   +   +  + A KE+  L  +H  G    P  
Sbjct: 127 LGRTSFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEA 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++MEF+    GF    LR +       I   Y  ++ +   L +   L+H D 
Sbjct: 180 FDNSRHMVLMEFI---KGFPMKNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLIHCDY 230

Query: 246 SEYNTIIHND--------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I +            +ID  Q +  +HP +  F R DI+ +  +F+K
Sbjct: 231 NEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 101/233 (43%), Gaps = 43/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAI- 124
           +KSM+NR  +      +  GKE+++                   Y+V + +G+ K   I 
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDI-------------------YQVSDKNGVAKVMKIH 125

Query: 125 KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPR 184
           ++ +TS    K+   Y+      + +    N   +  + A+KE++ +  ++  G I  P+
Sbjct: 126 RLGRTSFHTVKNNRDYL------KKNAHGTNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQ 178

Query: 185 PVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++ME +   +GF    LR++       I   Y  ++ +   L     L+H D
Sbjct: 179 PYDNSRHIVLMELI---DGFPMRNLRNH-----SNIPKLYSDLMTFAVKLAN-SGLIHCD 229

Query: 245 LSEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            +E+N +I N           +ID  Q +  +H  +  + + DI+ +  +F K
Sbjct: 230 FNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/234 (19%), Positives = 104/234 (44%), Gaps = 46/234 (19%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LKS++N+  +  +   +  GKE+++Y     T +A V+                     +
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQVSTSTSEALVMKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+    R +++   H    +  + A KE++ +  ++  G    PRP
Sbjct: 127 LGRTSFHTVKNNRDYLK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRP 178

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCR--LVHA 243
            +   ++++ME++    G+   +LR+  ++D   ++         M+ + Q+    L+H 
Sbjct: 179 YDNSRHIILMEYIK---GYPMRRLRE--HKDLPRLYS------ELMKFIVQLGNHGLIHC 227

Query: 244 DLSEYNTIIHNDK-------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           D +E+N +I +           +ID  Q +  +H  +  + + D++ +  +F+K
Sbjct: 228 DFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 101/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y           + ++ G   V++          +
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYK----------VSDKNGNPRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      +NS    N   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHSVRNNRDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFVVELAN-SGLIHCDF 230

Query: 246 SEYNTII-------HNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N ++        +    +ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 97/236 (41%), Gaps = 50/236 (21%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           L++M++R  I  +   +  GKE++VY   A  G A V+                     +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDGSARVLKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIHQSGVIPAPR 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  +H  G    P 
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-FTVPE 177

Query: 185 PVEVKNNVLVMEFLSRGNGFASPKLRDYPYRD---REEIFHYYHTMVAYMRLLYQVCRLV 241
           P +   ++++ME +             YP R+    + +   Y  ++ ++  L     L+
Sbjct: 178 PFDNSRHMILMELID-----------GYPMRNMRLHKNLPKLYSDLMLFIVKLANHG-LI 225

Query: 242 HADLSEYNTIIHN-------DKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           H D +E+N +I N       +   +ID  Q +  +H  +  F + D+  +  +F+K
Sbjct: 226 HCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/253 (18%), Positives = 109/253 (43%), Gaps = 52/253 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE++VY   A  G   V+                     +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGTPRVLKIH------------------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIHQSGVIPAPR 184
           + +TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G +  P 
Sbjct: 127 LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPE 177

Query: 185 PVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHAD 244
           P +   ++++M+ +   +G+   ++R +     + +   Y  +++++  L     L+H D
Sbjct: 178 PFDNSRHMILMQLI---DGYPMRRMRSH-----KNLPKLYSDLMSFIVKLANHG-LIHCD 228

Query: 245 LSEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFP 297
            +E+N +I N           +ID  Q +  +H  + ++ + D+  +  +F K       
Sbjct: 229 FNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK------- 281

Query: 298 ERVIFQFVISESL 310
            ++ ++ V+ ES+
Sbjct: 282 -KLKYEPVVDESM 293

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/232 (18%), Positives = 102/232 (43%), Gaps = 41/232 (17%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LKS++N+  +  +   +  GKE+++Y A           +  G++ V++          +
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA----------SDRNGEHRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+      +      +   + ++ A KE++ +  ++  G    P+ 
Sbjct: 127 LGRTSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FTVPKA 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    GF   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDF 230

Query: 246 SEYNTIIHNDK-------LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I ++K         +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/232 (18%), Positives = 100/232 (43%), Gaps = 42/232 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y           + +  G   V++          +
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQ----------VSDRNGNSRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+ G       R   +   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEP 178

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   ++++ME +    G+   +LR +      ++   Y  ++ ++  L     L+H D 
Sbjct: 179 FDNSRHIILMELIK---GYPMRRLRKH-----HDLPKLYSDLMCFIVNLANHG-LIHCDF 229

Query: 246 SEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I ++          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 230 NEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 102/233 (43%), Gaps = 43/233 (18%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LK+M+NR  +  +   +  GKE+++Y           + ++ G   V++          +
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYK----------VSDKNGNPRVMKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    ++   Y+      + S    N   + ++ A KE++ +  ++  G    P P
Sbjct: 127 LGRTSFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEP 179

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADL 245
            +   +++VME +    G+   +LR +     + I   Y  ++ ++  L     L+H D 
Sbjct: 180 FDNSRHIVVMELIE---GYPMRRLRKH-----KNIPKLYSDLMCFIVDLAN-SGLIHCDF 230

Query: 246 SEYNTIIHNDKL--------YMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           +E+N +I  DKL         +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 231 NEFNIMI-KDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/236 (19%), Positives = 98/236 (41%), Gaps = 50/236 (21%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LKS++ +  I  +   +  GKE+++Y                       +D   +   +K
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQV---------------------SDAASQSLVMK 123

Query: 126 IY---KTSILVFKDRERYVDGEFRFRNSRSQH-NPRKMIKIWAEKEFRNLKRIHQSGVIP 181
           I+   +TS    K +  Y+         R Q  N  ++  + AE+E+  +  ++  G   
Sbjct: 124 IHRLGRTSFHTVKTKREYL--------KRGQSANWMRLSHLSAEREYAYMCLLYSKG-FS 174

Query: 182 APRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLV 241
            P+P     + +VME++    G+   +LR +       +   Y  ++A++  L     ++
Sbjct: 175 VPKPYANSRHAIVMEYI---RGYPMRRLRSH-----SNVPKLYSDLMAFVVKLANHG-MI 225

Query: 242 HADLSEYNTIIHND-------KLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
           H D +E+N +I +D          +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 226 HCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 103/235 (43%), Gaps = 48/235 (20%)

Query: 66  LKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGLRKEYAIK 125
           LKSM+NR  +  +   +  GKE+++Y           + + +G+ +VL+          +
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQ----------VSDRSGESKVLKIH--------R 126

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRP 185
           + +TS    K+   Y+      RN +S  +   + K+ A KE++ +  ++       P+P
Sbjct: 127 LGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQP 178

Query: 186 VEVKNNVLVMEFLSRGNGFASPKLRDYPYR---DREEIFHYYHTMVAYMRLLYQVCRLVH 242
            +   + ++ME            +R YP R     + +   Y  ++ ++  L     L+H
Sbjct: 179 FDNSRHCVLME-----------HIRGYPMRRLGKHKNLPKLYSDLMCFIVKLANHG-LIH 226

Query: 243 ADLSEYNTII------HNDKLY-MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEK 290
            D +E+N +I       +D  Y +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 227 CDFNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 126 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 174
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>YPR171W Chr16 (883828..885558) [1731 bp, 576 aa] {ON}  BSP1Adapter
           that links synaptojanins Inp52p and Inp53p to the
           cortical actin cytoskeleton
          Length = 576

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 11/91 (12%)

Query: 259 MIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISE----SLEKFK 314
           +   S+   PE P  L       +N NL   K   SI P++V    V+ E         K
Sbjct: 330 LTTTSKPSLPEKPQKL-------RNANLAAHKTKPSIPPKKVELNIVLPELRPVETSPTK 382

Query: 315 GDYHNVIDLVGYIAKNLPIKSTEQDEAEDEI 345
            ++ N IDL    + N  IK  E+D   + I
Sbjct: 383 QNFENSIDLPKLRSSNRNIKKEEEDSIPEAI 413

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 131 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVI 180
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  +  S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON}
           (32401..36405) [4005 nt, 1335 aa]
          Length = 1334

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 174 IHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRL 233
           IH SG+I +PR VE   N++ +E  SR   FA   +  +P   +E    Y + M+ Y  +
Sbjct: 314 IHDSGLIESPRTVEDDANIIDIESKSRYLNFAKTFISSHPTIAQE----YVNKMIMYPEM 369

>Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] {ON}
            YNR031C (REAL)
          Length = 1581

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 79/190 (41%), Gaps = 13/190 (6%)

Query: 1    MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANR--ATVENVL 58
            + LED FD   + Q  S+     ++E    KIK +     K     DK N+   ++ + +
Sbjct: 1203 LDLEDVFDDDMMLQVNSEFRVQSIIE-LEEKIKRNPHQTGKVIDDSDKGNKYLVSLASSI 1261

Query: 59   DPRTMRFLK-SMVNRGVIA------DL-NGCLSTGKEANVYHAFAGTGKAPVIDEETGQY 110
               +MR+ K + V  G         DL NG +   KE N+  + A     P+I EE    
Sbjct: 1262 SNVSMRWQKRNFVGGGTFGRVFSAVDLDNGEILAVKEINIQDSKAMKKIFPLIKEEMSVL 1321

Query: 111  EVLETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRN 170
            E+L    +   Y +++++  + +F   E    G         +     + +++  +    
Sbjct: 1322 EILNHPNIVSYYGVEVHRDKVNIF--MEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEG 1379

Query: 171  LKRIHQSGVI 180
            L  +H+SG++
Sbjct: 1380 LAYLHESGIV 1389

>Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] {ON}
            YNR031C (REAL)
          Length = 1583

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 79/190 (41%), Gaps = 13/190 (6%)

Query: 1    MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANR--ATVENVL 58
            + LED FD   + Q  S+     ++E    +IK +     K     DK N+   ++ + +
Sbjct: 1202 LDLEDVFDDDMMLQVNSEFRLQSIIE-LEERIKRNPHQTGKVIDDSDKGNKYLVSLASSI 1260

Query: 59   DPRTMRFLK-SMVNRGVIA------DL-NGCLSTGKEANVYHAFAGTGKAPVIDEETGQY 110
               +MR+ K + +  G         DL NG +   KE N+  + A     P+I EE    
Sbjct: 1261 SNVSMRWQKRNFIGGGTFGRVFSAVDLDNGEILAVKEINIQDSKAMQKIFPLIKEEMSVL 1320

Query: 111  EVLETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRN 170
            E+L    +   Y +++++  + +F   E    G         +     + +I+  +    
Sbjct: 1321 EILNHPNIVSYYGVEVHRDKVNIF--MEYCEGGSLAALLEHGRIEDEMVTQIYTLQLLEG 1378

Query: 171  LKRIHQSGVI 180
            L  +H+SG++
Sbjct: 1379 LAYLHESGIV 1388

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,234,597
Number of extensions: 2015714
Number of successful extensions: 6374
Number of sequences better than 10.0: 59
Number of HSP's gapped: 6474
Number of HSP's successfully gapped: 60
Length of query: 485
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 371
Effective length of database: 40,409,475
Effective search space: 14991915225
Effective search space used: 14991915225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)