Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2815.431ON56755527410.0
YOR118W (RTC5)5.431ON56756724720.0
Smik_15.2965.431ON56656724470.0
Suva_8.1715.431ON56756724370.0
SAKL0G02464g5.431ON56355114990.0
NCAS0H020505.431ON57355314650.0
NDAI0C016105.431ON58456814340.0
TDEL0E019405.431ON56756814240.0
Kwal_55.214375.431ON55455013480.0
KLTH0F16126g5.431ON55454913441e-180
ZYRO0F09966g5.431ON55455013111e-175
Kpol_1016.75.431ON56254312721e-169
KLLA0E21143g5.431ON57255112591e-167
TPHA0H017905.431ON56555012481e-166
Ecym_47645.431ON56655212141e-161
CAGL0L11616g5.431ON55555312061e-160
KNAG0B042305.431ON57755211931e-157
AER258C5.431ON5575569141e-116
TBLA0A065305.431ON4925367381e-90
TBLA0A052901.66ON125452723.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.281
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...  1060   0.0  
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   956   0.0  
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   947   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   943   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   582   0.0  
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   568   0.0  
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   556   0.0  
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   553   0.0  
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   523   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   522   e-180
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   509   e-175
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   494   e-169
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   489   e-167
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   485   e-166
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   472   e-161
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   469   e-160
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   464   e-157
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   356   e-116
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   288   1e-90
TBLA0A05290 Chr1 (1293365..1297129) [3765 bp, 1254 aa] {ON} Anc_...    32   3.8  

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/555 (94%), Positives = 526/555 (94%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60
           MGQ               KKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60

Query: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120
           SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE
Sbjct: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLP 180
           KFLKIKSYDQLKLLFISLSLQKTDK              RHVKQIITDFDDVDTEMLCLP
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLP 180

Query: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240
           ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF
Sbjct: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240

Query: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300
           ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS
Sbjct: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300

Query: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360
           TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP
Sbjct: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360

Query: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420
           RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR
Sbjct: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480
           QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540
           GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI
Sbjct: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540

Query: 541 NFRSLGEDRALLEMA 555
           NFRSLGEDRALLEMA
Sbjct: 541 NFRSLGEDRALLEMA 555

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/567 (82%), Positives = 505/567 (89%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60
           MGQ               KKFTN++D+L+YFNNKAQQQVTIPELVSFKGNLQIE+LNTPI
Sbjct: 1   MGQSSSISSSNEEGSSHSKKFTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPI 60

Query: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120
           SHK L N L+FP NH ++VGIVTNMLRVLSNFPL+ SSYEPITG+GLLKCILLLNR RC 
Sbjct: 61  SHKALCNSLYFPQNHAMIVGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCA 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLP 180
           KFLK KSYDQLKLLFISLSLQKTDK                +KQIIT FDDVDTEMLC+P
Sbjct: 121 KFLKTKSYDQLKLLFISLSLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIP 180

Query: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240
           ADFMLQFL+WLLIL+V  PTTNSK DN +T++QW  FK+SA+NLLRTMNPDVV ++ESH 
Sbjct: 181 ADFMLQFLTWLLILTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHS 240

Query: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300
           ITF+QFSTAIRTVMPNL KPLENLMEHFFYL +DLV  D NLSSIQDS++MTPALLAQLS
Sbjct: 241 ITFQQFSTAIRTVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLS 300

Query: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360
           TGLPKELFI KLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNS+EYAAEKNP
Sbjct: 301 TGLPKELFIHKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNP 360

Query: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420
           RYRHFL+EFPKLK+SDQ MDASHL+K+KTTFAVYIDDPWKVTNKDYFGDLNTRII+ISPR
Sbjct: 361 RYRHFLEEFPKLKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480
           QDIYKVNQKGTIYFNTIGGGIGIGDKQP IK ASKRYIPGNVSLTFDSTLEFAVFR+TGY
Sbjct: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGY 480

Query: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540
           GG LDPGLLSMERKEENS +ELHFLIQDVEVWGCGGEKELEEQIKQ+ WEEAESKRRQQI
Sbjct: 481 GGSLDPGLLSMERKEENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQI 540

Query: 541 NFRSLGEDRALLEMAGIIGQHQGGGSM 567
           N RSLGEDRALLEMAG++GQHQGGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQHQGGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/567 (82%), Positives = 508/567 (89%), Gaps = 1/567 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60
           MGQ               +KF N+RDVL+YFN KAQ+Q+T+PELVS KGNLQIENLNTPI
Sbjct: 1   MGQSSSISSNNEEGSSHSRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPI 60

Query: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120
           SHK L N L+FP NHTI+VGIVTNMLRVLSNFPL+NSSYEPITG+GLLKCI+LLN++RCE
Sbjct: 61  SHKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCE 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLP 180
           KFLKIKSYDQLKLLFISLSLQKTDK              +++KQIIT FDDVDTE+L LP
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLP 180

Query: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240
           ADFMLQFL+WLLILSV+ PTTNS T N++T  QWD FKI AMNLLRTMNPDVV+N+ESHF
Sbjct: 181 ADFMLQFLTWLLILSVECPTTNS-TINNETNVQWDKFKIPAMNLLRTMNPDVVNNIESHF 239

Query: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300
           IT++QFSTAIRTVMPNL KPLENLMEHF YL +DLV  D NLSSIQDS+IMTPALLAQLS
Sbjct: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299

Query: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360
           TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSG+RITNS+EYAA KNP
Sbjct: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359

Query: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420
           RYRHFL+EFP LKDSDQKMDAS ++KKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR
Sbjct: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480
           QDIYKVN+KGT+YFNTIGGGIGIG+KQP IK+ASKRY+PGNVSLTFDSTLEFAVFR+TGY
Sbjct: 420 QDIYKVNKKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479

Query: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540
           GG LDPGLLSMERKEENS FELH LIQDVEVWGCGGEKELEEQIKQ+AWEEAESKRRQQI
Sbjct: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539

Query: 541 NFRSLGEDRALLEMAGIIGQHQGGGSM 567
           N RSLGEDRALLEMAG++GQHQGGGSM
Sbjct: 540 NLRSLGEDRALLEMAGLVGQHQGGGSM 566

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/567 (81%), Positives = 507/567 (89%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60
           MGQ               +KFTNN DVL+YFN+KAQQQVT+PELVS KGNLQIE++NTPI
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPI 60

Query: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120
           SHK L +VLHFP  HT++ GIVTNMLRVLSNFPL+NSSYEPITG+GLLKCILLLN+ RC 
Sbjct: 61  SHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCG 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLP 180
           K+LK KSYDQLKLLFISLSLQKTDK              R++KQII +FDDVD+E+L +P
Sbjct: 121 KYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVP 180

Query: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240
           ADFMLQFLSWLLILSV+ PT+NSK  N K Y+QWD+FKISAMNLLRTMNPDVVSN ESH 
Sbjct: 181 ADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTESHL 240

Query: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLS 300
           ITF+QFST+IRTVMPNL KPLENLMEHFFYL+NDLV+ D +LSS++DSRIMTPALL QLS
Sbjct: 241 ITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLTQLS 300

Query: 301 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNP 360
           T LP+ELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSIL+VSG RITNSDEYAA+KNP
Sbjct: 301 TVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNP 360

Query: 361 RYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 420
           RYRHFL+EFPKLKDSDQKMDAS+ +KKKTTFAVYIDDPWKVTNKDYFGD+NTRIIQISPR
Sbjct: 361 RYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPR 420

Query: 421 QDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGY 480
           QDIYKVN+KGTIYFNTIGGGIGIGDKQP IK ASKR+IPGNVSLTFDSTLEFAVFRHTGY
Sbjct: 421 QDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGY 480

Query: 481 GGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQI 540
           GG L+PG LS+ERKEE+SFFELHFLIQDVEVWGCGGEKELEEQ+KQMAWEEAESKRRQQI
Sbjct: 481 GGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQI 540

Query: 541 NFRSLGEDRALLEMAGIIGQHQGGGSM 567
           N RSLGEDRALLEMAG++GQ++GGGSM
Sbjct: 541 NLRSLGEDRALLEMAGLVGQNRGGGSM 567

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 390/551 (70%), Gaps = 7/551 (1%)

Query: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVV 79
           +F +  D+L YF  +A +Q T PELV+FK NL+ ++ N  +S + +  +L  P  + ++ 
Sbjct: 17  QFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLA 76

Query: 80  GIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLS 139
            ++ N ++ LSNFPLI  SY+ IT  GLLK  +LL+  RC K++  K+YDQLKL++I+L+
Sbjct: 77  DLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALA 136

Query: 140 LQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFP 199
           L+KT K                 K II +++ VD + L +PAD MLQ L+  L+LS +  
Sbjct: 137 LRKTVKELPSSPDPAKPW---DAKSIIRNYNSVDIDDLYVPADSMLQLLTLSLVLS-RHC 192

Query: 200 TTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPNL 257
           T N+    +  ++ WD +K +AMNLLRTMNPD+V+  ++    I+FEQFS AI  V P +
Sbjct: 193 TVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQV 252

Query: 258 FKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYI 317
            KPLE L+EH  YLD DL     + S    S+++T  LLAQLST LPKEL   KL+ LY+
Sbjct: 253 LKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYV 312

Query: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQ 377
           GR+SGFSMRS Q+K FKWMAPSIL++ GMRIT+  EYA  KNPRY+ FL+E+P+LKD DQ
Sbjct: 313 GRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQ 372

Query: 378 KM-DASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNT 436
            + D   L+++K  FAVY+++PWKVTNK+ FGDL T ++Q+SP+Q+++K  + G +YFNT
Sbjct: 373 HIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNT 432

Query: 437 IGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEE 496
           +GGGIG+G  QP IK   K+Y PGNVSLT DS+LEFA FRH GYGG + PG L  + +EE
Sbjct: 433 LGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEEE 492

Query: 497 NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAG 556
            + FE  F++QDVEVWGCGGEKEL+EQIKQ  WEEAE+KRRQ+IN +S+GEDRALLEMAG
Sbjct: 493 KTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAG 552

Query: 557 IIGQHQGGGSM 567
           ++GQHQ GGSM
Sbjct: 553 LVGQHQSGGSM 563

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/553 (49%), Positives = 381/553 (68%), Gaps = 12/553 (2%)

Query: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTP-----ISHKPLFNVLHFPPNH 75
           F +  ++   F  +     T  ELV+FK  +  E  ++      IS   L N+LH P  +
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPREN 86

Query: 76  TIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLF 135
            ++V +   ++ +LSNFPL+      +T  GLL CI+LL++ RC +F+   +YDQL L+F
Sbjct: 87  VLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIF 146

Query: 136 ISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILS 195
           I++SL   DK               +V++++  FD++  + L +PA  +LQFLSW L+L 
Sbjct: 147 IAMSLDYADKLLPYARTPKKL----NVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLL 202

Query: 196 VKFPTTNSKTDN-DKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVM 254
           +K PT+N +    ++ Y+ W +++ +A N++R+M+  ++ N+    I + QFS   + V+
Sbjct: 203 IKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQSIIRNLTDVRINYTQFSDVFKAVL 262

Query: 255 PNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQS 314
           PN   PLE+LM H  Y+D+DL+  D     + +S++M+  LLAQL+T LPKELF+ KLQ 
Sbjct: 263 PNFTTPLESLMGHLLYMDSDLI--DHETMPMNNSKLMSEPLLAQLATVLPKELFLSKLQK 320

Query: 315 LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKD 374
           LY+GR+SGFSMRSLQ+K F W APSIL+VSGM I++  +YA EKNPRY  FL+++PKLK+
Sbjct: 321 LYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKE 380

Query: 375 SDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYF 434
             Q +DA H  +KK TFAVYIDDPW+VTNK++FG +N+ IIQ++PRQD++  ++   IYF
Sbjct: 381 EQQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYF 440

Query: 435 NTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERK 494
           NT+GGGIG G+KQP I  A K+YIPGNVSLT DSTLEFAVFRH GYGG   P  L  +R 
Sbjct: 441 NTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRG 500

Query: 495 EENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEM 554
           +E+  FE+ F+IQDVEVWGCGGEKEL+EQIK++ WEEAE+KRRQ IN +SLGEDRALLEM
Sbjct: 501 KEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEM 560

Query: 555 AGIIGQHQGGGSM 567
           AG++GQ Q GGSM
Sbjct: 561 AGLVGQSQSGGSM 573

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/568 (48%), Positives = 379/568 (66%), Gaps = 25/568 (4%)

Query: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVV 79
           +F N  +V  YF  +     T  EL+S+K  L  ++L+  I+ + +  +LH P ++ I+ 
Sbjct: 22  QFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILS 81

Query: 80  GIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLS 139
            ++ NM+  L NFP +      IT   LL CI+LL+  RC++F+  KSYDQ+KLLFI L 
Sbjct: 82  NMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLC 141

Query: 140 LQKTDKXXXXXXXXXXXXXXR----------------HVKQIITDFDDVDTEMLCLPADF 183
           L   +               +                ++  I+  ++ +  + L +PA  
Sbjct: 142 LSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALS 201

Query: 184 MLQFLSWLLILSVKFPTTNSKT-DNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFIT 242
           + +  +W LI+S+K PT N K   N+  Y  W+ ++ +++N+LR+M+  +VSN++ + I+
Sbjct: 202 LSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYRIS 261

Query: 243 FEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTG 302
           F QF     +V+PN   PLEN+M H  Y+D DL++    +  I  S++M+ +LLAQLST 
Sbjct: 262 FTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHP--VMEIPKSKLMSESLLAQLSTT 319

Query: 303 LPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRY 362
           LPKELFI KLQ LYIGR+SGFSMRSLQ+K FKW+AP+IL+VSG+ I N +EY    NPR+
Sbjct: 320 LPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEY---NNPRF 376

Query: 363 RHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQD 422
           + FL EFPKL D++Q ++  H  KKK +FAVYID+PW+VTNK++FGDLN+RII++SPRQD
Sbjct: 377 KRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQD 436

Query: 423 IYK-VNQKGTIYFNTIGGGIGIGDKQPFIK--AASKRYIPGNVSLTFDSTLEFAVFRHTG 479
           I+K +     IYFNTIG GIGIGDKQP +   A S++Y PGNVSLT +STLEFAVFRH G
Sbjct: 437 IFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVG 496

Query: 480 YGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQ 539
           +GG   P  L  +R  E   FE+ F+IQDVEVWGCGGEKELEEQ+KQ+AWEEAE+KRRQQ
Sbjct: 497 HGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQ 556

Query: 540 INFRSLGEDRALLEMAGIIGQHQGGGSM 567
           +N +S+ EDRALLEM G++GQHQ GGSM
Sbjct: 557 VNLKSISEDRALLEMVGLVGQHQSGGSM 584

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/568 (48%), Positives = 382/568 (67%), Gaps = 2/568 (0%)

Query: 1   MGQXXXXXXXXXXXXXXXKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60
           MGQ               ++FT+N +++ +F+ +A    T  EL +FK  L+ + L  P+
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPV 60

Query: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120
             + L   L  P  + ++   V   +RVLSNFPL+  S++ +TG GLLK +LL N ++C 
Sbjct: 61  RSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCH 120

Query: 121 KFLKIKSYDQLKLLFISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLP 180
           K++ +K+YD +KLLFI+LS++K+ K                   ++  ++++  + L +P
Sbjct: 121 KYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIP 180

Query: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240
           A  ++Q L+WLLIL+   PT+N +   D  Y +W +FK++A NLLRTMN ++V+N+ES+ 
Sbjct: 181 ATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYS 240

Query: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSS-IQDSRIMTPALLAQL 299
           + FEQFS AI TVMPN+F+ L+N+MEH  Y D+DLVS  +N +  I  S+  T A+LAQL
Sbjct: 241 VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQL 300

Query: 300 STGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKN 359
            T L  E+   K Q+LY+GR+SGFSMRSLQAKVFKWMAP+++++SG  + + ++++ +KN
Sbjct: 301 ITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFS-KKN 359

Query: 360 PRYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISP 419
            RYR FL ++PKLKD DQ +     +K K  FAVYI +PWK TNKDYFG   T I+Q+SP
Sbjct: 360 SRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSP 419

Query: 420 RQDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTG 479
            QD++K      +YFNT+GGGIGIG+ QP IK   K Y PGNVSLT DSTLEFA FRH G
Sbjct: 420 TQDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVG 479

Query: 480 YGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQ 539
           YGG  +PGLL  +   E+  FE+ FLIQDVEVWGCGG++ELEEQ K+  WEEAE+KRRQ 
Sbjct: 480 YGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQN 539

Query: 540 INFRSLGEDRALLEMAGIIGQHQGGGSM 567
           IN RS GEDRALLEMAG++G  Q GGSM
Sbjct: 540 INLRSFGEDRALLEMAGLVGHSQNGGSM 567

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/550 (47%), Positives = 367/550 (66%), Gaps = 14/550 (2%)

Query: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVV 79
           +F + +DV+ +F+ KA + +T PELVSFK N+  ++L+  ++   L  VL     +  V 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 80  GIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLS 139
            ++ N ++ LSNFP I   YE IT  GLLK  +LLN+ RC  ++K K YD  KL++ISL+
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 140 LQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFP 199
           L KT K                  +II  F+ V  E L +P++ ML+F++ +L +S    
Sbjct: 137 LNKTVKEVSSSSNSQESL---DAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 200 TTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVESHFITFEQFSTAIRTVMPNL 257
             NSK D + + E W++F+  A+++LRTMN ++ +  ++  + ITF QF + I TV PNL
Sbjct: 194 IKNSKLDPNVS-EGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNL 252

Query: 258 FKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYI 317
             P E+LMEH  +L  DLV  DA+   + +S++++  LLAQL+T  P+EL   +LQ LY+
Sbjct: 253 LLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYV 312

Query: 318 GRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQ 377
           GR SGFSMRS QAK FKWMAPSIL++ G+RI N +EYA  KN RY++FL+E+P+LK+ DQ
Sbjct: 313 GRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQ 372

Query: 378 KMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTI 437
            +      KKK  FAVY++ PWKVTN + FGDL T IIQ+SP Q++YK ++ G IYFNT+
Sbjct: 373 VLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTL 432

Query: 438 GGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEEN 497
           GGGIG+G  QP +K  S++Y+PGNVSLT D  LEFAVFR  G+GG + P    +      
Sbjct: 433 GGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN----- 487

Query: 498 SFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGI 557
              E  FLIQD+E WGCGGEKELEEQ+K   WEEAE++RRQ+IN +S+ +DRALLEMAG+
Sbjct: 488 ---EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGL 544

Query: 558 IGQHQGGGSM 567
           +GQ+Q GGS+
Sbjct: 545 VGQNQSGGSI 554

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/549 (46%), Positives = 369/549 (67%), Gaps = 14/549 (2%)

Query: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVG 80
           F +  D+LS+++ KA + V+ PELVS+KGN+  + L+  ++ K L  VL     +  V G
Sbjct: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEG 77

Query: 81  IVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSL 140
           ++ N ++ L+NFPLI   YE +T  G+LK  +LLN+ RC ++++ K Y+  KL++ISL+L
Sbjct: 78  LLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLAL 137

Query: 141 QKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPT 200
            K  K                  ++I  F++V  E L +PA+ ML+FL+ +L +S     
Sbjct: 138 NKAVKEMSSLPNSNDSL---DAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVI 194

Query: 201 TNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVES--HFITFEQFSTAIRTVMPNLF 258
            NS+ D + + E+WD+FK  A+++LRTMN D++++ ++  + I++ QF   I +V PNL 
Sbjct: 195 KNSRLDVNIS-EKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLL 253

Query: 259 KPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIG 318
            PLE LMEH  +L+ DLV  +A+   I  S+++T  LLAQL+T  P+EL   +LQ LY+G
Sbjct: 254 VPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVG 313

Query: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQK 378
           R SGFSMRS QAK FKWMAPSIL+V G RI +  +YA  KN RY+ FLDE+P+LKD DQ 
Sbjct: 314 RDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQH 373

Query: 379 MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIG 438
           +  +   K+K  FA+ I++PWKVTN + FGD+ T I+Q+SP Q++YK ++ G +YFNT+G
Sbjct: 374 ILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLG 433

Query: 439 GGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENS 498
           GGIGIG  QP IK++  +++PGNVSLT D  LEFA FR+ G+GG + P            
Sbjct: 434 GGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS--------NTP 485

Query: 499 FFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGII 558
             E  FLIQD+E WGCGGEKELEEQ+K   WEEAE++RRQ+IN +S+ +DRALLE+AG++
Sbjct: 486 TSEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLV 545

Query: 559 GQHQGGGSM 567
           GQ+Q GGS+
Sbjct: 546 GQNQSGGSV 554

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  509 bits (1311), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 265/550 (48%), Positives = 374/550 (68%), Gaps = 14/550 (2%)

Query: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVG 80
           FT+N D+L  FN++A +Q T+ ELVSFK  L  ++LN  ++++ L   L  P +  ++  
Sbjct: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEILLRE 74

Query: 81  IVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSL 140
           ++ N ++VL NFPL+ +SYE +TG G+LK I+L N  RC+K++K ++YDQLKL FI+LS+
Sbjct: 75  LLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSI 134

Query: 141 QKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPT 200
           +KT K                V +I+  FD +    L +P  +M+ F+SWLLIL+   P 
Sbjct: 135 RKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPI 194

Query: 201 TNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLFKP 260
            N K +N   ++ W+++  SA  +LR+M P      ES +I +E F+  +R++ P++F P
Sbjct: 195 NNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHIFDP 250

Query: 261 LENLMEHFFYLDNDLVSR-DANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIGR 319
           L  +MEH  + D++LV     N   I  S+++  ALLAQ+S+ L K+L I  LQ LY+GR
Sbjct: 251 LTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLYLGR 310

Query: 320 KSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQKM 379
             GFSMRS QAKVFKW AP+I+++ G RI + +EY+  KN R+R FL E+PKLK SD   
Sbjct: 311 DHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSDMDT 369

Query: 380 DASHL--SKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTI 437
           +   +  +K K   AVY+ DPWK+TNK++FG  +T I+Q+SP Q+++  +++  +YFNTI
Sbjct: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTI 429

Query: 438 GGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEEN 497
           GGGIGIG+KQP IK+ +K Y PGNVSLT DS LEFAV RH G GG+L PGL+  ++    
Sbjct: 430 GGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD--- 486

Query: 498 SFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGI 557
             FE+  L+QDVEVWGCGGEKELEEQ+KQ  WEE+E+KRRQQIN RS+GEDRALLEMAG+
Sbjct: 487 --FEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGL 544

Query: 558 IGQHQGGGSM 567
           +GQ Q GGS+
Sbjct: 545 VGQAQSGGSV 554

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 253/543 (46%), Positives = 362/543 (66%), Gaps = 8/543 (1%)

Query: 26  DVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVGIVTNM 85
           D+L +FNN++   +   E+  FK  L  ++L+ P++      +L    +++ +  ++ N 
Sbjct: 27  DILDFFNNRSLSILLPMEIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQILLWNF 86

Query: 86  LRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSLQKTDK 145
              +S FP +++  E +TGFG+LK I+LL R R +K+L   +   +KL+FI L+ Q+   
Sbjct: 87  FLKISAFPFLSNRSESMTGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGLTSQE--- 143

Query: 146 XXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPTTNSKT 205
                           ++ ++   D +D     +    ML F++WLL+LSV  PT+N K 
Sbjct: 144 ----KVGVKTEASVFKIQHVLDTLDGIDLASSTVKDTDMLSFITWLLLLSVHCPTSNCKL 199

Query: 206 DNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLFKPLENLM 265
           +    Y++W  ++I A +++R+MN  + +  +   I++  FS  I  V  N+  PLEN++
Sbjct: 200 NEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGIGISYSDFSHTIVAVSKNVMSPLENIV 259

Query: 266 EHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFSM 325
           EH  Y  +DL+      + ++++++MT  L+AQL T LP E+ + +LQ LY+GR+SG+SM
Sbjct: 260 EHMLYKQDDLLEFPCLDTFLKETKLMTYPLVAQLCTVLPNEIVMSQLQKLYVGRESGYSM 319

Query: 326 RSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQKMDASHLS 385
           RSLQ+KVF W A +IL+VSG RI +  EY+  KNPRY+ FL+E+PKLKD DQ+MD  H  
Sbjct: 320 RSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEMDDCHNL 379

Query: 386 KKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIGGGIGIGD 445
           KKK TFAVYID+PW+VTNK+YFG+  T II++SPRQD +   + G++YFNTIGGGIGIG+
Sbjct: 380 KKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGGGIGIGN 439

Query: 446 KQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENSFFELHFL 505
            QP  K  S RY PGNVSLT D+TLEF VFRHTGYGG + P  L  +  EEN  FE+ FL
Sbjct: 440 NQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGGTIGPSELLKKNNEENKAFEIRFL 499

Query: 506 IQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGIIGQH-QGG 564
           I+DVEVWGCGGEKELEEQ+++  WEEAE+KRRQ+IN +++GEDRALLEMAGIIGQH Q G
Sbjct: 500 IRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIGQHGQSG 559

Query: 565 GSM 567
           GS+
Sbjct: 560 GSI 562

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  489 bits (1259), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 268/551 (48%), Positives = 361/551 (65%), Gaps = 12/551 (2%)

Query: 27  VLSYFNNKAQQQVTIPELVSFKGNL-QIENLNTPISHKPLFNVLHFPPNHTIVVGIVTNM 85
           ++ +FN++  +Q+T  EL+SFK N+ + + LN  +    +  + + P +  +++ +  NM
Sbjct: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83

Query: 86  LRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSLQKTDK 145
              L+NFPL+  SYE +T   LLK  LLL + R  K+   K Y+ LK+LFI+LSL+K  K
Sbjct: 84  FHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIK 143

Query: 146 XXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPTTNSKT 205
                         +  K +I  ++  D + L + A+ +L FL+ +L LS      N K 
Sbjct: 144 AEPLMDSSALSDC-KDWKGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCKI 202

Query: 206 DNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVESHFITFEQFSTAIRTVMPNLFKPLEN 263
           DND   +  + FK  A+N++RTMNP+++S  +     IT+ QFS A+  V PNL  PL+ 
Sbjct: 203 DNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKM 262

Query: 264 LMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSGF 323
           LMEH  Y+D DLV  D        ++I+  + L+QL+T LPKE+   + Q LY+GR+SGF
Sbjct: 263 LMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGF 322

Query: 324 SMRSLQAKVFKWMAPSILVVSGMRITNSDE-----YAAEKNPRYRHFLDEFPKLKDSDQK 378
           SMRS Q+KVFKWMAP+IL V GMRI + D+     YA  KNPRYR+FL E+ KLK  DQ 
Sbjct: 323 SMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV-KNPRYRNFLQEYGKLKSEDQH 381

Query: 379 MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVN--QKGTIYFNT 436
           +D     K+K  FAV I DPWKV+NKD FGD +T+IIQ+ PRQ+I+  +  + G +YFNT
Sbjct: 382 LDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNT 441

Query: 437 IGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEE 496
           +GGGIGIG  QP IKA  K+Y PGNVSLT DS+LEF +FRH G GG   PG L   R EE
Sbjct: 442 VGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEE 501

Query: 497 NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAG 556
            + FE  F+IQDVEVWGCGGEKELEEQ+KQ  WEEAE+KRRQ+IN +S+GEDRALLEMAG
Sbjct: 502 RNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAG 561

Query: 557 IIGQHQGGGSM 567
           ++GQHQ GGS+
Sbjct: 562 LVGQHQSGGSI 572

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 240/550 (43%), Positives = 363/550 (66%), Gaps = 5/550 (0%)

Query: 19  KKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIV 78
           K  T+  +++ YFN +   Q +  EL+ FK  L+I++ +T I    ++ +L        +
Sbjct: 20  KDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRL 79

Query: 79  VGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISL 138
             ++ N ++ L+NFP I++  + +T +GLLK I++L + +  K+      + LK+LFI+L
Sbjct: 80  RNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIAL 139

Query: 139 SLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKF 198
                D                 +  I+T +D +    + + +  M+ FL+W+L LS   
Sbjct: 140 G----DYDREEDNKKILDCHNISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVC 195

Query: 199 PTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLF 258
           PT NS  D    ++ W+ ++ SA++L+R+MNPD++   ++  I F QF TA+ T+MP+++
Sbjct: 196 PTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDNQNILFIQFKTALETIMPHVY 255

Query: 259 KPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSLYIG 318
            PLE+L+ H  ++++ L+       S Q+S++MT A+ +QLST L  ++ I KL  LY G
Sbjct: 256 LPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSG 315

Query: 319 RKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQK 378
           R+SGFSMRS Q+K FKW AP+IL++SGMR+T+  EYA +KNPRY+ F+D++P+L+D DQ 
Sbjct: 316 RESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQN 375

Query: 379 MDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIG 438
           ++  H   +K TFAVY+D+PWKV+NK  FG L T I+++SPRQD ++  + G IYFNT+G
Sbjct: 376 LEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVG 435

Query: 439 GGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENS 498
           GGIGIG  QP  K  S  Y PGNVSLT D++LEF  FRHTGYGG ++P  +  ++++   
Sbjct: 436 GGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATR 495

Query: 499 FFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGII 558
            FE+ FLIQD+EVWGCGGEKE++EQ+KQ AWEE E+K+RQ++N +S+GEDRALLEMAGII
Sbjct: 496 TFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGII 555

Query: 559 GQH-QGGGSM 567
           G H   GGS+
Sbjct: 556 GNHAHSGGSL 565

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  472 bits (1214), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 243/552 (44%), Positives = 353/552 (63%), Gaps = 9/552 (1%)

Query: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIE-NLNTPISHKPLFNVLHFPPNHTIVV 79
           F + +++L +F+N+A +Q+   ELV+F+ N+ ++ +L   +S + L  +   P +    V
Sbjct: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78

Query: 80  GIVTNMLRVLSNFPLINS-SYEPITGF-GLLKCILLLNRTRCEKFLKIKSYDQLKLLFIS 137
            +   M+   S FPL+   + E +  F GL+K  LL +  +  K+ + K+YDQ+ L+FI 
Sbjct: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138

Query: 138 LSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVK 197
           L+L+   K                 ++I+  F+D++ E + + AD +LQF+++LL+++ K
Sbjct: 139 LALEPHAKVSKKELGRPPSSY--DARKIMESFNDINLETIEVSADDLLQFMTFLLVIT-K 195

Query: 198 FPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVESHFITFEQFSTAIRTVMP 255
           +    +   N   YE W  ++  A+N+LRTMNP +VS  +   + +T  QF   I  V P
Sbjct: 196 YCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCP 255

Query: 256 NLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQSL 315
           NL  PL   M+H  Y    LVS      + + S +MT  LLAQL T  PK +  Q L+ L
Sbjct: 256 NLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKL 315

Query: 316 YIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDS 375
           +I ++SGFS+RS QAKV  WMAPSIL+VSGM+I +  +  A KN RY+ FL E+PKLKD 
Sbjct: 316 FIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPKLKDE 374

Query: 376 DQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFN 435
           DQK D+    K+K TFAV++ + WKVTNK+ FG+L T I+Q+SPRQ++++ ++ G IYFN
Sbjct: 375 DQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFN 434

Query: 436 TIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKE 495
           T+GGGIGIG+ QP IK++ K+Y PGNVSLT D + EF VFR+ G+GG + PG L +ER +
Sbjct: 435 TVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPD 494

Query: 496 ENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555
                E  F+IQDVEVWGCGG+KE E Q+KQ  WEEAES+RRQ IN  S+GED+ALLEM 
Sbjct: 495 VEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMV 554

Query: 556 GIIGQHQGGGSM 567
           G++G HQ GGS+
Sbjct: 555 GLVGHHQSGGSL 566

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  469 bits (1206), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 238/553 (43%), Positives = 345/553 (62%), Gaps = 21/553 (3%)

Query: 20  KFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFP--PNHTI 77
           +F    ++L YFN +  +  T+ E+ +FK      +LN PI    +   L+    PN   
Sbjct: 19  QFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDTLIKEALYLDAQPN--- 75

Query: 78  VVGIVTNMLRVLSNFPLINSSY-EPITGFGLLKCILLLNRTRCEKFLK--IKSYDQLKLL 134
           V   V+  +R+L NFPL +    + ITGFGLLK I ++N  R EK +   I  YD    +
Sbjct: 76  VWSAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYD----I 131

Query: 135 FISLSLQKTDKXXXXXXXXXXXXXXRHVKQIITDFDDVDTEMLCLPADFMLQFLSWLLIL 194
            ++L L    K               ++  I+  +D ++ E + +P D ++  ++WLL L
Sbjct: 132 TVTLGLCGQAKESENKIKST------NLGDILKTYDHIEIESIHIPYDKLILLVAWLLTL 185

Query: 195 SVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVM 254
                TTN K +   T   W+ FK SA+++  T++   + N     I       A  T+M
Sbjct: 186 VTGVATTNCKVELSDTIANWNNFKSSAISIANTISTSALGNANDIGIPATDILNAFNTIM 245

Query: 255 PNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQKLQS 314
            +L   + NL EH  +  +DL+    +L+++    ++TP+L AQ+  GLP  + I KLQ 
Sbjct: 246 ISLVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGLPNSITITKLQK 305

Query: 315 LYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKD 374
           LY+G++SGFSMRSLQ+KVF+W AP++++VSG RI++ + YA  KNPRYR FL  FPKL++
Sbjct: 306 LYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLRE 365

Query: 375 SDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYF 434
           +DQ +DA HL+KKK T+AVYID+PWKV+NK+ FG  N  I++++P+Q  Y+   + T+YF
Sbjct: 366 NDQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYF 425

Query: 435 NTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERK 494
           NTIGGGIG+G +QP +K    ++IPGN+SLT DS+LEF VFRH G GG     LL     
Sbjct: 426 NTIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLD---N 482

Query: 495 EENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEM 554
           +++  FE+ F+IQ+VEVWGCGGEKEL EQ+KQ+ WEEAE+KRRQ IN +SL ED+ALLEM
Sbjct: 483 DDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEM 542

Query: 555 AGIIGQHQGGGSM 567
            G++GQHQ GGS+
Sbjct: 543 VGLVGQHQSGGSV 555

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  464 bits (1193), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 235/552 (42%), Positives = 344/552 (62%), Gaps = 21/552 (3%)

Query: 31  FNNKAQQQVTIPELVSFKGNLQI-ENLNTPISHKPLFNVL------HFPPNHTIVVGIVT 83
           +N++  +Q    EL +FK  + +   LN  +  + L   L      H      ++VG++ 
Sbjct: 32  YNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPSKLLVGVI- 90

Query: 84  NMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISLSLQKT 143
              +VL  FP I+++   +T   LLK ++L+NR +C K++  KSY+ L+L+F++L L + 
Sbjct: 91  ---KVLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALYLAQ- 146

Query: 144 DKXXXXXXXXXXXXXXRHVKQIITDFD---DVDTEMLCLPADFMLQFLSWLLILSVKFPT 200
           D                +++++I+ +D   D  +E + + AD +LQF + LL+LS + P 
Sbjct: 147 DSHDSTKKESYDPKEPHNIEKVISSYDGNSDCVSE-ITVQADNLLQFTTMLLLLSARIPR 205

Query: 201 TNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLFKP 260
            NS+ D       W  ++ SA N++RTMN  ++S+ ++H I+F QF   I  ++P +   
Sbjct: 206 PNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIISSCQTHTISFHQFYDVISILLPTILTT 265

Query: 261 LENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELF-IQKLQSLYIGR 319
           L+NL++H  Y  + LV   A   +  ++++M     A L   L  + + I KLQ LY+GR
Sbjct: 266 LDNLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLYVGR 325

Query: 320 KSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQKM 379
            SGFSMRS Q KVF W AP++L VSG RI + D+Y+  KNPRY  FL++F KL+D+DQ++
Sbjct: 326 DSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLRDTDQQL 385

Query: 380 DASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIGG 439
               L K+K  F +YI+ PW+VTNKDYF    T I Q+SP  DI+K N+   +YFNT+GG
Sbjct: 386 SPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYFNTMGG 445

Query: 440 GIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEE--- 496
           GIGIGD QP+ K   + Y PGN+SLT DS+LEF  FR+ G GG+ +PG L   R  +   
Sbjct: 446 GIGIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVV 505

Query: 497 -NSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555
            ++ +EL FLIQDVEVWGCGGEKEL EQ+KQ+ WEE E+KRRQ +N +SL EDRALLEMA
Sbjct: 506 TSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRALLEMA 565

Query: 556 GIIGQHQGGGSM 567
           G++GQHQ GGS+
Sbjct: 566 GLVGQHQSGGSI 577

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  356 bits (914), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/556 (36%), Positives = 309/556 (55%), Gaps = 26/556 (4%)

Query: 21  FTNNRDVLSYFNNKAQQQVTIPELVSFKGNL--QIENLNTPISHKPLFNVLHFPPNHTIV 78
           FT+   ++++FN +A +Q++  E  +F  N+   IE     +  + L  +   P +    
Sbjct: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE-LDLQALATLYGVPADVPWF 77

Query: 79  VGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCEKFLKIKSYDQLKLLFISL 138
             +    +  L++FPL+N    P T  GLLK  LL N+ R  ++   KSYD   L+   L
Sbjct: 78  TEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDVASLVLALL 136

Query: 139 SLQKTDKXXXXXXXXXXXXXXRHVKQ-----IITDFDDVDTEMLCLPADFMLQFLSWLLI 193
           +  +                  +V Q     +I   D      L +  + ++++  ++  
Sbjct: 137 APPRD-------------ACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQ 183

Query: 194 LSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVESHFITFEQFSTAIR 251
           +S     +N        +  W+      + LLR+++  +VS  +  S  IT++QF+  +R
Sbjct: 184 ISQVCNGSNEPLSR-SMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLR 242

Query: 252 TVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLAQLSTGLPKELFIQK 311
           +V PN+F  L   +E  FY+  D  ++     + + S I+T  LL QLST  P+      
Sbjct: 243 SVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTS 302

Query: 312 LQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPK 371
           +Q L++   +GFSM   QAKVFKWMAP+IL VSG RI + DE    KN RY+ FL ++P 
Sbjct: 303 MQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD-DEIVCTKNKRYKAFLQDYPA 361

Query: 372 LKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGT 431
           LKD++Q++      K+   +A+++ DPWK+TNKD FGD++T IIQ++PRQ I+K  +   
Sbjct: 362 LKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPN 421

Query: 432 IYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSM 491
           IYFN +GGGIG G  QP +K A KRY PGNVS T D ++EFAVFR+ G GG+   G    
Sbjct: 422 IYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVP 481

Query: 492 ERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRAL 551
              E+   +E   +I+D+EVWG GGE+EL++QI++  WEEAE+ +R+ I      EDRAL
Sbjct: 482 APAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRAL 541

Query: 552 LEMAGIIGQHQGGGSM 567
           LEMAGI+G +Q GGS+
Sbjct: 542 LEMAGIVGHYQSGGSV 557

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  288 bits (738), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 197/536 (36%), Positives = 298/536 (55%), Gaps = 71/536 (13%)

Query: 32  NNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVGIVTNMLRVLSN 91
           N   ++  T+ EL++F+  +   +L+  IS K +    + P +   +  +    +R L+ 
Sbjct: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76

Query: 92  FPLINSSYEPITGFGLLKCILLLNRTRCEK-FLKIKSYDQLKLLFISLSLQKTDKXXXXX 150
           +P   S+   ITG+  LK I LLN+ R  K F KI   + +K++F+ LS ++        
Sbjct: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKI---EWIKIIFMCLSDEEVQ------ 124

Query: 151 XXXXXXXXXRHVKQIITDFDDVDT--EMLCLPADFMLQFLSWLLILSVKFPTTNSKTDND 208
                             F   +T  ++  L  D +++F+S LL L++   T     + D
Sbjct: 125 ------------------FPCWETTHDIHVLEND-LIEFISLLLTLNMNCCTDYCLINQD 165

Query: 209 KTY--EQWDTF-KISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLFKPLENLM 265
            T+    WDT+ + SA  ++R M      NVE     FE     +  ++PN+F  L+NL+
Sbjct: 166 LTFNDHDWDTYWRKSASCIVRDMKE---CNVEE----FEN----VLLIVPNIFDCLKNLI 214

Query: 266 EHFFYLDNDLVSRDANLSSIQDSRI-MTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFS 324
           EH  Y  + L  ++  L   Q ++  M  A+L Q+   + K      +  LYIGR++G+S
Sbjct: 215 EHSLYTKDQL--KECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYS 270

Query: 325 MRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQKMDASHL 384
           MRS Q+KVFKW AP+IL+++G +I N  EY +EKN RY+ FL+ +P+LKD       +  
Sbjct: 271 MRSFQSKVFKWKAPTILLITGKKIINDQEY-SEKNNRYKSFLNSYPRLKDG----KTTFQ 325

Query: 385 SKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIGGGIGIG 444
           +    TFA+YI++PWK+T K YFG L+T+IIQ+SPRQD++       +YF+T   GIGIG
Sbjct: 326 TPLHYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIG 383

Query: 445 DKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENSFFELHF 504
           ++     ++  +Y PGNVS+T DSTLEFAVFRH+G      PG+           FE+  
Sbjct: 384 NEH---MSSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRL 434

Query: 505 LIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMAGIIGQ 560
            IQ VEVWGCGG KEL EQ  +  WEE E++RRQ ++   + EDRALLE+AGIIG+
Sbjct: 435 HIQSVEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIGE 489

>TBLA0A05290 Chr1 (1293365..1297129) [3765 bp, 1254 aa] {ON}
           Anc_1.66 YLR187W
          Length = 1254

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 163 KQIITDFDDVDTEMLCLPADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQW 214
           K++I+D DDV++ +  LP    L    + L +   FP  NS T ND   + W
Sbjct: 412 KKLISDKDDVNSLLFALPLSPHL----YYLKIEDLFPLANSSTSNDWNIQDW 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,147,259
Number of extensions: 2681206
Number of successful extensions: 7556
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7693
Number of HSP's successfully gapped: 35
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)