Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.2795.426ON1460146077310.0
Smik_15.2945.426ON1460146075280.0
YOR116C (RPO31)5.426ON1460146075130.0
Suva_8.1695.426ON1460146074950.0
NDAI0C016205.426ON1460146068610.0
NCAS0H020405.426ON1460146068550.0
TDEL0E019905.426ON1460146068220.0
KAFR0D050305.426ON1462145768070.0
Kpol_1016.95.426ON1460146067170.0
SAKL0G02354g5.426ON1458146067030.0
ZYRO0F09856g5.426ON1458146066720.0
CAGL0L11660g5.426ON1459145966480.0
KLTH0F16236g5.426ON1460146165630.0
TBLA0A037205.426ON1458146065580.0
KNAG0B042405.426ON1455146165200.0
AER252C5.426ON1459146064540.0
KLLA0E21253g5.426ON1457146064510.0
Ecym_55255.426ON1459146064400.0
TPHA0H017605.426ON1459145264290.0
Kwal_55.214595.426ON1148114551520.0
KNAG0C039707.314ON1721150018720.0
TPHA0A030707.314ON1719152018720.0
Ecym_80657.314ON1743150718670.0
Suva_4.1047.314ON1733151418610.0
ZYRO0F05918g7.314ON1744151618620.0
KLLA0F05071g7.314ON1720151418590.0
Smik_4.957.314ON1719151518570.0
KLTH0H02046g7.314ON1740153218560.0
YDL140C (RPO21)7.314ON1733151418560.0
KAFR0B010607.314ON1685151618470.0
Skud_4.1147.314ON1726151618480.0
NDAI0A021307.314ON1729151118440.0
Kwal_56.244897.314ON1728153218410.0
ADR086C7.314ON1745151418300.0
CAGL0I03828g7.314ON1715151118220.0
NCAS0A139007.314ON1716151918170.0
TDEL0C023207.314ON1727149818000.0
SAKL0F10472g7.314ON1730128217070.0
Kpol_162.1singletonON1311116816420.0
Kwal_55.21464singletonOFF32031713871e-180
TBLA0F021707.314ON1726100014311e-169
CAGL0E05500g7.51ON164398211561e-132
TPHA0H028007.51ON1648107411561e-132
TDEL0H040007.51ON166597011391e-129
ZYRO0D04532g7.51ON166797811331e-129
Skud_15.5067.51ON166598111221e-127
YOR341W (RPA190)7.51ON166497711211e-127
Smik_15.5197.51ON166598011161e-126
TBLA0E019307.51ON165998111141e-126
KAFR0K005407.51ON166296811151e-126
NCAS0F007307.51ON167491211141e-126
KNAG0D049707.51ON167197311111e-126
Kwal_26.69797.51ON165498611081e-125
KLTH0D01628g7.51ON165498411071e-125
Suva_8.3917.51ON166598011051e-125
KLLA0F23243g7.51ON165398611031e-125
NDAI0H012007.51ON166991310991e-124
ADR374C7.51ON164097910691e-120
SAKL0B10736g7.51ON165097810401e-116
Kpol_1040.37.51ON16567269571e-106
Kpol_1019.277.314ON3642911922e-14
TPHA0H014405.359ON875128782.2
Suva_13.4108.752ON267114736.5
TDEL0F040708.280ON287126729.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.279
         (1460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2982   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2904   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2898   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2891   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2647   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2645   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2632   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2626   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2591   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2586   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2574   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2565   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2532   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2530   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2516   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2490   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2489   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2485   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2481   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1989   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   725   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   725   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   723   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   721   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   721   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   720   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   719   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   719   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   719   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   716   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   716   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   714   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   713   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   709   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   706   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   704   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   697   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   662   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   637   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   538   e-180
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   555   e-169
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   449   e-132
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   449   e-132
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   443   e-129
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   441   e-129
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   436   e-127
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   436   e-127
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   434   e-126
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   433   e-126
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   434   e-126
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   433   e-126
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   432   e-126
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   431   e-125
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   431   e-125
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   430   e-125
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   429   e-125
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   427   e-124
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   416   e-120
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   405   e-116
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   373   e-106
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    79   2e-14
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    35   2.2  
Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {O...    33   6.5  
TDEL0F04070 Chr6 complement(753401..754264) [864 bp, 287 aa] {ON...    32   9.1  

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2982 bits (7731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1440/1460 (98%), Positives = 1440/1460 (98%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            LVPKPCLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2904 bits (7528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1399/1460 (95%), Positives = 1422/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSA+LLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RHFL ELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT+PSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELITLFNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN+DEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +T NEILRPLEERLVRYDN G LVKEE+ ++AEYVDQYDAERDFYRSL+EYINLKATALA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGM E LEPP KE E +D D+ VPDNV+TSVSQLYRISEKSVRKFLEIAL+KYRK
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRA+KLKIQASDVNIIGKD+IAINVFPEGYKA+SISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDD KRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            LVPKPCLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2898 bits (7513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1401/1460 (95%), Positives = 1417/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSA+LLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVL HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT+PSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQELI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIE FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFVIIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELITLFNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN+D+GLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +TANEIL PLEERLVRYDN G LVK ED ++AEYVDQYDAERDFY SLREYIN KATALA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGM   LEPP KEL+GID DE VPDNV+TSVSQLYRISEKSVRKFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVA+YVQDVYKDNLSFIQVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRASKLKIQASDVNIIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGLPDISRAVINIRDD KRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            LVPK CLFESLSNEAALKAN
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2891 bits (7495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1388/1460 (95%), Positives = 1418/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAP+ANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LEC TCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSA+LLSETDK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT+PSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLK+NEDARRNLRYGDRMKLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL MMSDG+EQFDVPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLIKP+H SPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAYRKCDELIT FNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+N+DEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +TAN+IL PLE+RLVRYDNRG LVK+EDKD+AE+VDQYDAERDFYRSLREYINLKAT LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            NLRKSRGM E +  P KEL+G+D DEAVP NVRTSVSQLYRISE+SV+KFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRASKLKIQA DV IIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGL DISRAVINIRDD KRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSI+REINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L+PKPCLFESLSNEAALKAN
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2647 bits (6861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1259/1460 (86%), Positives = 1357/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSEVE+S+RDLFDLEK R PK  GALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSA+LLS+ D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL+ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            D FRWVGKKSAPEKD WVG+WKEVL+H+PELER+VKRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG+++T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNR KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NEDARRNLRYGDR+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMM D   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            +YLWTGKQ+FSLLIKPN +SPVVINLDAKNKV++PPK+K+ P+EMS+NDG+VIIRGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+ +  GLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +T N IL+PLE+RL+RYDN G +V  ED  +AEYVDQ+DAERDFY+SLR+Y++ KA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RKSRGM   ++ P +EL+ ++ DE VP+ +R SV QLY+I+E  V+KFLEIAL+KYRK
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVAYY+QDVYKDNLSFIQVRIDL+TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+A+TRA KLKI  SDVNIIGKD+IAINVFPEGYKAKSIST+AKEP+EN VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGLP+I+RAVINIRDD KRELLVEGYGLRDVMCTDGVIG KTTTNH+L
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT I+++ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L++  ++K N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2645 bits (6855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1262/1460 (86%), Positives = 1352/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSE+EVS+RDLFDLEK R PK  GALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CK CSA+LL++ DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WKEVL+H+PELER++KRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK+NEDARRNLRYGDR+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMS+G  +FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKVF+PPK K  P+EMS+NDG+V+IRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  F+KG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+N ++GLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  NEIL+PLEERL+RYDN G LV ++D ++AEYVDQ+DAERDFYRSLR+YI  KA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RKSRGM E    P +EL  +D DE + ++++ SV QLY+I+EKSV+ FLEIAL+KYRK
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSD+AYY+QDVYKDNLSFIQVR+DL TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AIT+A KLKIQ SDVNI+GKD+IAINV+P+GYKAKSIST AKEPS N VFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRR LP +VVKG  DISRAVINIRDD KRELLVEGYGLRDVMCTDGVIG KTTTNH+L
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFE LSN    K N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2632 bits (6822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1254/1460 (85%), Positives = 1348/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+A GALDPKMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSAVLL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RHFL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++EDARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLLSMMSDG  QFD+P PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLIKPN  SPVVINLDAKNKVF+PPKSKSLPSEMSQNDG+VIIRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI  +NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNN + GL PY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  ++IL PL  RL+RYDN G LV +E     EY+DQ DAER+FY SL+ ++  KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RK RGM E L+ P  E + ID DE VP+N+R SV QL RI+  SVR+FL+IA+ KYR+
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLSF+QVRIDL+TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRA KLKIQASDV I+ KD+IAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRR+LP +VVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+KGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFESLS E A+KAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2626 bits (6807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1244/1457 (85%), Positives = 1352/1457 (92%), Gaps = 1/1457 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  K NGALDP+MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+L C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS+VLLS+ DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RHFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXII 179
            + +LHELR  G +DNL++MGILKK++DQCKKQRRCLHC                    II
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQEL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479
            ++NGPN+HPGANYLLK+NE+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMMSDG  QFD+PPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQI 659
            PYYLWTGKQ+FSLLIKPNH SPVVINLDAKNKV++PPKSKSLP+EMS+NDGFVIIRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  ADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779
            ADDLK KKEELVEIAY KCD+LI  +NKG+LETQPGCNEE+TLEAKIGG LSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAI 959
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN + GLLPY +
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  MKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATAL 1019
            MK  NE+L PLEERLVRYDN G+ V +ED D+ EY DQ+DAERDFY++LR YI  K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1020 ANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079
            A++RKSRG+ E L  P +EL+ +  DE   D  R+SV QL +I+EK+V KFLEIAL KYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK+ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGRVEKT+LSDVAYY+QDVYKDNLSF+Q+RIDL+TI+KLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIA+A+T+A KLKIQASDV+I G D++ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQQLRRALP +VVKGLP+I+RAVINIRDD KRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVKGT+I  +
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1440 DLVPKPCLFESLSNEAA 1456
            DL PKP LFESLS+ ++
Sbjct: 1441 DLKPKPTLFESLSSASS 1457

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2591 bits (6717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1230/1460 (84%), Positives = 1335/1460 (91%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVVSETPK+I GLEFSALSA+DIVAQSEVEVSTRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS++EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCS++LL++TD+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPG+DNL+RM I+KKILDQCKKQRRCL C                    IIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS+PEKD WVG+W++VL +NPELER+ KR MDDLNPLKTLNLFKQI+  DCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP+M+PG+S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LK NE+ARRNLRYGDR+K+AK L++GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRAT TQLLSMMSD   QFD+PPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            Y LWTGKQ+FSLLIKPN +SPVVINLDAKNKVF+PPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            + LKQKKEELVEIAY KCDELI LF KG+LETQPGCNEEQTLEAKIGG LSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNF RSWDHA NITF+N  +GLLPYAI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
               N+IL P EERL+RYDN G+LVK  D+ + E+VDQ D+ER+FY SLR+Y+  KA+ LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RK +G+ E    P  E + +DLDE      R +V +L +I+EK+V KFLEIA+ KYR+
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDND+RAARVVKGR+EKTLLSDVAYYVQDVYKDNLSF++V+IDLSTIDKLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+A+TRA KLKIQ +DV I+ KD+I I+V+PEG KAKSISTS KEPSENDVFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VV GLPDI+RAVINIRDD KRELLVEGYGLR+VMCTDGVIGSKTTTNHVL
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FK++K T I   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PK  LFE+L  E ALK N
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2586 bits (6703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1229/1460 (84%), Positives = 1339/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R PK  GALD KMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC+++LLS+ DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ + SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+ KLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN+HPGANYLLK+N+DARRNLRYGDRMKLAKNLQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSDG  QFD+PPPA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            +YLWTGKQVFSLLI+PN  SPV+IN+DAKNKVF+PPK K LP+EMS NDGFV+IRGS+IL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  N IL+PLE++LVR+DN G+ + +ED+++ EY+DQ+DAER+FY+SLR+Y+  KAT LA
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RK++G+   L+ P  EL+ ++LDE  P+ + T+V+QL +IS+  V  FL IA+ KY +
Sbjct: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVND DERAARVVKGR+EKT+LSDV YY+QDVYKDNLSFIQ ++DL TI+KLQLEL
Sbjct: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRASKLKI  +DV+I+G+++I INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGLPDISRAVINIRDD KRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            E+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT+ISE+D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PK  LFESL N+ ALK +
Sbjct: 1439 LKPKHTLFESLCNDVALKTH 1458

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2574 bits (6672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1224/1460 (83%), Positives = 1342/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS++EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS++LL +TDK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            +HFL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEK+ W+G+W  VL H+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TI SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNGPN +PGANYLLK++EDARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLLSMMSDG  QFD+PPP I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
             YLWTGKQ+FSLLI+PN  SPVV+NLDAKNKV++PPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            ++LK+KKEE+VE AY KCDELI LF+KG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN D GLLPY IM
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +   EIL+PLE RLVRYDN G+ + +E++DR EY+DQ DAER FY SLR++I  KA  LA
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
              R S+ M E ++ P  EL+ +DLDE VP+++R SV Q+YRI++K VR+FL +A+ KYR+
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVN++DERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLS++QVR+DLSTIDKLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+A+TRA KLKIQASDV+I+GKD+IAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALP +VVKGL DISRAVINIRDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE+ 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFESL NE ++K N
Sbjct: 1439 LKPKPTLFESLVNETSVKVN 1458

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2565 bits (6648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1232/1459 (84%), Positives = 1336/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+PK  GALDP+MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            S+S++EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSA+LLSE DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RHFL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK+NE+ARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLLSMMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLIKPN NSPV INLDAKNKV++PPK K  P+EMSQNDGFVI+RGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI L+NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN D GLLPY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            KT + IL+PLE+RL+RYD  G  V  ED    +YVDQ+D+ER FY SLRE++  KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLD-EAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079
             LRKSRG+ + ++  + ELEG D + E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 KLRKSRGLPKLIK--KSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGR+EKTLLSDV YY+QDVYK+N++++QV++DL+TIDKLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIAIAITRA KLKIQ SDV ++GKD+IAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRRALP ++VKGL DI+RAVINIRDD KRELLVEGYGLRDVMCTDGVIG+KT TNHV
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1440 DLVPKPCLFESLSNEAALK 1458
            +L PK  LFESL++  A K
Sbjct: 1439 ELKPKRTLFESLTSNVANK 1457

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2532 bits (6563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1461 (82%), Positives = 1318/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
              FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VL HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLK++E+ARRNLRYGDRMKLA+NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLLSMMSDG  QFD+PPP+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KSLP+EMS NDG+V+IRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKE +VE AY KCD LI LFNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ D+ LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  N +L+PLEE+LVRYDN G+ +    +DR EY+DQ DAER+FY+SLR+Y+  KA+ LA
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            N+R  +G+ E L+ P  EL+ +DLDE  P +   SV QL +IS K V KFLEIA+FKY K
Sbjct: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDN+SF+QV++DL TI+KLQLEL
Sbjct: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIA+AITRA+KLKI ASDV+I+GKD++ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGLPDI+RAVINI+DD  RELLVEGYGLR+VM TDGVIG KT TNH+L
Sbjct: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGT+ISE D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439

Query: 1441 LVPKPCLFESLSNE-AALKAN 1460
            L PKP LFESL +   ALK N
Sbjct: 1440 LAPKPTLFESLCDSVTALKVN 1460

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2530 bits (6558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1216/1460 (83%), Positives = 1312/1460 (89%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEV ++TRDL+DLE  RAPK +GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICK+C+AVLLS+ DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPG+DNL+RMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD WVG+W+EVL+HNPELER+VKR MDDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP ++PG+S G  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYN+ KLQ L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK++E+ARRNLRYGD++KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLLSMM DG  QFD+PPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
             YLWTGKQ+FSLLIKPN NSPVVIN+DAKNKVF PPK KSLPSEMS NDGFV+IRGSQIL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            D LK  KE LVEIAY KCDELI L+N+G+LETQPGCNEEQTLEAKI G LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP +MEGNAQPVNFNRSWDHAYNI F+N D+ + PY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  N+IL PLEE+L+RYDN G +V  E+  + E+VDQ DAER+FY SLR+Y+  KA  LA
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++RKSRGM E L  P  E + +DLDE  PD++R SV Q+ RI+E +VR+FL+IA+ KYR+
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRR 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1080 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVAYY+QD YKDN S+++V+IDL TI+KLQLEL
Sbjct: 1140 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLEL 1199

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+ DIA AI RA KLKIQ  DV      +I I+V PE   +K IS SAKEP EN+VFYRM
Sbjct: 1200 TMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGLPDI+RAVINIRD+ KRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1259 QHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV SVLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGT 1438

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PK  LFESL  E  +K N
Sbjct: 1439 LKPKRTLFESLCKETNIKIN 1458

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2516 bits (6520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/1461 (81%), Positives = 1318/1461 (90%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  K  GALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS+ EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSAVLLS+ D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                    IIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD W+GEW E+LTH+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++T+ SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NE+ARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLLSMMSD   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YYLWTGKQVFSLLI+PN  SPVVINLDAKNKV++PPK KS P+EMS NDGFVIIRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI +F  G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPY I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  + +L+PLEE+L+RYDN G++V +E  D   Y D++DAER FY+SLR Y+  KA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLD-EAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079
             +R +RG+ E  +       G D   E V   ++ SV Q+Y+I++K+V  FL IAL KY 
Sbjct: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199
            IINAVLVN+ DERAARVVKGR+EKTLLSD+A+Y+QDVY+ N+S++++R+DL+TI+KLQLE
Sbjct: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194

Query: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LT+EDIA+A++RA KLKIQ +D++I+GKD+I +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRR+LPDVVVKGLPDISRAVINIRDD KRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  ++SE+
Sbjct: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434

Query: 1440 DLVPKPCLFESLSNEAALKAN 1460
            DL  +P LFESL++E A+KAN
Sbjct: 1435 DLKVRPTLFESLASETAIKAN 1455

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2490 bits (6454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1460 (81%), Positives = 1305/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD +MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            VNG NVHPGANYLLK+NE+ARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+LSMMSDG  QFD+PPPAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            +YLWTGKQ+FSLLIKPN  SPV+INLDAKNKV++ PK+K+ P+EMS NDG+V+IRGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK  KEE+VEIAY KCDELI L+ +G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N++D+G+LPY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  N IL PLE++L RYDN G+ +    ++   Y+DQ+DAER+FY+SLR Y++ KA  LA
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            ++ KSRG+ E    P  EL+ +DLD + P+    SV+QL +IS K VR FL+IA+ KYRK
Sbjct: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INA LVND+DERAARVVKGRVEKTLLSDV +Y+QDVY+DN+SF+QV++DL+TI+KLQLEL
Sbjct: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIAIAIT A KLKI   DV+I+G+++I INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGLPDISRAVINIRDD KRELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L +   LK N
Sbjct: 1440 LKPKPTLFENLCSLNTLKVN 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2489 bits (6451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1460 (81%), Positives = 1298/1460 (88%), Gaps = 3/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ K  GALDP+MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLRRM ILKKILDQCKKQRRC  C                    IIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQ+L+
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLK+NEDARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLLSMMSD   QFD+PPP+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            +YLWTGKQVFSLLIKP+  SPVVINLDAKNKV++PP  K  P+EMSQNDGFV+IRGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DLKQKKE++VE AY KCDELI LFNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
               N IL+PLE +L RYDN G  +++ED+ + EY+DQ+DAER FY+SLRE++  KA  LA
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
            +LR  RG+ E ++ P +EL   + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDV++YVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDI +AI +A KLKI  +D++IIGKD+I I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALP +VVKG  DISRAVINIRDD KRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR  II EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L  +  +KAN
Sbjct: 1439 LTPKPTLFETLC-DTVVKAN 1457

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2485 bits (6440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1460 (81%), Positives = 1301/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PK+IKGL FSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQ ICKNC+A+LLSE +K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLRRM  L+K+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+W +VL HNPELERY+KR MD+LNPLKTLNLFKQ+++ DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYN+ KLQ+LI
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LK+NEDARRNLRYGDR+KLAKN+QIGDVVERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSF+DRAT TQLLSMM+D   QFD+PPPAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
             YLWTGKQVFSLLI+PN  SPV+INLDAKNKV++PPK+KS P+EMS NDG+VIIRGS+IL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
             GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKEE+VEIAY KCDELI LF +GELETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNTVRTS+NG+VQFTYGGDGLDPL MEGNAQPVNFNRSWDHA NITFNNE+ GLLPY IM
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +T+N IL PLE +L+R DN G+ +  +     EY+DQ DAERDFY+SLR Y+  KA  LA
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +RKS+G+   LE P +EL+ +DLD +       S++QL +IS   V  FL IA+ KY K
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASK ISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200
            INA+LVNDNDERAARVVKGR+EKTLLSDV +Y+QDVY+DN+SFIQV++DLSTI+KLQLEL
Sbjct: 1140 INALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLEL 1199

Query: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAIAI+RA KLKI   DV+IIGK++I I+V  +  K KSIST   EP+ENDVFYRM
Sbjct: 1200 TIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRM 1259

Query: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP++VVKGLPDISRAVINI +D KRELLVEGYGLRDVM TDGVIG KT TNH L
Sbjct: 1260 QHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVF VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV+GTNIS  +
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDE 1439

Query: 1441 LVPKPCLFESLSNEAALKAN 1460
            L P P LFE+L N  ALK +
Sbjct: 1440 LKPNPTLFENLCNNTALKVS 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2481 bits (6429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1183/1452 (81%), Positives = 1314/1452 (90%), Gaps = 4/1452 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVV+SETPKRI GLEFSALS +DI+AQSEVE+STRDLFDLE  RAP   GALDPKMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSSTLEC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQILQG+CK+CSA+LL++TDK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RHFLHELR+P +DNL+RM ILKKILDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK+ PEKD W+G+W +VLT+NPELE+++KRC DDLNPLKTLNLFKQIK+ DCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVN  ++PGS NGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGS-NGGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NE+ARRNLRYG+R KLAK L+IGD+VERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLLSMMSD   +FD+PPPAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQI 659
            P  LWTGKQ+FSLLIKPN  SPVVINLDAKNKV++PP++KS PSEMS NDG+VIIRGS+I
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQE+ANAMNRMAKLCAR+LGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  ADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779
             ++LK KKE+LVEIAY+KCDELI  +NKGELETQPGCNEEQTLEAKIGG LSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAI 959
            YDNT+RTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA NITF+   +GLLPY I
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  MKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATAL 1019
            +K  N IL+PLE  LVRY+N G  + ++D  + EYVDQ DA+RDFY S+REY+  KA  L
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 ANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079
            A +RK+R + E +  P +EL+ ID DE +P NVR  V +L +ISE +V+KFLEIA+ KY 
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYH 1079

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK+ISTP
Sbjct: 1080 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1139

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199
            II AVLVND+D RAARVVKGR+EKTLLSDVAYY++DVY+DN +FI+++IDLSTI+KLQLE
Sbjct: 1140 IIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLE 1199

Query: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIAIAI++A KLKI +S+++I+G D+IAI+VF E   +KSISTS KE SEN VFY+
Sbjct: 1200 LTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYK 1257

Query: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRRALPDVVVKGL DISRAVINI+DD+K ELLVEGYGLRDVMCTDGVIG+KT+TNH+
Sbjct: 1258 MQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHI 1317

Query: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1377

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF VVK T +S +
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPE 1437

Query: 1440 DLVPKPCLFESL 1451
             + PK  LFESL
Sbjct: 1438 QVKPKRTLFESL 1449

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1989 bits (5152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 939/1145 (82%), Positives = 1024/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R PK+ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLK++E+ARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLLSMMSDG  QFD+PPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660
            YY+WTGKQVFSLLI+PN  S VVINLDAKNKV++PPK K LP+EMS NDGFV+IRGSQIL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN+ D+ LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020
            +  N IL+PLEE+LVRYDN G  +    +DRAE++DQ DAER+FY+SLREY++ KA+ LA
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080
             +R  +G+ + L+ P  EL+ +DLDE  P  +  SV QL +IS K V KFLEIA+FKY K
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVL 1145
            INAVL
Sbjct: 1140 INAVL 1144

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1500 (33%), Positives = 783/1500 (52%), Gaps = 138/1500 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKR-HFL 124
            +C TC   ++ C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +++   +
Sbjct: 66   KCQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQV 125

Query: 125  HELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFR 184
              ++ P     +R      +   CK +   + C                        T R
Sbjct: 126  MAIKDPK----KRFNATWAL---CKTK---MVCETDVPSENDPTKLVSRGGCGNTQPTVR 175

Query: 185  WVGKKSAPEKDIWVGEWKEVLT-HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
              G K        VG WK   T    E E+ V      L+  + LN+FK I + D   LG
Sbjct: 176  KDGLK-------LVGSWKRKKTIEGEEPEQRV------LSTEEILNIFKHISTEDFIRLG 222

Query: 244  IDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 223  FNEEF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 279

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 280  HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 333

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+ N
Sbjct: 334  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 393

Query: 423  GPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH+
Sbjct: 394  GPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 451

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 452  MSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 511

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPPPAI 597
            +P+S +P +   QD + G  +++ +D+F +   L  +L+M+      DG+    +P PAI
Sbjct: 512  SPQSNKPCMGIVQDTLCGIRILTLRDTFLE---LDHVLNMLYWVPDWDGV----IPTPAI 564

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGS 657
            +KP  LWTGKQ+ S+ I    N   +   D    +  P           +++G +II G 
Sbjct: 565  LKPKPLWTGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGMLIIDG- 609

Query: 658  QILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND- 716
            QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D 
Sbjct: 610  QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDT 668

Query: 717  VTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREE 776
            +     +K+  E + E A +K +E+        L  + G    ++ E  +  FL++ R++
Sbjct: 669  IADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 727

Query: 777  VGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 728  AGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 787

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 788  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 847

Query: 897  SCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDEGL 954
               YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N    L
Sbjct: 848  MVHYDNTTRNSLGNVIQFIYGEDGIDASYIEKQSLDTIGGSDAAFEKKYRIDLMNVQNSL 907

Query: 955  LPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD------------------ 996
             P  ++++ +EI   L+ + +  +    LVK+    R  +VD                  
Sbjct: 908  DP-TLLESGSEITGDLKLQTLLDEEYKQLVKDRAFLRNVFVDGESNWPLPVNIRRIIQNA 966

Query: 997  ----QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNV 1052
                + D  +    ++R+ I+      + L   RG  E +E  + +   +          
Sbjct: 967  QQTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEIIERAQTDAVTLFCCLVRSRLA 1026

Query: 1053 RTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFA 1112
               V + YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFA
Sbjct: 1027 TRRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1086

Query: 1113 GVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K++ TP +   L +D  +D+  A++++  +E T L  V 
Sbjct: 1087 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVT 1146

Query: 1171 -----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL-----TIEDI 1205
                 YY  D    V +++   IQ+   L      S++D+     L+LEL       +D+
Sbjct: 1147 VASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDL 1206

Query: 1206 AIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRR 1265
             +        +   +D+ +I  +  A  +       +  S  A+  +E D  + ++++  
Sbjct: 1207 TMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLKKIEN 1264

Query: 1266 A-LPDVVVKGLPDISRAVINIRDDAK-----------RELLVE--GYGLRDVMCTDGVIG 1311
              L ++ ++G+ +I R V+ ++ D K            E ++E  G  L +VM   GV  
Sbjct: 1265 TMLENITLRGVENIERVVM-MKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDA 1323

Query: 1312 SKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1371
            ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +
Sbjct: 1324 TRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSV 1383

Query: 1372 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1384 TRHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1520 (34%), Positives = 788/1520 (51%), Gaps = 159/1520 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ + S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R      I   CK +  C                           T 
Sbjct: 121  QMRQVMSIKDSKKR---FNAIWTLCKTKTVC---ETDVPSEDDPTQLISRGGCGNAQPTI 174

Query: 184  RWVGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    N   E E+ V      LN  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHDSNT 221

Query: 242  LGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            LG +      RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFNEQF--ARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  +A Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPPP 595
            +++P+S +P +   QD + G   ++ +D F +   L QLL+M+      DGI    +P P
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIE---LDQLLNMLYWVPDWDGI----IPTP 563

Query: 596  AIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVI 653
            AI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +I
Sbjct: 564  AIIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLI 607

Query: 654  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIG 713
            I G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS G
Sbjct: 608  IDG-QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTG 665

Query: 714  INDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKV 773
            I D        ++  E +  A RK +E+        L  + G    ++ E  +  FL++ 
Sbjct: 666  IGDTIADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 774  REEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLP 833
            R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726  RDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLP 785

Query: 834  HFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSL 893
            HF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786  HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 894  EDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNED 951
            ED+   YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   + +
Sbjct: 846  EDIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLMSPN 905

Query: 952  EGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQ-------------- 997
              L P +++++  EI   ++ + +       LV +    R  ++D               
Sbjct: 906  HALDP-SLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRII 964

Query: 998  YDAERDFY--------RSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAVP 1049
             +A++ F          ++ E I   A    NL   RG  + +E  E + + I L   + 
Sbjct: 965  QNAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIE--EAQNDAITLFCCL- 1021

Query: 1050 DNVRTSVS-----QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQM 1104
              VR+ ++     Q YR+++++ +  L     ++ ++ + PG  +G + AQSIGEP TQM
Sbjct: 1022 --VRSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1105 TLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVE 1162
            TL TFHFAGVAS  VT GVPR+KEI+N +K++ TP     L  +   D+  A++++  +E
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIE 1139

Query: 1163 KTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL-- 1200
             T L  V      YY  D    V  ++   IQ+   L        ID      L+LEL  
Sbjct: 1140 HTTLKSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDR 1199

Query: 1201 -TIEDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDV 1256
              + D  + + +  + KI+ +   D+++I  +  A  +       +  S  A+  +E D 
Sbjct: 1200 AAMNDKDLTMVQVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEAEED- 1257

Query: 1257 FYRMQQLRRA-LPDVVVKGLPDISRAVINIRDDAKRE-------------LLVEGYGLRD 1302
             + ++++    L  + ++G+ DI R V+ ++ D K               L  +G  L +
Sbjct: 1258 -HMLKKIENTMLESITLRGVEDIERVVM-MKYDRKMPSETGEYQKVPEWVLETDGVNLME 1315

Query: 1303 VMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVM 1362
            VM   GV GS+  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVM
Sbjct: 1316 VMTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVM 1375

Query: 1363 TYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1422
            T +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   
Sbjct: 1376 TTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAP 1435

Query: 1423 IGTGSFKVVKGTNISEKDLV 1442
            IGTG+F V+    I E+ LV
Sbjct: 1436 IGTGAFDVM----IDEESLV 1451

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1507 (34%), Positives = 784/1507 (52%), Gaps = 138/1507 (9%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                  +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRHFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKS 236
                 + R  G          VG WK+   ++ + ++  KR    L+  + LN+FK I  
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITP 216

Query: 237  ADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
             D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    R
Sbjct: 274  INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNR 476
             +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFD 591
            V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    
Sbjct: 507  VPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV---- 559

Query: 592  VPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGF 651
            +P P I+KP  LW+GKQ+ S+ I PN    + +    +   ++ PK          ++G 
Sbjct: 560  IPKPTILKPKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGM 605

Query: 652  VIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFS 711
            +II G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS
Sbjct: 606  LIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFS 663

Query: 712  IGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLS 771
            IGI D    +   ++  E + +A ++  E+        L  + G    ++ E  +  FL+
Sbjct: 664  IGIGDTIADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLN 723

Query: 772  KVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 831
            + R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724  EARDKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRT 783

Query: 832  LPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 891
            LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784  LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 892  SLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNN 949
            +LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y I   N
Sbjct: 844  ALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLN 903

Query: 950  EDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQ------------ 997
             + GL P +++++A EI+  L+ + +  +    LV++    R+ ++D             
Sbjct: 904  PEYGLDP-SLLESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRR 962

Query: 998  --YDAERDFYRSLREYINL--KATALA------NLRKSRGMFEQLEPPEKELEGIDLDEA 1047
               +A++ F     +  +L  K   L       NL   RG    L+  ++    +     
Sbjct: 963  IIQNAQQTFRIDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLV 1022

Query: 1048 VPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLK 1107
                    V   YR+++++ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL 
Sbjct: 1023 RSRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L  D   D+  A++++  +E T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTT 1142

Query: 1166 LSDVA-----YYVQD----VYKDNLSFIQVRIDLSTIDK-----------LQLEL---TI 1202
            L  V      YY  D    V +++   IQ+   L   +            L+LEL    +
Sbjct: 1143 LKSVTVSSEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAM 1202

Query: 1203 EDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSIST--SAKEPSENDVF 1257
             D  + + +  + KI+ +   D+ +I  +  A N+       +   T  +  E  E+ + 
Sbjct: 1203 NDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHML 1261

Query: 1258 YRMQQLRRALPDVVVKGLPDISRAVINIRDDAKRE-------------LLVEGYGLRDVM 1304
             +++     L  + ++G+ DI+R V+ ++ D K               L  +G  L +VM
Sbjct: 1262 KKIENT--MLESITLRGVQDITRVVM-MKYDRKVPNETGEYHKVPEWVLETDGVNLSEVM 1318

Query: 1305 CTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTY 1364
               GV  ++  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1319 TVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTS 1378

Query: 1365 KGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIG 1424
            +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IG
Sbjct: 1379 QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIG 1438

Query: 1425 TGSFKVV 1431
            TG+F V+
Sbjct: 1439 TGAFDVM 1445

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1514 (33%), Positives = 780/1514 (51%), Gaps = 147/1514 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D  +R G +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I + D
Sbjct: 174  VRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISAKD 218

Query: 239  CELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  SSSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFV 652
            P PAI+KP  LW+GKQV S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQVLSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSK 772
            GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL++
Sbjct: 665  GIGDTIADGPTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNE 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNP 904

Query: 951  DEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQ------------- 997
            D  L P +++++ +EIL  L+ +++  +    LVK+    R  +VD              
Sbjct: 905  DHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIRRI 963

Query: 998  -YDAERDFY--------RSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAV 1048
              +A++ F+         ++++ +        NL   RG  E ++  +++   +      
Sbjct: 964  IQNAQQTFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLR 1023

Query: 1049 PDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   V Q Y++++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLASRRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLV--NDNDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K++ TP +   L   +  D+  A+ ++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTL 1143

Query: 1167 SDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL---TIE 1203
              V      YY  D    V  ++   IQ+   L       + D+     L+LEL    + 
Sbjct: 1144 KSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMN 1203

Query: 1204 DIAIAITRASKLKIQA--SDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQ 1261
            D  + + +  +   Q   +D+ +I  +     +       +  S  A+  +E D  + ++
Sbjct: 1204 DKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HMLK 1261

Query: 1262 QLRRA-LPDVVVKGLPDISRAVINIRD------------DAKRELLVEGYGLRDVMCTDG 1308
            ++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM   G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPG 1321

Query: 1309 VIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            +  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 IDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1429 KVVKGTNISEKDLV 1442
             V+    I E+ LV
Sbjct: 1442 DVM----IDEESLV 1451

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1516 (34%), Positives = 785/1516 (51%), Gaps = 151/1516 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  +I A S  ++   +  D  + RA K  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            E  R  +   D+ +R      +   CK +   + C                        T
Sbjct: 120  EQMRQAIKIKDSKKR---FNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLTH--NPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
             R  G K        VG WK+      N E E+ V      LN  + LN+FK I   D  
Sbjct: 174  IRRDGLK-------LVGSWKKDKNSGDNEEPEQRV------LNMEEILNIFKHISPEDSW 220

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  KLGFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278  TLEHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQEL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTML 391

Query: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479
            + NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQ 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPP 594
             +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +P 
Sbjct: 510  QIVSPQSNKPCMGVVQDTLCGIRKLTLRDNFIE---LGQVLNMLYWVPDWDGV----IPT 562

Query: 595  PAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFV 652
            PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +
Sbjct: 563  PAILKPKPLWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            +I G QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS 
Sbjct: 607  VIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFST 664

Query: 713  GIND-VTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLS 771
            GI D +     ++Q  E + E A  K +++        L  + G    ++ E  +  +L+
Sbjct: 665  GIGDTIADGQTMRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLN 723

Query: 772  KVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 831
            + R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724  EARDKAGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRT 783

Query: 832  LPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 891
            LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784  LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 892  SLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNN 949
            +LED+   YD T R S   I+QF YG DG+D   +E  A       +R+++  Y I   N
Sbjct: 844  ALEDIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLN 903

Query: 950  EDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD-------QYDAER 1002
             D  L P +++++ +EI+  L+ + +  +    LV++    R  +VD         +  R
Sbjct: 904  PDYSLDP-SLLESGSEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRR 962

Query: 1003 DFYRSLREY-INLKATALANLRKSRGMFEQLEPPEKELEGID--LDEAVPDNV------- 1052
                + + + I+    +   +R      ++L+     + G    + EA  D +       
Sbjct: 963  IIQNAQQTFRIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLM 1022

Query: 1053 -----RTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLK 1107
                    V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL 
Sbjct: 1023 RSRLASRRVIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K++ TP + A L  D   D+  A++++  +E T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTT 1142

Query: 1166 LSDVA-----YYVQD----VYKDNLSFIQVRIDLSTIDK-----------LQLEL---TI 1202
            L  V      YY  D       ++   IQ+   L   +            L+LEL    +
Sbjct: 1143 LKSVTVASEIYYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAM 1202

Query: 1203 EDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
             D  + + +  + KI+ +   D+ +I  +  A  +       +  S   +  +E D  + 
Sbjct: 1203 NDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLPDISRAVINIRDDA------------KRELLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D              +  L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             GV  S+  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1427 SFKVVKGTNISEKDLV 1442
            +F V+    I E+ LV
Sbjct: 1440 AFDVM----IDEESLV 1451

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1514 (33%), Positives = 783/1514 (51%), Gaps = 152/1514 (10%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++   S  ++   +  D  + +A K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDESQMKA-KIGGLNDPRLG 59

Query: 60   VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                  +C TC   +A C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE-- 117

Query: 120  KRHFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +E  R  +   D  RR   +  +   CK +   + C                   
Sbjct: 118  ----YNEQMRQAIKIKDPKRRFNAVWTL---CKAK---MVCETEVPSPDDPTVFLSRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKS 236
              I  + R  G          VG WK+    + + ++  KR    ++  + LN+FK I  
Sbjct: 168  GHIQPSIRKDGLS-------LVGTWKKDKNAD-DSDQPEKRI---ISAEEILNVFKHISP 216

Query: 237  ADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
             D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDGWRLGFNEDF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    R
Sbjct: 274  INVQKLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNR 476
             +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFD 591
            V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DGI    
Sbjct: 507  VPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGI---- 559

Query: 592  VPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGF 651
            +P PAI+KP  LW+GKQV S+ I PN    + +        F+ PK          ++G 
Sbjct: 560  IPTPAILKPVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGM 605

Query: 652  VIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFS 711
            +II G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + GFS
Sbjct: 606  LIIDG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFS 663

Query: 712  IGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLS 771
            IGI D    +   ++  E + +A +K +++        L  + G    ++ E  +  +L+
Sbjct: 664  IGIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLN 723

Query: 772  KVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRS 831
            + R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724  EARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRT 783

Query: 832  LPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 891
            LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784  LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 892  SLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNN 949
            +LED+   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I   N
Sbjct: 844  ALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLN 903

Query: 950  EDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLR 1009
            E+  L P +++++ +EI+   + +L+  D    LV +    R  +V   D E ++     
Sbjct: 904  EEYALDP-SLLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFV---DGEHNWPLP-- 957

Query: 1010 EYINLKATALANLRKSRGMFEQLEPPEKELEGI------------------DLDEAVPDN 1051
              +N+K     + +  R   +Q +P +  +E +                  D+ +    N
Sbjct: 958  --VNIKRIIQNSQQTFR--IDQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQN 1013

Query: 1052 VRT-------------SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIG 1098
              T              V + YR++ ++    L     ++ ++ + PG  +G + AQSIG
Sbjct: 1014 AITLFCCLLRSRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIG 1073

Query: 1099 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARV 1156
            EP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L  +   D+  A+ 
Sbjct: 1074 EPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKE 1133

Query: 1157 VKGRVEKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----L 1196
            ++  +E T L  V      YY  D    V +D+   IQ+   L       ++D      L
Sbjct: 1134 IRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLL 1193

Query: 1197 QLEL-----TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSIST--SAK 1249
            +LEL     T +D+ +        +   +D+ +I  +  A  +       +   T  +  
Sbjct: 1194 RLELDRAAMTDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADV 1253

Query: 1250 EPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRDDA------------KRELLVEG 1297
            E  E+ +  +++     L  + ++G+ DI+R V+   D              +  L  +G
Sbjct: 1254 EAEEDHMLKKIEN--SMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDG 1311

Query: 1298 YGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQL 1357
              L +VM   GV GS+  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ L
Sbjct: 1312 VNLSEVMTVSGVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMAL 1371

Query: 1358 LGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIIL 1417
            L DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +IL
Sbjct: 1372 LVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVIL 1431

Query: 1418 GQTMSIGTGSFKVV 1431
            GQ   IGTG+F V+
Sbjct: 1432 GQMAPIGTGAFDVM 1445

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1515 (33%), Positives = 786/1515 (51%), Gaps = 149/1515 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDAEEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFV 652
            P PAI+KP  LW+GKQ+ S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSK 772
            GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL++
Sbjct: 665  GIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNE 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLLNT 904

Query: 951  DEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLRE 1010
            +  L P +++++ +EIL  L+ +++  +    LVK+    R  +VD  +A      ++R 
Sbjct: 905  EHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDG-EANWPLPVNIRR 962

Query: 1011 YI-NLKAT-ALANLRKSRGMFEQLEPPEKELEGIDL-----DEAVPDNVRTSVS------ 1057
             I N + T  + + + S    + +    K+L+G  L     +E + +  R +V+      
Sbjct: 963  IIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLL 1022

Query: 1058 ----------QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLK 1107
                      Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL 
Sbjct: 1023 RSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1108 TFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLV--NDNDERAARVVKGRVEKTL 1165
            TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L   +  D+  A++++  +E T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTT 1142

Query: 1166 LSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL---TI 1202
            L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL    +
Sbjct: 1143 LKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAM 1202

Query: 1203 EDIAIAITRASKLKIQA--SDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
             D  + + +  +   Q   +D+ +I  +     +       +  S  A+  +E D  + +
Sbjct: 1203 NDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HML 1260

Query: 1261 QQLRRA-LPDVVVKGLPDISRAVINIRD------------DAKRELLVEGYGLRDVMCTD 1307
            +++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM   
Sbjct: 1261 KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP 1320

Query: 1308 GVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGE 1367
            G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1321 GIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG 1380

Query: 1368 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1427
            +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1381 LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA 1440

Query: 1428 FKVVKGTNISEKDLV 1442
            F V+    I E+ LV
Sbjct: 1441 FDVM----IDEESLV 1451

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1532 (33%), Positives = 794/1532 (51%), Gaps = 170/1532 (11%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                  +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRHFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL R  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLTHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER V      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRLKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERH 465
            E VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYW 552

Query: 585  ----DGIEQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKS 638
                DG+    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G +II G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  E + +A RK +E+        L  + G   
Sbjct: 651  KVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRS 938
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIAS 888

Query: 939  WDHAYNITFN----NEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEY 994
             D A+   F     N    L P +++++ +EI+  L+ + +  +    LV++ +  R  +
Sbjct: 889  SDAAFERRFRIDLLNPRHALDP-SLLESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIF 947

Query: 995  VDQYDAE------RDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKEL----EGIDL 1044
            VD           R   ++ ++   +  T   +L     ++   E  EK L    +   L
Sbjct: 948  VDGEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKIL 1007

Query: 1045 DEAVPDNVRT------------SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAI 1092
             EA  + V               V Q YR+++++    L     ++ ++ + PG  +G +
Sbjct: 1008 QEAQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVL 1067

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVNDN--D 1150
             AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L  D+  D
Sbjct: 1068 AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAAD 1127

Query: 1151 ERAARVVKGRVEKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK 1195
            +  A++++  +E T L  +      YY  D    V +++   IQ+   L       ++D 
Sbjct: 1128 QEKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDY 1187

Query: 1196 -----LQLEL---TIEDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSI 1244
                 L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       +  
Sbjct: 1188 QSPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDP 1246

Query: 1245 ST--SAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRDDA------------K 1290
             T  +  E  E+ +  R++     L  + ++G+ DI+R V+   D              +
Sbjct: 1247 KTLDAEAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPE 1304

Query: 1291 RELLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSV 1350
              L  +G  L +VMC  GV  ++  TN  +++ +VLGIEA R ++ +E+   +++ G  V
Sbjct: 1305 WVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYV 1364

Query: 1351 DPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEG 1410
            + RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   G
Sbjct: 1365 NYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRG 1424

Query: 1411 VSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
            VSE ++LGQ   IGTG+F V+    I E+ LV
Sbjct: 1425 VSENVLLGQVAPIGTGAFDVM----IDEESLV 1452

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1514 (33%), Positives = 780/1514 (51%), Gaps = 147/1514 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  IRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFV 652
            P PAI+KP  LW+GKQ+ S+ I    N   +   D    +  P           +++G +
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAIP---NGIHLQRFDEGTTLLSP-----------KDNGML 606

Query: 653  IIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSI 712
            II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS 
Sbjct: 607  IIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFST 664

Query: 713  GINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSK 772
            GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL++
Sbjct: 665  GIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNE 950
            LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y +   N 
Sbjct: 845  LEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNT 904

Query: 951  DEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQ------------- 997
            D  L P +++++ +EIL  L+ +++  +    LVK+    R  +VD              
Sbjct: 905  DHTLDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRI 963

Query: 998  -YDAERDFY--RSLREYINLKATALA------NLRKSRGMFEQLEPPEKELEGIDLDEAV 1048
              +A++ F+   +    + +K   L       NL   RG  E ++  +++   +      
Sbjct: 964  IQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLR 1023

Query: 1049 PDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
                   V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1024 SRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLV--NDNDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K++ TP +   L   +  D+  A++++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTL 1143

Query: 1167 SDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL---TIE 1203
              V      YY  D    V  ++   IQ+   L       + D+     L+LEL    + 
Sbjct: 1144 KSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMN 1203

Query: 1204 DIAIAITRASKLKIQA--SDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQ 1261
            D  + + +  +   Q   +D+ +I  +     +       +  S  A+  +E D  + ++
Sbjct: 1204 DKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HMLK 1261

Query: 1262 QLRRA-LPDVVVKGLPDISRAVINIRD------------DAKRELLVEGYGLRDVMCTDG 1308
            ++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM   G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPG 1321

Query: 1309 VIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            +  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 IDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1429 KVVKGTNISEKDLV 1442
             V+    I E+ LV
Sbjct: 1442 DVM----IDEESLV 1451

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1516 (33%), Positives = 774/1516 (51%), Gaps = 151/1516 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  +V   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK--RHF 123
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++  R  
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQV 125

Query: 124  LHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            L +++ P     +R      +   CK +   + C                        T 
Sbjct: 126  L-KIKDPK----KR---FNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWKE--VLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ V      L   + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTK 221

Query: 242  LGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            LG D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  LGFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEQFDVPPPAIM 598
            +++P+S +P +   QD + G  +++ KD+F +   +  +L  + D  GI    +P PAI+
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPDWDGI----IPTPAIL 566

Query: 599  KPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVIIRG 656
            KP  LWTGKQ+ S  I      P  I+L    +    + PK          ++G +II G
Sbjct: 567  KPKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG 610

Query: 657  SQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND 716
             QI+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGD 668

Query: 717  VTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREE 776
                 +  ++  E +  A +K +E+        L  + G    ++ E  +  FL++ R++
Sbjct: 669  TIANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDEGL 954
               YD T R S   I+QF YG DG+D   +E  +       + +++  Y I     +  L
Sbjct: 849  MVHYDGTTRNSLGNIIQFIYGEDGIDASHIEKQSLDTIGGSDAAFEKRYRIDLLKVENSL 908

Query: 955  LPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD------------------ 996
             P +++++ +EI   L+ +++  +    LV++    R  + D                  
Sbjct: 909  DP-SLLESGSEITGDLKLQVLLDEEYRQLVEDRAFLRKVFTDGESNWPLPVNIRRIIQNA 967

Query: 997  ----QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNV 1052
                + D  +    ++R+ I         L   RG  E ++  +++   +          
Sbjct: 968  QQTFRIDHSKPSDLTIRDIIKGVRELQEKLLVLRGKNEIVQQAQQDAITLFCCLVRSRLA 1027

Query: 1053 RTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFA 1112
               V Q YR++++S    +     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1113 GVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA 1170
            GVAS  VT GVPR+KEI+N +K++ TP +   L      D+  A+ ++  +E T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVT 1147

Query: 1171 -----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL-----TIEDI 1205
                 YY  D    V +D+   IQ+   L      +++D+     L+LEL       +D+
Sbjct: 1148 VASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1206 AIAITRASKLKIQASDVNIIGKDQIAIN-------VFPEGYKAKSISTSAKEPSENDVFY 1258
             +        +    D+ +I  +  A         V P+G  A++      E  E+ +  
Sbjct: 1208 TMGQVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAET------EAEEDHMLK 1261

Query: 1259 RMQQLRRALPDVVVKGLPDISRAVINIRDDA------------KRELLVEGYGLRDVMCT 1306
            +++     L ++ ++G+ +I R V+   D              +  L  +G  L +VM  
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTI 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             GV  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTG 1439

Query: 1427 SFKVVKGTNISEKDLV 1442
            +F    G  I E+ LV
Sbjct: 1440 AF----GVMIDEESLV 1451

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1516 (33%), Positives = 781/1516 (51%), Gaps = 151/1516 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLTHN----PELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDADEPELRV--------LSTEEILNIFKHISVED 218

Query: 239  CELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQ 477
            +L+ NGPN HPGA Y+++ + D R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDG 650
            P PAI+KP  LW+GKQV S  I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             +II G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFL 770
            S GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL
Sbjct: 663  STGIGDTIADGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFN 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       +++++  Y I   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLL 902

Query: 949  NEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQ----------- 997
            N +  L P +++++ +EIL  L+ +++  +    LVK+    R  +VD            
Sbjct: 903  NPEHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIR 961

Query: 998  ---YDAERDFY--------RSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDE 1046
                +A++ F+         +++E +        NL   RG  E ++  +++   +    
Sbjct: 962  RIIQNAQQTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCL 1021

Query: 1047 AVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
                     + Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 FRSRLATRRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLV--NDNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L   +  D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHT 1141

Query: 1165 LLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL---T 1201
             L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL    
Sbjct: 1142 TLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAA 1201

Query: 1202 IEDIAIAITRASKLKIQA--SDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            + D  + + +  +   Q   +D+ +I  +     +       +  S  A+  +E D  + 
Sbjct: 1202 MNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLPDISRAVINIRD------------DAKRELLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1427 SFKVVKGTNISEKDLV 1442
            +F V+    I E+ LV
Sbjct: 1440 AFDVM----IDEESLV 1451

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1511 (33%), Positives = 781/1511 (51%), Gaps = 141/1511 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PV H+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            E  R  +   D+ +R      + + CK +   + C                        T
Sbjct: 120  EQMRQAIAIKDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
             R  G K        VG WK+    N   E E+ V      L+  + LN+FK I   D  
Sbjct: 174  VRKDGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDST 220

Query: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  RLGFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQEL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 420  IVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPS 479
            + NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEQFDVPPPAI 597
             +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D  G+    +P PAI
Sbjct: 510  QIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV----IPTPAI 565

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVIIR 655
            +KP  LW+GKQV S+ I      P  I+L    +    + PK          ++G +++ 
Sbjct: 566  IKPKPLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVD 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
            G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 716  DVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVRE 775
            D        ++  E +  A RK +++        L  + G    ++ E  +  FL++ R+
Sbjct: 668  DTIADGSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
            + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDEG 953
            +   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I   N    
Sbjct: 848  IMVHYDGTARNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLMNPKNA 907

Query: 954  LLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAE------RDFYRS 1007
            L P +++++ +EI   ++ + +  +    L+K+    R  +VD           R   ++
Sbjct: 908  LDP-SLLESGSEITGDVKLQSLLDEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQN 966

Query: 1008 LREYINLKATALANLRKSRGMF--EQLEPPEKELEG-IDLDEAVPDN--------VRTSV 1056
             ++   +  +  ++L     +F  + LE     L G  ++ +   D+        VR+ +
Sbjct: 967  AQQTFRIDHSKPSDLTIRDIIFGLKDLEERLLVLRGKSEIIQKAQDDAITLFCCLVRSRL 1026

Query: 1057 S-----QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHF 1111
            S     Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHF
Sbjct: 1027 STRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1112 AGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTLLSDV 1169
            AGVAS  VT GVPR+KEI+N +K++ TP +   L +D  +D+  A+ ++  +E T L  +
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSI 1146

Query: 1170 A-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL-----TIED 1204
                  YY  D    V  ++   IQ+   L       ++D+     L+LEL       +D
Sbjct: 1147 TVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKD 1206

Query: 1205 IAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLR 1264
            + +        +   +D+ +I  +  A  +       +  S  A+  +E D  + ++++ 
Sbjct: 1207 LTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEED--HMLKKIE 1264

Query: 1265 RA-LPDVVVKGLPDISRAVINIRDDA------------KRELLVEGYGLRDVMCTDGVIG 1311
               L ++ ++G+ +I R V+   D              +  L  +G  L +VM   GV  
Sbjct: 1265 NTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGVDA 1324

Query: 1312 SKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1371
            ++  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G +  I
Sbjct: 1325 TRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALTSI 1384

Query: 1372 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            TR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1385 TRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

Query: 1432 KGTNISEKDLV 1442
                I E+ LV
Sbjct: 1445 ----IDEESLV 1451

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1532 (33%), Positives = 792/1532 (51%), Gaps = 170/1532 (11%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                  +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRHFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL +  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMKQAIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLTHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER +      ++  +
Sbjct: 153  PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRLKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERH 465
            E VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LEQVLNMLYW 552

Query: 585  ----DGIEQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKS 638
                DG+    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G +II G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  + + +A RK +E+        L  + G   
Sbjct: 651  KVVNYWLLHNGFSIGIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNFN 936
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E  A       +
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQAIDTIACSD 890

Query: 937  RSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD 996
             +++  + I   N    L P +++++ +EI+  L+ + +  +    L ++    R  +VD
Sbjct: 891  AAFERRFKIDLLNPKHALDP-SLLESGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVD 949

Query: 997  ----------------------QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEP 1034
                                  + D  +    S+R+ I         L   RG  + L+ 
Sbjct: 950  GEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQ- 1008

Query: 1035 PEKELEGIDLDEAVPDNVRTS--VSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAI 1092
             E ++  + L   +  +   S  V Q YR+++++    L     ++ ++ + PG  +G +
Sbjct: 1009 -EAQVNAVTLFCCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVL 1067

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVNDN--D 1150
             AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L  ++  D
Sbjct: 1068 AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAAD 1127

Query: 1151 ERAARVVKGRVEKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK 1195
            +  A++++  +E T L  +      YY  D    V +D+   IQ+   L       ++D 
Sbjct: 1128 QEKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDY 1187

Query: 1196 -----LQLEL---TIEDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSI 1244
                 L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       +  
Sbjct: 1188 QSPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLVIRCRVVRDP 1246

Query: 1245 ST--SAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRDDA------------K 1290
             T  +  E  E+ +  R++     L  + ++G+ DI+R V+   D              +
Sbjct: 1247 KTLDAEAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPE 1304

Query: 1291 RELLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSV 1350
              L  +G  L +VMC  GV  ++  TN  +++ +VLGIEA R ++ +E+   +++ G  V
Sbjct: 1305 WVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYV 1364

Query: 1351 DPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEG 1410
            + RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   G
Sbjct: 1365 NYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRG 1424

Query: 1411 VSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
            VSE ++LGQ   IGTG+F V+    I E+ LV
Sbjct: 1425 VSENVLLGQVAPIGTGAFDVM----IDEESLV 1452

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1514 (33%), Positives = 774/1514 (51%), Gaps = 152/1514 (10%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                  +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRHFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPE-LERYVKRCMDDLNPLKTLNLFKQIK 235
                 + R  G          VG WK+    N E  ++  KR    ++  + LN+FK I 
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKK--DKNAEDADQPEKRI---ISAEEILNVFKHIS 215

Query: 236  SADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
              D   LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216  PEDSWRLGFNEDF--SRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKA 272

Query: 296  SSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQ 355
            +  ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    
Sbjct: 273  NINVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRA 327

Query: 356  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLK 415
            RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +
Sbjct: 328  RLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDR 387

Query: 416  LQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFN 475
            L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFN
Sbjct: 388  LTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFN 445

Query: 476  RQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 535
            RQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L 
Sbjct: 446  RQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLC 505

Query: 536  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQF 590
             V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+   
Sbjct: 506  AVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV--- 559

Query: 591  DVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQN 648
             +P P I+KP  LW+GKQ+ S+ I      P  I+L    +   ++ PK          +
Sbjct: 560  -IPTPTILKPKPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK----------D 602

Query: 649  DGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNR 708
            +G +II G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + 
Sbjct: 603  NGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHN 660

Query: 709  GFSIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGG 768
            GFSIGI D    +   ++  + + +A +K +E+        L  + G    ++ E  +  
Sbjct: 661  GFSIGIGDTIADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVR 720

Query: 769  FLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQ 828
            +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF 
Sbjct: 721  YLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFA 780

Query: 829  DRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRR 888
            DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RR
Sbjct: 781  DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR 840

Query: 889  LMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNIT 946
            L+K+LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y I 
Sbjct: 841  LVKALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIEKQSIDTIPGSDLAFEKRYRID 900

Query: 947  FNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAE----- 1001
              N +  L P  ++++  EI+  L+ + +  +    LV++    R  ++D          
Sbjct: 901  LLNPNYALDP-NLLESGTEIVGDLKLQNLLDEEYKQLVQDRHFLRKIFMDGEHNWPLPVN 959

Query: 1002 -RDFYRSLREYINLKATALANL------RKSRGMFEQLEPPEKELEGID--LDEAVPDNV 1052
             R   ++ ++   + +T   +L      +  RG+ E+L      L G    L EA  + +
Sbjct: 960  IRRIIQNAQQTFRIDSTKPTDLSIQDVVQGVRGLQERL----LVLRGKSQILQEAQENAI 1015

Query: 1053 RTSVSQL------------YRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEP 1100
                  L            YR+++++    L     ++ ++ + PG  +G + AQSIGEP
Sbjct: 1016 TLFCCLLRSRLATRRVITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEP 1075

Query: 1101 GTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVK 1158
             TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L      D+  A++++
Sbjct: 1076 ATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIR 1135

Query: 1159 GRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLELTIEDIAIAITRASK--LK 1216
              +E T L  V    +  Y  + S   +  D   I +L   L  E+   ++   S   L+
Sbjct: 1136 SAIEHTTLKSVPVASEIYYDPDPSSTVIEEDEEII-QLHFSLMDEETEASLKHQSPWLLR 1194

Query: 1217 IQASDVNIIGKDQIAINV---FPEGYK------------------------AKSISTSAK 1249
            ++   V +  KD     V     E +K                         K++   A 
Sbjct: 1195 LELDRVAMTDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEA- 1253

Query: 1250 EPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRDDA------------KRELLVEG 1297
            E  E+ +  +++     L  + ++G+ DI+R V+   D              +  L  +G
Sbjct: 1254 EAEEDHMLKKIENT--MLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDG 1311

Query: 1298 YGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQL 1357
              L +VM   GV  ++  TN  +++ +VLGIEA R ++ +E+   +++ G  V+ RH+ L
Sbjct: 1312 VNLSEVMSVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMAL 1371

Query: 1358 LGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIIL 1417
            L DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +IL
Sbjct: 1372 LVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVIL 1431

Query: 1418 GQTMSIGTGSFKVV 1431
            GQ   IGTGSF V+
Sbjct: 1432 GQMAPIGTGSFDVM 1445

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1511 (33%), Positives = 772/1511 (51%), Gaps = 141/1511 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  +I A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
            E  R  +           +   CK +   + C                        T R 
Sbjct: 120  EQMRQAIQIKDPKKRFNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTIRK 176

Query: 186  VGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
             G K        VG WK+  +     E E+ V      L+  + LN+FK I   D   LG
Sbjct: 177  DGLK-------LVGSWKKDKSTGDADEPEQRV------LSTEEILNIFKHISPEDSYRLG 223

Query: 244  IDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224  FNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 281  HNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+ N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRN 394

Query: 423  GPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPPPAI 597
            +P+S +P +   QD + G   ++ +D+F +     Q+L+M+      DG+    +P PAI
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFLE---FDQVLNMLYWVPDWDGV----IPTPAI 565

Query: 598  MKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVIIR 655
            +KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G ++I 
Sbjct: 566  IKPKPLWSGKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
            G +I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  G-EIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 716  DVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVRE 775
            D        ++  E +  A +K + +        L  + G    ++ E  +  FL++ R+
Sbjct: 668  DTVADGQTMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
              G +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  RAGRLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDEG 953
            +   YD T R S   ++QF YG DG+D   +E  +       +++++  Y I   N    
Sbjct: 848  IMVHYDGTTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSNS 907

Query: 954  LLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAE------RDFYRS 1007
            L P +++++ +EI+  L+ ++   +    LVK+    R  + D   +       R   ++
Sbjct: 908  LEP-SLLESGSEIIGDLKVQMALDEEYKQLVKDRRFLRTIFSDGESSWPLPVNIRRIIQN 966

Query: 1008 LREYINLKATALANL------RKSRGMFEQLEPPEKELEGID--LDEAVP-------DNV 1052
             ++   +  T  ++L         R + ++L     + E I    D+AV          +
Sbjct: 967  AQQTFRIDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKAQDDAVTLFCCLLRSRL 1026

Query: 1053 RT-SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHF 1111
             T  V Q YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHF
Sbjct: 1027 ATRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1112 AGVASMNVTLGVPRIKEIINASKSISTPIINAVLVND--NDERAARVVKGRVEKTLLSDV 1169
            AGVAS  VT GVPR+KEI+N +K++ TP +   L  +   D+  A++V+  +E T L  V
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSV 1146

Query: 1170 A-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL-----TIED 1204
                  YY  D    V  ++   IQ+   L        +D+     L+LEL       +D
Sbjct: 1147 TVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKD 1206

Query: 1205 IAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLR 1264
            + +            +D+ +I  +  A  +       +  +  A+  +E D  + ++++ 
Sbjct: 1207 LTMGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEED--HMLKKIE 1264

Query: 1265 RA-LPDVVVKGLPDISRAVINIRDDA------------KRELLVEGYGLRDVMCTDGVIG 1311
               L ++ ++G+  I R V+   D              +  L  +G  L +VM   GV  
Sbjct: 1265 NTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVDP 1324

Query: 1312 SKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1371
            ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +
Sbjct: 1325 TRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSV 1384

Query: 1372 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1385 TRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

Query: 1432 KGTNISEKDLV 1442
                I E+ LV
Sbjct: 1445 ----IDEESLV 1451

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1519 (33%), Positives = 783/1519 (51%), Gaps = 157/1519 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++   S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R   +  +   CK +   + C                        + 
Sbjct: 121  QMRQAMAIKDSKKRFNAVWTL---CKTK---MICETDVPSDDDPTTLISRGGCGNAQPSI 174

Query: 184  RWVGKKSAPEKDIWVGEWKEV--LTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ V      L+  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHISPEDSTR 221

Query: 242  LGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            +G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  MGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPPP 595
            +++ +S +P +   QD + G   ++ +D+F +     Q+L+M+      DG+    +P P
Sbjct: 511  IVSAQSNKPCMGIVQDTLCGIRKLTLRDTFIE---FDQVLNMLYWVPDWDGV----IPTP 563

Query: 596  AIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVI 653
            A++KP  LWTGKQV S  I      P  I+L    +    + PK          ++G ++
Sbjct: 564  AVLKPKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLV 607

Query: 654  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIG 713
            I G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS G
Sbjct: 608  IDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTG 665

Query: 714  IND-VTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSK 772
            I D +     +K+  E + E A +K +++        L  + G    ++ E  +  FL++
Sbjct: 666  IGDTIADGQTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNE 724

Query: 773  VREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 832
             R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+L
Sbjct: 725  ARDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTL 784

Query: 833  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 892
            PHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+
Sbjct: 785  PHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKA 844

Query: 893  LEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNE 950
            LED+   YD T R S   ++QF YG DG+D   +E          + +++  Y I   N 
Sbjct: 845  LEDIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRYRIDLLNP 904

Query: 951  DEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD-------------- 996
            +  L P  ++++ +EI   L+ + +  +    LV++    R  +VD              
Sbjct: 905  EHSLDP-TLLESGSEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIRRI 963

Query: 997  --------QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAV 1048
                    + D  +    ++R+ +        +L   RG  E +E  +   + I L   +
Sbjct: 964  IQNAQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQS--DAITLFCCL 1021

Query: 1049 PDNVRTSVS-----QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQ 1103
               VR+ ++     Q Y++++++ +  L     ++ ++ + PG  +G + AQSIGEP TQ
Sbjct: 1022 ---VRSRLATRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQ 1078

Query: 1104 MTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVN--DNDERAARVVKGRV 1161
            MTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L +   +D+  A+ ++  +
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAI 1138

Query: 1162 EKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL- 1200
            E T L  +      YY  D    V  ++   IQ+   L       ++D+     L+LEL 
Sbjct: 1139 EHTTLKSITVASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELD 1198

Query: 1201 ----TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDV 1256
                  +D+ +        +   +D+ +I  +  A  +       +  S  A+  +E D 
Sbjct: 1199 RAAMNDKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED- 1257

Query: 1257 FYRMQQLRRA-LPDVVVKGLPDISRAVINIRD----DAKRE--------LLVEGYGLRDV 1303
             + ++++    L ++ ++G+ +I R V+   D     A  E        L  +G  L +V
Sbjct: 1258 -HMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEV 1316

Query: 1304 MCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMT 1363
            M   G+  ++  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1364 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSI 1423
             +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   I
Sbjct: 1377 TQGGLTSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPI 1436

Query: 1424 GTGSFKVVKGTNISEKDLV 1442
            GTG+F V+    I E+ LV
Sbjct: 1437 GTGAFDVM----IDEESLV 1451

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1498 (33%), Positives = 766/1498 (51%), Gaps = 138/1498 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R      I   CK +   + C                        T 
Sbjct: 121  QMRQACKIKDSKKR---FNAIWTLCKTK---MICESDVPSEEDPTKLISRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWK-EVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
            R  G K        VG WK E  T +PE        M+++     LN+FK I   D   L
Sbjct: 175  RKDGLK-------LVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNRL 222

Query: 243  GIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIV 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVR 393

Query: 422  NGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS-----DGIEQFDVPPPA 596
            ++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG+    +P PA
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDNFIE---LDQVLNMLYWVPDWDGV----IPTPA 564

Query: 597  IMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVII 654
            I+KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +II
Sbjct: 565  IIKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 655  RGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGI 714
             G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI
Sbjct: 609  DG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGI 666

Query: 715  NDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVR 774
             D        ++  E +  A +K +++        L  + G    ++ E  +  FL++ R
Sbjct: 667  GDTIADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDE 952
            D+   YD+T R S   ++QF YG DG+D   +E  A       + +++  Y I   N D 
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDH 906

Query: 953  GLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAE------RDFYR 1006
             L P +++++ +EI+  L+ +++  +    LV++    R+ +VD           R   +
Sbjct: 907  LLDP-SLLESGSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQ 965

Query: 1007 SLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVS--------- 1057
            + ++   +  T  ++L      F      +K L      E + +  + +VS         
Sbjct: 966  NAQQTFRIDHTKPSDLSIRDVYFAVKNLQDKLLVLRGNSEIIKNAQQDAVSLFCCLMRSR 1025

Query: 1058 -------QLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFH 1110
                   + YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFH
Sbjct: 1026 LATRRVIEEYRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1111 FAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVN---------DNDERAARVVKG-- 1159
            FAGVAS  VT GVPR+      +K I + I +  L +         D D R+  + +   
Sbjct: 1086 FAGVASKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEE 1145

Query: 1160 --RVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLELTIEDIAIAITRASKLKI 1217
              ++  +LL D      +   D  S   +R++L        +LT+  +   I    K   
Sbjct: 1146 IIQLHFSLLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFK--- 1198

Query: 1218 QASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRA-LPDVVVKGLP 1276
              +D+ +I  +  A  +       +  S   +  +E D  + ++++    L ++ ++G+ 
Sbjct: 1199 --NDLFVIWSEDNAEKLIIRCRVVRPKSMDIETEAEED--HMLKKIENTMLENITLRGVE 1254

Query: 1277 DISRAVINIRD----DAKRE--------LLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFS 1324
            +I R V+   D     A  E        L  +G  L +VM   GV   +  TN  +++  
Sbjct: 1255 NIERVVMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIME 1314

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L
Sbjct: 1315 VLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGAL 1374

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLV 1442
               SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+    I E+ LV
Sbjct: 1375 MRCSFEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM----IDEESLV 1428

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1282 (35%), Positives = 693/1282 (54%), Gaps = 118/1282 (9%)

Query: 226  KTLNLFKQIKSADCELLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDL 285
            + LN+FK I   D   LG +      RPE  +   LP PP  +RPS+   ++    EDDL
Sbjct: 206  EVLNVFKHICPEDSWRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDL 262

Query: 286  TVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGG 344
            T KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S    
Sbjct: 263  TYKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG--- 319

Query: 345  GKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTY 404
               +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTY
Sbjct: 320  ---RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTY 376

Query: 405  PEKVTRYNRLKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVER 464
            PE VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VER
Sbjct: 377  PEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVER 434

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQT 524
            H+ D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+
Sbjct: 435  HIIDNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQS 494

Query: 525  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS 584
            EE RAE   L  V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+ 
Sbjct: 495  EETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLY 551

Query: 585  -----DGIEQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPK 637
                 DG+    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK
Sbjct: 552  WVPDWDGV----IPTPTILKPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPK 601

Query: 638  SKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM 697
                      ++G +I+ G QI+ GV+DK  +G      + + + R+ GPQ  A   + +
Sbjct: 602  ----------DNGMLIVDG-QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNI 649

Query: 698  AKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCN 757
             K+   +L + GFSIGI D        ++  E + +A +K + +        L  + G  
Sbjct: 650  QKVVNYWLLHNGFSIGIGDTIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMT 709

Query: 758  EEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQI 817
              ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ 
Sbjct: 710  LRESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQS 769

Query: 818  ISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAV 877
            + G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAV
Sbjct: 770  VEGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAV 829

Query: 878  KTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNF 935
            KTAETGY+ RRL+K+LED+   YD T R S   I+QF YG DG+D   +E  +       
Sbjct: 830  KTAETGYIQRRLVKALEDIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGS 889

Query: 936  NRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYV 995
            +R+++  Y I   N D  L P +++++ +E++  L+ +    +    LV++    R  +V
Sbjct: 890  DRAFERRYRIDLLNPDNALDP-SLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFV 948

Query: 996  D------------------QYDAERDFYRSLREYINLKATALANLRKS----RGMFEQLE 1033
            D                  Q     D  +     I+     + +L++     RG  E L+
Sbjct: 949  DGEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQ 1008

Query: 1034 PPEKELEGIDLDEAVPDNVRTS--VSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
              E +   + L   +  +   S  V + Y++++++ +  L     ++ ++ + PG  +G 
Sbjct: 1009 --EAQTNAVTLFCCLLRSRLASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGV 1066

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVNDN-- 1149
            + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP +   L ++   
Sbjct: 1067 LAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESA 1126

Query: 1150 DERAARVVKGRVEKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STID 1194
            D+  A++++  +E T L  V      YY  D    V +D+   IQ+   L       ++D
Sbjct: 1127 DQEKAKLIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLD 1186

Query: 1195 K-----LQLEL---TIEDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKS 1243
                  L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       + 
Sbjct: 1187 HQSPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRD 1245

Query: 1244 IST--SAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRD----DAKRE----- 1292
              T  +  E  E+ +  +++     L  + ++G+ DI+R V+   D     A  E     
Sbjct: 1246 PKTLDAEAEAEEDHMLKKIENT--MLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVP 1303

Query: 1293 ---LLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMS 1349
               L  +G  L +VM   GV  ++  TN  +++ +VLGIEA R ++ +E+   +++ G  
Sbjct: 1304 EWVLETDGVNLAEVMSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSY 1363

Query: 1350 VDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVE 1409
            V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   
Sbjct: 1364 VNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCR 1423

Query: 1410 GVSECIILGQTMSIGTGSFKVV 1431
            GVSE +ILGQ   IGTG+F V+
Sbjct: 1424 GVSENVILGQMAPIGTGAFDVM 1445

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 1   MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMG 59
           M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G
Sbjct: 1   MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETD 119
                 +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E +
Sbjct: 60  SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHN 119

Query: 120 KR 121
           ++
Sbjct: 120 EQ 121

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1168 (35%), Positives = 638/1168 (54%), Gaps = 109/1168 (9%)

Query: 348  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 407
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408  VTRYNRLKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLE 467
            VT YN  +L +L+ NGPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS--- 584
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +     Q+L+M+    
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIE---FDQVLNMLYWVP 236

Query: 585  --DGIEQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKS 640
              DG+    +P PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK   
Sbjct: 237  DWDGV----IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK--- 283

Query: 641  LPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKL 700
                   ++G ++I G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+
Sbjct: 284  -------DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKV 334

Query: 701  CARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQ 760
               +L + GFS GI D     +  ++  E +  A +K +E+        L  + G    +
Sbjct: 335  VNFWLLHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRE 394

Query: 761  TLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISG 820
            + E  +  FL++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G
Sbjct: 395  SFEDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEG 454

Query: 821  NRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTA 880
             R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTA
Sbjct: 455  KRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTA 514

Query: 881  ETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRS 938
            ETGY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E  +       N++
Sbjct: 515  ETGYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQA 574

Query: 939  WDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQY 998
            ++  Y I   + +   L   ++++ +EI+  ++ + +  +    LV +    R  ++D  
Sbjct: 575  FEKRYRIDLMSPEHS-LDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGE 633

Query: 999  DAE------RDFYRSLREYINLKATALANLRKSRGMF--EQLEPPEKELEGID--LDEAV 1048
                     R   ++ ++   +  T  ++L     ++  ++LE     L G    ++EA 
Sbjct: 634  QNWPLPVNIRRIVQNAQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEAQ 693

Query: 1049 PDNVRT------------SVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQS 1096
             D +               V + YR+++++    L     ++ ++ + PG  +G + AQS
Sbjct: 694  NDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQS 753

Query: 1097 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPIINAVLVNDN--DERAA 1154
            IGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K++ TP     L  +   D+  A
Sbjct: 754  IGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKA 813

Query: 1155 RVVKGRVEKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------STIDK---- 1195
            + ++  +E T L  V      YY  D    V  D+   IQ+   L        +D     
Sbjct: 814  KFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPW 873

Query: 1196 -LQLEL---TIEDIAIAITRASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSISTSA 1248
             L+LEL    + D  + + +  + KI+ +   D+ +I  +  A  +       +  S  A
Sbjct: 874  LLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDA 932

Query: 1249 KEPSENDVFYRMQQLRRA-LPDVVVKGLPDISRAVINIRDDAKRE-------------LL 1294
            +  +E D  + ++++    L  + ++G+ DI R V+ ++ D K               L 
Sbjct: 933  ETEAEED--HMLKKIENTMLESITLRGVEDIERVVM-MKYDRKMPSENGAYEKVPEWVLE 989

Query: 1295 VEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRH 1354
             +G  L +VM   GV  ++  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH
Sbjct: 990  TDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRH 1049

Query: 1355 IQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSEC 1414
            + LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE 
Sbjct: 1050 MALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSEN 1109

Query: 1415 IILGQTMSIGTGSFKVVKGTNISEKDLV 1442
            +ILGQ   +GTG+F V+    I E+ L+
Sbjct: 1110 VILGQMAPVGTGAFDVM----IDEESLI 1133

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  538 bits (1387), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 263/317 (82%), Positives = 290/317 (91%), Gaps = 1/317 (0%)

Query: 1145 LVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLELTIED 1204
            LVN NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDNLSF+QV+IDL TI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1205 IAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLR 1264
            IA+AITRASKLKI A DV+IIGKD++ INV+PEG K KSISTSAKEP EN++FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1265 RALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFS 1324
            R+LP +VVKGLPDI+RAVINI+ D  RELLVEGYGLRDVM TDGV+G KT TNH+LEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            VLGIEAAR SI+ EI+YTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLVPK 1444
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVKGTN+S ++L PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1445 PCLFESL-SNEAALKAN 1460
              LFESL  N AALK N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  555 bits (1431), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 366/1000 (36%), Positives = 537/1000 (53%), Gaps = 67/1000 (6%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
           S  P R IK ++F   S  +I A S  ++   +  D  + RA K  G  DP++G     L
Sbjct: 7   SSAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLH 125
           +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E +++  + 
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQ--MR 123

Query: 126 ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
           ++ +   D+ +R      I   CK +   + C                        T R 
Sbjct: 124 QILKIK-DSKKR---FNAIWSLCKTK---MICDTDVPSEHDPTQLVSRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKDIWVGEWKEV--LTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
            G K        VG WK+    +   E E+ +      L+  + LN+FK I   D   +G
Sbjct: 177 DGLK-------LVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISPEDSIAMG 223

Query: 244 IDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNEEF--SRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
             G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 281 HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 363 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVN 422
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L+ N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRN 394

Query: 423 GPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHR 482
           GPN HPGA Y+++ N D R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 483 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
           +S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 543 TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSD--GIEQFDVPPPAIMKP 600
           + +S +P +   QD + G   ++ +D+F +   +  LL  + D  G+    +P PAI+KP
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV----IPTPAILKP 568

Query: 601 YYLWTGKQVFSLLIKPNHNSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVIIRGSQ 658
             LW+GKQ+ S+ I      P  I+L    +   F+ PK          ++G +II G Q
Sbjct: 569 KPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG-Q 611

Query: 659 ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVT 718
           I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D  
Sbjct: 612 IIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTI 670

Query: 719 PADDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVG 778
              +  ++    +  A RK +E+        L  + G    ++ E  +  FL++ R++ G
Sbjct: 671 ADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 779 DVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKD 790

Query: 839 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 899 QYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNEDEGLLP 956
            YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   N +  L P
Sbjct: 851 HYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLLNTENSLNP 910

Query: 957 YAIMKTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVD 996
            +++++  EI   L+ + +       LVK+    R  +VD
Sbjct: 911 -SLLESGAEISGNLKLQNLLDVEYKQLVKDRTFLRTVFVD 949

 Score =  181 bits (460), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 225/428 (52%), Gaps = 48/428 (11%)

Query: 1056 VSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V Q ++++++S +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1116 SMNVTLGVPRIKEIINASKSISTPIINAVL--VNDNDERAARVVKGRVEKTLLSDVA--- 1170
            S  VT GVPR+KEI+N +K++ TP + A L      D+  A++++  +E T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTVAS 1150

Query: 1171 --YYVQD----VYKDNLSFIQVRIDL------STIDK-----LQLEL---TIEDIAIAIT 1210
              YY  D    V  ++   +Q+   L       ++D+     L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1211 RASKLKIQAS---DVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRA- 1266
            +  + KI+ +   D+ +I  +  A  +       +  +  A+  +E D  + ++++    
Sbjct: 1211 QVGE-KIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEED--HMLKKIENTM 1267

Query: 1267 LPDVVVKGLPDISRAVINIRD----------DAKRELLVE--GYGLRDVMCTDGVIGSKT 1314
            L ++ ++G+ +I R V+   D          +   E ++E  G  L +VM   GV  S+ 
Sbjct: 1268 LENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASRI 1327

Query: 1315 TTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1374
             TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT  G +  +TR 
Sbjct: 1328 YTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTRH 1387

Query: 1375 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGT 1434
            G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+   
Sbjct: 1388 GFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM--- 1444

Query: 1435 NISEKDLV 1442
             I E+ LV
Sbjct: 1445 -IDEESLV 1451

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  449 bits (1156), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 318/982 (32%), Positives = 496/982 (50%), Gaps = 130/982 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIPGVKQA 445

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 446  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 505

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ I+NGP+  PGA+ +  +NED        +    R  LA  L           +   V
Sbjct: 506  RQAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKV 563

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 564  YRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 623

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 624  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 683

Query: 582  MM---SDGIE---QFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PPAI KP  LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 684  GCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI- 741

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++       +ND  VI +  Q+L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 742  ---KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 795

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKK----EELVEIAYRKCDELITL----- 744
            ++ + +L   ++ N  F+ G++D+    D  + +    +E V+I  +   E+  L     
Sbjct: 796  LSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTP 855

Query: 745  FNKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMA 795
             N  EL     E     N+   L+A     ++ +  +V   C+    +  +  N+   MA
Sbjct: 856  SNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAMA 915

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 916  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSG 975

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 976  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1035

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLV 975
            YGGD +D ++    +    FN   D+   +        L+ +  ++TA           +
Sbjct: 1036 YGGDAVDVIK---ESHMTEFNFCLDNYDALLKKYNPSALVEHVDVETA-----------L 1081

Query: 976  RYDNRGSLVKEEDKDRAEYVD--QYDAERDFYRSLREYI-----NLKATALANLRKSRGM 1028
            +Y  +    +++ KD   Y    +YD     Y   + Y+     N +      L KS   
Sbjct: 1082 KYSKKTLKNRKKHKDEKHYKQTLKYDPVLSKYNPAK-YLGAVSENFQDKLELFLDKSSKT 1140

Query: 1029 FEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTA 1088
            F++ E                            I+EK  R  +++   KY ++ + PG A
Sbjct: 1141 FKEYES---------------------------INEKKFRALMQL---KYMRSLINPGEA 1170

Query: 1089 IGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVN 1147
            +G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   + N
Sbjct: 1171 VGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWN 1230

Query: 1148 DNDERAARVVKGRVEKTLLSDV 1169
            D  +  A      + K +LS+V
Sbjct: 1231 DVSDETADTFCKSISKVILSEV 1252

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGI 1328
             +++ +P I R +    ++ KR L+ EG   + +   +  I     T+N +  V    G+
Sbjct: 1477 TIIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGV 1536

Query: 1329 EAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1537 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1595

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            +E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1596 YETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L++ADI   S   ++   + D      P + G  D  +G     L C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  449 bits (1156), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 338/1074 (31%), Positives = 534/1074 (49%), Gaps = 154/1074 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+              A  D+ I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GK+ P+ G  Q L+ K+G FR ++
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRKHM 465

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L++ ++NGP+  P
Sbjct: 466  MGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 525

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDGDVVLF 474
            GA  +  +NED        +    R  LA  L           +   V RH+++ DVV+ 
Sbjct: 526  GATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIM 583

Query: 475  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 533
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 584  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 643

Query: 534  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIE-- 588
            L    +  LTP SG P+    QD I+    ++ KDS++ R    Q +       DG    
Sbjct: 644  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSAN 703

Query: 589  -QFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPV---VINLDAKNKVFVPPKSKSLPSE 644
             +    PPAI+KP  LWTGKQ+ + ++   + SPV    INL +KNK+    K +     
Sbjct: 704  NKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQH 757

Query: 645  MSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARF 704
              +N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   +
Sbjct: 758  SEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNY 814

Query: 705  LGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNK------GEL----- 750
            + N  F+ G++D+   D+  + + ++++ +    R+    +T   K       EL     
Sbjct: 815  ITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKDTSADDSELLKRLE 874

Query: 751  ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGSTLNV 806
            E     N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS +NV
Sbjct: 875  EILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALSGAKGSNVNV 934

Query: 807  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAI 866
            SQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH +
Sbjct: 935  SQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQEYYFHCM 994

Query: 867  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEM 926
            +GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGGD +D  + 
Sbjct: 995  AGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDAVDVTK- 1053

Query: 927  EGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGSLVKE 986
                       S+ + ++   +N D  L  Y                     N  +L+  
Sbjct: 1054 ----------ESYMNQFDFCLDNYDSLLKRY---------------------NPAALIDF 1082

Query: 987  EDKDRA-EYVDQYDAERDFYRSLREYI-NLKAT-ALANLRKSRGMFEQLEPPEKELEGID 1043
             D D A +Y  +    R   +++  Y+ N+K    LA    ++ +    E  + +LE   
Sbjct: 1083 LDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKYNPAKYLGSVSEKFQDKLE--- 1139

Query: 1044 LDEAVPDNVRTSVSQLYRISEKSV--RKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPG 1101
                   N   S SQL++ S KSV  +KF  +   KY ++ + PG A+G I +QS+GEP 
Sbjct: 1140 -------NFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPS 1191

Query: 1102 TQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDERAARVVKGR 1160
            TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   +++D  +  A +    
Sbjct: 1192 TQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFAKS 1251

Query: 1161 VEKTLLSDV---------------------AYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199
            + K +LS+V                      +Y QD Y +     +  +     +     
Sbjct: 1252 ISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVANNF--- 1308

Query: 1200 LTIEDIAIAITRASKLKIQASDVNI-IGKDQIAINVFPEGYKAKSISTSAKEPS 1252
            LT  +IAI      + K  ASDV I I K Q+A+    EG  +K +  + +E S
Sbjct: 1309 LTSLEIAIHKEIKKQKKTTASDVGIAIPKAQLALAAV-EGLSSKVMEDNDEEQS 1361

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLR------DVMCTDGVIGSKTTTNHVLEVFS 1324
            VV+ +P+I R V    ++ KR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGI-----TSNDVSSVLK 1535

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS LSA +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  443 bits (1139), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 307/970 (31%), Positives = 493/970 (50%), Gaps = 106/970 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISIN 310
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+   D+  +I 
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 311  NMMEHWDYLQLTVAMYINS-----DSVNPAMLPGSSNGGGKVK-PIRGFCQRLKGKQGRF 364
                  D  ++  +  +N+     + VN  +    + G    K P+ G  Q L+ K+G F
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKIPVPGVKQALEKKEGLF 466

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNGP 424
            R ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NGP
Sbjct: 467  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 526

Query: 425  NVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDGD 470
            +  PGA+ +  +NED        +    R  LA  L           +   V RH+++ D
Sbjct: 527  DKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHIKNRD 584

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            VVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 585  VVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 644

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--------S 581
            EA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +         
Sbjct: 645  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIRPEHG 704

Query: 582  MMSDGIEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSKS 640
              S G  +    PPA++KP  LWTGKQ+ S +L+         INL++ NK+    K++ 
Sbjct: 705  HASRG--KIVTMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI----KNEY 758

Query: 641  LPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKL 700
                 ++ND  VI +  +++ G++DKS  G   K+ + +++   YGP+ AA  ++ + +L
Sbjct: 759  WGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSVLGRL 815

Query: 701  CARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKG------EL- 750
               ++    F+ G++D+    +  + + E+++ +    R+    +T  +K       EL 
Sbjct: 816  FTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDDVELL 875

Query: 751  ----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGS 802
                E     N+   L+A     ++ V  +V   C+ +       +N+   MA  G+KGS
Sbjct: 876  KRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGS 935

Query: 803  TLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFL 862
             +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ 
Sbjct: 936  NVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIKPQEYY 995

Query: 863  FHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLD 922
            FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D
Sbjct: 996  FHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYGGDAVD 1055

Query: 923  PLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRGS 982
             +  E +    +F R           N D  L  Y  +  A  +     E  ++Y  + S
Sbjct: 1056 -VTKESHMTQFDFCRE----------NYDALLKKYNPVALAEHLDV---ETALQYSKKVS 1101

Query: 983  LVKEEDKDRAEYVD--QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELE 1040
              ++++   A Y    +YD                   LA    ++ +    E    +LE
Sbjct: 1102 KNRKKNSKTAHYEQKVKYDP-----------------VLAKYNPAKYLGSVSEKFHDKLE 1144

Query: 1041 GIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEP 1100
                D+A     R SV         S ++F  +   KY ++ + PG A+G I +QS+GEP
Sbjct: 1145 SYLEDKAKEFKSRESV---------SAKRFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1195

Query: 1101 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDERAARVVKG 1159
             TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   + +D  +  A +   
Sbjct: 1196 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQADLFCK 1255

Query: 1160 RVEKTLLSDV 1169
             + K +LS+V
Sbjct: 1256 SISKVVLSEV 1265

 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ +P I R V +   + KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  L+F+ L+  DI   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L + +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  441 bits (1133), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 318/978 (32%), Positives = 497/978 (50%), Gaps = 124/978 (12%)

Query: 253  PETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----------- 300
            P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+           
Sbjct: 353  PDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMSNLQK 409

Query: 301  ---AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRL 357
               +  D+ +  + +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q L
Sbjct: 410  DKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GST--GGKV-PIPGVKQAL 461

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQ 417
            + K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 462  EKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 521

Query: 418  ELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVVE 463
            + ++NGP+  PGA  +  +NED        +    R  LA  L           +   V 
Sbjct: 522  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKVF 579

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 580  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 639

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSM 582
            Q E AR+EA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +  
Sbjct: 640  QNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIYG 699

Query: 583  M---SDGIE---QFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPV---VINLDAKNKVF 633
                 DG     +    PPA+MKP  LWTGKQ+ + +I   + +P     INL +KNK+ 
Sbjct: 700  CIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIM--NVTPADMPGINLLSKNKI- 756

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++      ++N+  VI +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 757  ---KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 810

Query: 694  MNRMAKLCARFLGNRGFSIGINDVT-PADDLKQKKEEL---VEIAYRKCDELITL----- 744
            ++ + +L   F+ N  FS G++D+   A+  K +K+ L    ++  +   E+  L     
Sbjct: 811  LSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTP 870

Query: 745  FNKGEL-----ETQPGCNEEQTLEA----KIGGFLSKVREEVGDVCINELDNWNAPLIMA 795
             N  EL     E     N+   L+A    K+    SKV   V      +    N+   MA
Sbjct: 871  SNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMA 930

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 931  LSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSG 990

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 991  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFL 1050

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-ERL 974
            YGGD +D  +     Q           ++    N D  L  Y      + ++  L+ E  
Sbjct: 1051 YGGDAVDTTKESHMTQ-----------FDFCLENYDALLRKY----NPSALVEHLDVESA 1095

Query: 975  VRYDNRGSLVKEEDKDRAEY--VDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQL 1032
            ++Y  +    +++      Y   D+YD                   L+    ++ +    
Sbjct: 1096 LKYSKKALKSRKKIDKEPHYKNSDKYDP-----------------VLSKYNPAKYLGSVS 1138

Query: 1033 EPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAI 1092
            E  + +LEG  LD        +   QL   S  + +KF  +   KY ++ + PG A+G I
Sbjct: 1139 EKFQDKLEGF-LD--------SHSKQLKLHSGINEKKFRALMQLKYMRSLVNPGEAVGII 1189

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDE 1151
             AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS +I TP ++  + N   +
Sbjct: 1190 AAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSD 1249

Query: 1152 RAARVVKGRVEKTLLSDV 1169
              A +    + K +LS+V
Sbjct: 1250 DQASIFCKSITKVVLSEV 1267

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 83/162 (51%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ +P ISR +       +R L  EG   + +   +  I      +N V  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F+  SA +I   S  +++   + D      P + G  D  +G     L CATC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  436 bits (1122), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 308/981 (31%), Positives = 499/981 (50%), Gaps = 128/981 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        + +  R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIK 756

Query: 634  VPPKSK-SLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                 K SL SE       V+ +   +L G++DKS  G   K+ + +++   YGP+ AA 
Sbjct: 757  NEYWGKGSLESE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAK 808

Query: 693  AMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGE 749
             ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T  +K  
Sbjct: 809  VLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKET 868

Query: 750  LETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPL----IM 794
                P             N+   L+A     ++ +  +V   C+ +      P      M
Sbjct: 869  PSDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAM 928

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+S
Sbjct: 929  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYS 988

Query: 855  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF
Sbjct: 989  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQF 1048

Query: 915  TYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERL 974
             YGGD +D   +   +    F    D+ Y +        L+ +  +++A           
Sbjct: 1049 MYGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA----------- 1094

Query: 975  VRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEP 1034
            ++Y           K   +Y  ++  E  + +S++         LA    ++ +    E 
Sbjct: 1095 LKYS----------KKTLKYRKKHSKEPHYKQSMK-----YDPVLAKYSPAKYLGSVSEN 1139

Query: 1035 PEKELEGIDLDEAVPDNVRTSVSQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIG 1090
             + +LE   LDE          S+L++    ++EK  R  +++   KY ++ + PG A+G
Sbjct: 1140 FQDKLESF-LDEN---------SKLFKSTDGVNEKKFRALMQL---KYMRSLINPGEAVG 1186

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND- 1148
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS +I TP +   + +D 
Sbjct: 1187 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDV 1246

Query: 1149 NDERAARVVKGRVEKTLLSDV 1169
            +DE+A    K  + K LLS+V
Sbjct: 1247 SDEQADTFCKS-ISKVLLSEV 1266

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  436 bits (1121), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 307/977 (31%), Positives = 499/977 (51%), Gaps = 120/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKI- 755

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 756  ---KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGEL 750
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T  +K   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTP 869

Query: 751  ETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPL----IMA 795
               P             N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 870  ADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +++A           +
Sbjct: 1050 YGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA-----------L 1095

Query: 976  RYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPP 1035
            +Y           K   +Y  ++  E  + +S++         LA    ++ +    E  
Sbjct: 1096 KY----------SKKTLKYRKKHSKEPHYKQSVK-----YDPVLAKYNPAKYLGSVSENF 1140

Query: 1036 EKELEGIDLDEAVPDNVRTSVSQLYRISEK-SVRKFLEIALFKYRKARLEPGTAIGAIGA 1094
            + +LE   LD+          S+L++ S+  + +KF  +   KY ++ + PG A+G I +
Sbjct: 1141 QDKLESF-LDKN---------SKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIAS 1190

Query: 1095 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND-NDER 1152
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS +I TP +   + ND +DE+
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQ 1250

Query: 1153 AARVVKGRVEKTLLSDV 1169
            A    K  + K LLS+V
Sbjct: 1251 ADTFCKS-ISKVLLSEV 1266

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  434 bits (1116), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 304/980 (31%), Positives = 502/980 (51%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV P+ G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PVPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PP I KPY LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKI- 755

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 756  ---KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGEL 750
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T  +K   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTP 869

Query: 751  ETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMA 795
               P             N+   L+A     ++ +  +V   C+ +       +N+   MA
Sbjct: 870  ADDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +++A           +
Sbjct: 1050 YGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA-----------L 1095

Query: 976  RYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPP 1035
            +Y           K   +Y  ++  E  + +S++         LA    ++ +    E  
Sbjct: 1096 KY----------SKKTLKYRKKHIKEPHYKQSIK-----YDPVLAKYNPAKYLGSVSENF 1140

Query: 1036 EKELEGIDLDEAVPDNVRTSVSQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
            + +LE   LD+          S+L++    ++EK  R  +++   KY ++ + PG A+G 
Sbjct: 1141 QDKLESF-LDKG---------SKLFKSADGVNEKKFRALMQL---KYMRSLINPGEAVGI 1187

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND-N 1149
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS +I TP +   + +D +
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVS 1247

Query: 1150 DERAARVVKGRVEKTLLSDV 1169
            DE+A    K  + K LLS+V
Sbjct: 1248 DEQADTFCKS-ISKVLLSEV 1266

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 303/981 (30%), Positives = 491/981 (50%), Gaps = 126/981 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S           + GG  V P  G  Q 
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP--GVKQA 461

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 462  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAEL 521

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 522  RQAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKV 579

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 580  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 639

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 640  PQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 699

Query: 582  MM---SDGIE---QFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG     +    PP I KP  LWTGKQ+ + +L+    +    INL +KNK+  
Sbjct: 700  GCIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI-- 757

Query: 635  PPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
                K+       N+  VI +   +L G++DK+  G  K + + +++   YGP  AA  +
Sbjct: 758  ----KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAAKVL 812

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGELE 751
            + + +L   ++    F+ G++D+   D+  + + ++++ +    R+    +T  +K    
Sbjct: 813  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTPA 872

Query: 752  TQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCI----NELDNWNAPLIMAT 796
              P             N+   L+A     ++ +  +V   C+     +   +N+   MA 
Sbjct: 873  DDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMAL 932

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 933  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSGI 992

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F Y
Sbjct: 993  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFLY 1052

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLL----PYAIMKTANEILRPLEE 972
            GGD +D  +            S+   +     N D GL+    P A+++  N       E
Sbjct: 1053 GGDAVDVTK-----------ESYMTQFKFCLENYD-GLVKKYNPSALIEHLN------VE 1094

Query: 973  RLVRYDNRGSLVKEEDKDRAEYV--DQYDAERDFYRSLREYINLKATALANLRKSRGMFE 1030
              ++Y  +    +++      Y+   +YD                   LA    S+ +  
Sbjct: 1095 SALKYSKKALKYRKKHSSVPHYLQNSKYDP-----------------VLAKYNPSKYLGS 1137

Query: 1031 QLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIG 1090
              E  + +LE     E + +N +  V     ++EK  R  +++   KY ++ ++PG ++G
Sbjct: 1138 VSEKFQDKLE-----EFLNENSKL-VKSTEGVNEKKFRALMQL---KYMRSLIDPGESVG 1188

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDN 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS SI TP +N  ++ND 
Sbjct: 1189 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDV 1248

Query: 1150 DERAARVVKGRVEKTLLSDVA 1170
              + A      + K LLS V 
Sbjct: 1249 SNQQAETFCKSITKVLLSQVT 1269

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ +P+I R V    ++  R L+ EG   + +   D  I   K T+N V  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  LS+  I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  434 bits (1115), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 302/968 (31%), Positives = 487/968 (50%), Gaps = 125/968 (12%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+              +  D+ I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GKV P+ G  Q L+ K+G FR ++
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTK-------AQGNTSGKV-PVPGVKQALEKKEGLFRKHM 470

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L++ ++NGP+  P
Sbjct: 471  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWP 530

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ-----------IGDVVERHLEDGDVVL 473
            GA  +  +NED        +    R  LA  L            +   V RH+++ D+V+
Sbjct: 531  GATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVI 588

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 589  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 648

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIE- 588
            NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +       DG   
Sbjct: 649  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHAT 708

Query: 589  --QFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVFVPPKSKSLPSE 644
              +    PPA+MKP  LWTGKQ+ + ++  N   P +  INL + NK+      K+    
Sbjct: 709  RAKLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKI------KNDYWG 761

Query: 645  MSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARF 704
               N+  VI +  ++L G++DKS  G   K+ + + +   YGP  +A A++ + +L   +
Sbjct: 762  KGSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNY 820

Query: 705  LGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGELETQPGC----- 756
            +    F+ G++D+   ++  + ++E+++ +    R+    +T   K      P       
Sbjct: 821  ITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLE 880

Query: 757  ------NEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGSTLNV 806
                  N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS +NV
Sbjct: 881  EIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPENSMQSMALSGAKGSNVNV 940

Query: 807  SQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAI 866
            SQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ FH +
Sbjct: 941  SQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHCM 1000

Query: 867  SGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEM 926
            +GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YGGD +D  + 
Sbjct: 1001 AGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGDAIDVTK- 1059

Query: 927  EGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-ERLVRYDNRGSLVK 985
                       S    +N    N D  L  Y      + ++  L+ E  ++Y  +    +
Sbjct: 1060 ----------ESHLTKFNFCLENYDALLKKY----NPSALIEHLDVETALKYSKKSLKYR 1105

Query: 986  EEDKDRAEYVD--QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGID 1043
            ++    A Y    +YD     Y          A  L ++  S    +QLE          
Sbjct: 1106 KKHAKEAHYQQTVKYDPILSKYNP--------AKYLGSV--SENFQDQLE---------- 1145

Query: 1044 LDEAVPDNVRTSVSQLYRISEK-SVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGT 1102
                   N     S+L +  E  + +KF  +   KY ++ + PG A+G I +QS+GEP T
Sbjct: 1146 -------NFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPST 1198

Query: 1103 QMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDERAARVVKGRV 1161
            QMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   +++D  +  A      +
Sbjct: 1199 QMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDEQADTFAKSI 1258

Query: 1162 EKTLLSDV 1169
             K +LS+V
Sbjct: 1259 SKVVLSEV 1266

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEG------YGLRDVMCTDGVIGSKTTTNHVLEVFS 1324
            V++ +P I R V    ++ KR L+ EG      +   D +  DG+      +N V  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR +++ EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS L++ DI + S  ++    + D      P + G  D  +G     L C TC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +PV++  +F      L+  C  C    L   +   F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 299/912 (32%), Positives = 478/912 (52%), Gaps = 106/912 (11%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ I  + +M  +  +Q  V  +I+S              GGK+ PI G  Q L+ K+G 
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTAGGKL-PIPGVKQALEKKEGL 474

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NG
Sbjct: 475  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 534

Query: 424  PNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   V RH+++ 
Sbjct: 535  PDKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNR 592

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 593  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 652

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SD 585
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +       D
Sbjct: 653  AEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 712

Query: 586  GI---EQFDVPPPAIMKPYYLWTGKQVFS---LLIKPNHNSPVVINLDAKNKVFVPPKSK 639
            G     +    PP I KP  LWTGKQ+ S   L I P  N P  INL + NK+    K++
Sbjct: 713  GHATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITP-ANMPG-INLKSSNKI----KNE 766

Query: 640  SLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAK 699
               +   +N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ + +
Sbjct: 767  YWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGR 823

Query: 700  LCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGELETQPGC 756
            L   ++ +  F+ G++D+   ++  + + ++++ +    R+    +T  +K      P  
Sbjct: 824  LFTNYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPEL 883

Query: 757  -----------NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKG 801
                       N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KG
Sbjct: 884  LKRLQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKG 943

Query: 802  STLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEF 861
            S +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+
Sbjct: 944  SNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEY 1003

Query: 862  LFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGL 921
             FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD +
Sbjct: 1004 YFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAV 1063

Query: 922  DPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRYDNRG 981
            D   +   +    F+   D+ Y+   N  +    P A+++  +       E  ++Y    
Sbjct: 1064 D---VTKESHMTEFDFCLDN-YDALLNKYN----PSALIEHLD------VESALKYS--- 1106

Query: 982  SLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEG 1041
               K+  K+R +++ +       Y+   +Y       L+    ++ +    E  + +LEG
Sbjct: 1107 ---KKSLKNRKKHIKE-----PHYKQNIKY----DPVLSKFNPAKYLGSVSEKFQDKLEG 1154

Query: 1042 IDLDEAVPDNVRTSVSQLYRISEKSV--RKFLEIALFKYRKARLEPGTAIGAIGAQSIGE 1099
              LD+          S+L++ S  SV  +KF  +   KY ++ + PG A+G I +QS+GE
Sbjct: 1155 Y-LDKN---------SKLFK-SHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1203

Query: 1100 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND-NDERAARVV 1157
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   + ND +DE+A    
Sbjct: 1204 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFC 1263

Query: 1158 KGRVEKTLLSDV 1169
            K  + K +LS+V
Sbjct: 1264 KS-ISKVVLSEV 1274

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R +    ++ KR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 42.0 bits (97), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L++ +I   S  +++   + D      P   G  D  +G     L C+TC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  432 bits (1111), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 303/973 (31%), Positives = 488/973 (50%), Gaps = 135/973 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+              +  D+ I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S         GS+  GG V P+ G  Q L+ K+G FR ++
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GST--GGNV-PVPGVKQALEKKEGLFRKHM 475

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NGP+  P
Sbjct: 476  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 535

Query: 429  GANYLLKRNEDARR----NLRYGDRMKLAKNLQ-----------IGDVVERHLEDGDVVL 473
            GA  L  +NED        +    R  LA  L            +   V RH+++ D+V+
Sbjct: 536  GA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVI 593

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 594  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 653

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SDGIE- 588
            NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +       DG   
Sbjct: 654  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 713

Query: 589  --QFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEM 645
              +    PPA+ KP  LWTGKQ+ + +L+         INL + NK+    K++      
Sbjct: 714  RPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSS 769

Query: 646  SQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFL 705
             +N+  V+ +  ++L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   ++
Sbjct: 770  EENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYI 826

Query: 706  GNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNKGELETQPGC------ 756
                F+ G++D+    +  + ++++++ +    R+    +T   K      P        
Sbjct: 827  MATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQE 886

Query: 757  -----NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGSTLNVS 807
                 N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KGS +NVS
Sbjct: 887  VLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 946

Query: 808  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 867
            Q++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++
Sbjct: 947  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMA 1006

Query: 868  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEME 927
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D  +  
Sbjct: 1007 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVDVTK-- 1064

Query: 928  GNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-ERLVRYDNRGSLVKE 986
                      S    ++    N D  L  Y      + ++  L+ E  ++Y  +    ++
Sbjct: 1065 ---------ESHMTKFDFCLENYDALLKKY----NPSALIEHLDVESALKYSKKSLKYRK 1111

Query: 987  EDKDRAEYVD--QYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGIDL 1044
            +    A Y    +YD     Y                             P K L  +  
Sbjct: 1112 KHAKEAHYKQSPKYDPVLAKYN----------------------------PAKYLGSV-- 1141

Query: 1045 DEAVPDNVRTSV---SQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSI 1097
             E   D + T +   S+L++    ISEK  R  +++   KY ++ + PG A+G I +QS+
Sbjct: 1142 SEKFQDKLETFIDKNSKLFKHNDDISEKKFRALMQL---KYMRSLINPGEAVGIIASQSV 1198

Query: 1098 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDERAARV 1156
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   +++D  ++ A  
Sbjct: 1199 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADT 1258

Query: 1157 VKGRVEKTLLSDV 1169
                + K LLS+V
Sbjct: 1259 FSKSISKVLLSEV 1271

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLR------DVMCTDGVIGSKTTTNHVLEVFS 1324
            ++  +P I R V    ++ KR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGI-----TSNDVSAVLK 1555

Query: 1325 VLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            V G+EAAR +I+ EI+     + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            ++ S+E T   L  A    +++ ++  S  I++G+  ++GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  RIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCH 71
           RI  ++F   SA ++ A S  +++   + D      P + G  D  +G     + CA+C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
            +   C GH GH++L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  431 bits (1108), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 311/986 (31%), Positives = 498/986 (50%), Gaps = 128/986 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            + GGKV PI G  Q 
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGSAGGKV-PIPGVKQA 453

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 454  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 513

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYG----DRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA+ +  +NED       G     R  LA  L           +   V
Sbjct: 514  RQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKV 571

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 572  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 631

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 632  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIY 691

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG     +    PPA+MKP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 692  GCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI-- 749

Query: 635  PPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K+       ++ND  VI +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 750  --KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVL 804

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELV----EIAYRKCDELITL-----F 745
            + + +L   ++    F+ G++D+   DD  + + +++    ++      E+  L      
Sbjct: 805  SVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSA 864

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI-----NELDNWNAPLIMA 795
            N  EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 865  NDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-ERL 974
            Y   G D +++   +    F    D        N D  L  Y      + ++  L+ E  
Sbjct: 1044 Y---GGDAVDVTQESHMTEFKFCAD--------NYDALLKKY----NPSALIEHLDVESA 1088

Query: 975  VRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEP 1034
            ++Y  +      +++ + E V  + A++  Y  +    N                     
Sbjct: 1089 LKYSKKAL----KNRKKNERVPHF-AQKVKYDPVVSKFN--------------------- 1122

Query: 1035 PEKELEGIDLDEAVPDNVRT---SVSQLYRISEKSV--RKFLEIALFKYRKARLEPGTAI 1089
            P K L  +   E   D + +   S ++L++ S  SV  +KF  +   KY ++ + PG A+
Sbjct: 1123 PSKYLGSVS--ENFQDKLESFIDSNNELFK-SRDSVNEKKFRALMQLKYMRSLINPGEAV 1179

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   ++ D
Sbjct: 1180 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILAD 1239

Query: 1149 NDERAARVVKGRVEKTLLSDVAYYVQ 1174
              +  A      + K +LS+V   V+
Sbjct: 1240 VTDSQADTFCKSITKVMLSEVVDRVE 1265

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 91/168 (54%), Gaps = 2/168 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++ KR L+ EG   +++   D  +  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNIS 1437
            E T   L  A    + + ++  S  ++LG+  ++GTG+F V+   + S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G     L CATC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  431 bits (1107), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 308/984 (31%), Positives = 499/984 (50%), Gaps = 124/984 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI+          
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELIVNGPNVHPGANYLLKRNEDARRNLRYG----DRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED       G     R  LA  L           +   V
Sbjct: 515  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIY 692

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG     +    PPA+ KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 693  GCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI-- 750

Query: 635  PPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++      ++ND  V+ +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELV----EIAYRKCDELITL-----F 745
            + + +L   ++    F+ G++D+   ++  + + +++    ++      E+  L      
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSA 865

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI-----NELDNWNAPLIMA 795
            N  EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 866  NDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTAN--EILRPLE-E 972
            YGGD +D  +     Q           +    +N D      A++K  N   ++  L+ E
Sbjct: 1045 YGGDAVDVTQESHMTQ-----------FKFCADNYD------ALLKKYNPAALIEHLDVE 1087

Query: 973  RLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQL 1032
              ++Y  +      + + + E V  Y  +  +              ++    S+ +    
Sbjct: 1088 SALKYSKKAL----KHRKKTEKVPHYSQKVKY-----------DPVVSKFNPSKYLGSVS 1132

Query: 1033 EPPEKELEG-IDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
            E  + +LE  ID +  +  + R +VS+      K  R  +++   KY ++ + PG A+G 
Sbjct: 1133 ENFQDKLESFIDSNNDLFKS-RDTVSE------KKFRALMQL---KYMRSLINPGEAVGI 1182

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDND 1150
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   ++ D  
Sbjct: 1183 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVT 1242

Query: 1151 ERAARVVKGRVEKTLLSDVAYYVQ 1174
            +  A      V K +LS+V   V+
Sbjct: 1243 DPQADTFCKSVTKVMLSEVVDRVE 1266

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++ KR L+ EG   +++   D  I  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G     L CATC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELRRPGV 132
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++   +  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKILDQCKK 150
             L + G    ++D+C K
Sbjct: 124 --LLQYG----LIDECYK 135

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  430 bits (1105), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 306/980 (31%), Positives = 501/980 (51%), Gaps = 126/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PPAI KPY LWTGKQ+ + ++  N   P +  INL + NK+ 
Sbjct: 698  GCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKI- 755

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
               K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 756  ---KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNK--- 747
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T  NK   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTP 869

Query: 748  ---GEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPL----IMA 795
                EL     E     N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 870  ADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +++A           +
Sbjct: 1050 YGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESA-----------L 1095

Query: 976  RYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPP 1035
            +Y           K   +Y  ++  E  + ++++         LA    ++ +    E  
Sbjct: 1096 KY----------SKKTLKYRKKHSKEPHYKQAVK-----YDPVLAKYNPAKYLGSVSENF 1140

Query: 1036 EKELEGIDLDEAVPDNVRTSVSQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
            + +LE   LD+          S+L++    ++EK  R  +++   KY ++ + PG A+G 
Sbjct: 1141 QDKLESF-LDKN---------SKLFKSADGVNEKKFRALMQL---KYMRSLINPGEAVGI 1187

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND-N 1149
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS +I TP +   + +D +
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVS 1247

Query: 1150 DERAARVVKGRVEKTLLSDV 1169
            DE+A    K  + K LLS+V
Sbjct: 1248 DEQADTFCKS-ISKVLLSEV 1266

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +++ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  429 bits (1103), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 312/986 (31%), Positives = 486/986 (49%), Gaps = 132/986 (13%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLK 358
              +  D+ +  N +M  +  +Q  V  +I+S           S+ G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALE 461

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQE 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 419  LIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNL----------QIGDVVER 464
             ++NGP+  PGA  +  +NED        +    R  LA  L           I   V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYR 579

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM 583
             E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +   
Sbjct: 640  NENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 584  ---SDGI---EQFDVPPPAIMKPYYLWTGKQVFS--LLIKPNHNSPVVINLDAKNKVFVP 635
                DG     +    PPA+MKP  LWTGKQ+ +  LL     N P  INL++KNK+   
Sbjct: 700  IRPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPG-INLNSKNKI--- 755

Query: 636  PKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMN 695
             K++       +N+  V+ +  Q+L G++DKS  G   K  + +++   YGP  AA  ++
Sbjct: 756  -KNEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLS 811

Query: 696  RMAKLCARFLGNRGFSIGINDVTPADDLKQKKEEL----VEIAYRKCDELITL-----FN 746
             + +L   ++    F+ G++D+    +  + + ++    V+I      E+  L      +
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSD 871

Query: 747  KGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATC 797
             GEL     E     N+   L+A     ++ +  +V   C+ +       +N+   MA  
Sbjct: 872  DGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALS 931

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIR 991

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y 
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLY- 1050

Query: 918  GDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLEERLVRY 977
              G D +++   +    F    D        N D      A++K  N             
Sbjct: 1051 --GGDAVDITKESHMTEFKFCVD--------NYD------ALLKKYNP------------ 1082

Query: 978  DNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATA----LANLRKSRGMFEQLE 1033
                          +  VD  D E     S +   N K  +     A   K   +  +  
Sbjct: 1083 --------------SALVDHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDPVLSKFN 1128

Query: 1034 PPEKELEGIDLDEAVPDNVRTSVS---QLYRISEK-SVRKFLEIALFKYRKARLEPGTAI 1089
            P  K L  +   E   D +   +S     ++  E  + +KF  +   KY ++ + PG A+
Sbjct: 1129 P-SKYLGAVS--ENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   + +D
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDD 1245

Query: 1149 NDERAARVVKGRVEKTLLSDVAYYVQ 1174
              +  A      + K +LS+V   VQ
Sbjct: 1246 VSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 85.5 bits (210), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG   + +   D  I  +   +N V  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 12/133 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS L++ +I   S  +V+   + D      P   G  D  +G     L CATC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR---- 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGVDNLR 136
                R  +DN+R
Sbjct: 128 ALIDERYQIDNIR 140

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  427 bits (1099), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 296/913 (32%), Positives = 469/913 (51%), Gaps = 108/913 (11%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ +  + +M  +  +Q  V  +I+S              GGKV PI G  Q L+ K+G 
Sbjct: 418  DRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTTGGKV-PIPGVKQALEKKEGL 469

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELIVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ ++NG
Sbjct: 470  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 529

Query: 424  PNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVVERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   V RH+++ 
Sbjct: 530  PDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNR 587

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 588  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 647

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMM---SD 585
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +       D
Sbjct: 648  AEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 707

Query: 586  GIE---QFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFVPPKSKSL 641
            G     +    PP I KP  LWTGKQ+ S +L+         INL + NK+      K+ 
Sbjct: 708  GHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI------KNE 761

Query: 642  PSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLC 701
                S N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ + +L 
Sbjct: 762  YWGKSSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLF 820

Query: 702  ARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITLFNK------GEL-- 750
              ++ +  F+ G++D+  +++  + + ++++ +    R+    +T  +K       EL  
Sbjct: 821  TNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLK 880

Query: 751  ---ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGST 803
               E     N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KGS 
Sbjct: 881  RLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSN 940

Query: 804  LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLF 863
            +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ F
Sbjct: 941  VNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYF 1000

Query: 864  HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDP 923
            H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D 
Sbjct: 1001 HCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD- 1059

Query: 924  LEMEGNAQPVNFNRSWDHAYNITFNNED-EGLLPYAIMKTANEILRPLEERLVRYDNRGS 982
              +   +    F+   D+ Y+   N  +   L+ +  ++TA      L+       NR  
Sbjct: 1060 --VTKESHMTEFDFCLDN-YDALLNKYNPSALIEHLDVETA------LKYSKKTLKNRKK 1110

Query: 983  LVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQLEPPEKELEGI 1042
              KE     A    +YD                   L+    ++ +    E  + +LE  
Sbjct: 1111 HAKEAHHKNAT---KYDP-----------------VLSKFNPAKYLGSVSEKFQDKLESY 1150

Query: 1043 DLDEAVPDNVRTSVSQLYR----ISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIG 1098
             LD+          S+L++    +SEK  R  +++   KY ++ + PG A+G I +QS+G
Sbjct: 1151 -LDKN---------SKLFKSHDNVSEKKFRALMQL---KYMRSLINPGEAVGIIASQSVG 1197

Query: 1099 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVND-NDERAARV 1156
            EP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   +  D +DE+A   
Sbjct: 1198 EPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQADTF 1257

Query: 1157 VKGRVEKTLLSDV 1169
             K  + K +LS+V
Sbjct: 1258 CKS-ISKVVLSEV 1269

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +P I R V    ++ KR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 42.4 bits (98), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++F  L++ +I   S  +++   + D      P + G  D  +G     L C++C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C  + L + +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  416 bits (1069), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 307/979 (31%), Positives = 495/979 (50%), Gaps = 124/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  N +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GST--GGKV-PIPGVKQA 439

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 500  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKV 557

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 558  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 617

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E AR+EA  L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 618  PQNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 677

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                  DG     +    PPA++KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 678  GCIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI-- 735

Query: 635  PPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++       +N+  VI +   +L G++DKS  G   K+ + +++   YGP  ++  +
Sbjct: 736  --KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPAD-------DLKQKKEELVEIAYRKCDEL------ 741
            + + +L   ++ +  F+ G++D+   D       D+ +K  ++   A  +   L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 742  --ITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMA 795
                L  + E E     N+   L+A     ++ +  EV   C+ +       +N+   MA
Sbjct: 851  DDAELLKRLE-EILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMA 909

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG
Sbjct: 910  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSG 969

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 970  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFL 1029

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-ERL 974
            YGGD +D  +            S    +    +N D  L  Y      + +++ L+ E  
Sbjct: 1030 YGGDAIDVTK-----------ESHMSEFKFCVDNYDALLKRY----NPSALIQHLDVESA 1074

Query: 975  VRYDNRGSLVKEEDKDRAEYV--DQYDAERDFYRSLREYINLKATALANLRKSRGMFEQL 1032
            ++Y  +    ++++ +   Y   D+YD                   L+    S+ +    
Sbjct: 1075 LKYSKKAMKNRKKNLNLPHYARHDKYDP-----------------VLSKYNPSKFLGSVS 1117

Query: 1033 EPPEKELEG-IDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGA 1091
            E  + +LE  ID + ++     T       ++EK  R  +++   KY ++ + PG A+G 
Sbjct: 1118 ENFQDKLESFIDSNASLFKGQAT-------VNEKKFRALMQL---KYMRSLINPGEAVGI 1167

Query: 1092 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDND 1150
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   ++ D  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1151 ERAARVVKGRVEKTLLSDV 1169
            +  A +      K +LS+V
Sbjct: 1228 DETADIFCKNTTKVILSEV 1246

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V+K +P+I R V    ++ KR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS +SAA+I A S  +++   + D      P   G  D  +G     L CATC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLDHLGH--PIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P +   +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  405 bits (1040), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 299/978 (30%), Positives = 487/978 (49%), Gaps = 122/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+          
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  D+ +  N +M  +  +Q  V  +I+       +     N GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA  +  +NED        +    R  LA  L           +   V
Sbjct: 509  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKV 566

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 567  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 626

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 627  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 686

Query: 582  MM---SDGI---EQFDVPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVV--INLDAKNKVF 633
                  DG     +    PPA++KP  LWTGKQ+ + ++  N   P +  INL +KNK+ 
Sbjct: 687  GCIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI- 744

Query: 634  VPPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
                 K+       N+  VI +  ++L G++DKS  G   K  + +++   YGP  A   
Sbjct: 745  -----KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKV 798

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEEL----VEIAYRKCDELITLFNKGE 749
            ++ + +L   ++    F+ G++D+   ++  + + E+    V+I      E+  L  +G+
Sbjct: 799  LSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNL--EGD 856

Query: 750  L------------ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLI 793
            +            E     N+   L+A     ++ +  +V   C+ +       +N+   
Sbjct: 857  VKADDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQA 916

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+
Sbjct: 917  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFY 976

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++Q
Sbjct: 977  SGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQ 1036

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIMKTANEILRPLE-E 972
            F Y   G D +++   +    F    D        N D  L  Y      + ++  L+ E
Sbjct: 1037 FLY---GGDAVDVTKESHMTEFKFCVD--------NYDALLKKY----NPSALIEHLDVE 1081

Query: 973  RLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALANLRKSRGMFEQL 1032
              ++Y  +      +++ + E +  Y     +   L +Y   K     +      + + +
Sbjct: 1082 SALKYSKKAM----KNRKKNEKIPHYAHNIKYDPVLSKYNPSKYLGSVSENFQDKLEKFI 1137

Query: 1033 EPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAI 1092
            +   K L+  D                  ++EK  R  +++   KY ++ + PG A+G I
Sbjct: 1138 DSNSKLLKSKD-----------------NVNEKKFRALMQL---KYMRSLINPGEAVGII 1177

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKSISTPIINAVLVNDNDE 1151
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS +I TP +   ++ D  +
Sbjct: 1178 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTD 1237

Query: 1152 RAARVVKGRVEKTLLSDV 1169
              A      + K +LS+V
Sbjct: 1238 DQADTFCKSITKVMLSEV 1255

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V+  +P+I R V    ++ KR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1330 AARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G     L CATC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  373 bits (957), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/726 (32%), Positives = 383/726 (52%), Gaps = 75/726 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELIVNGPNVHPGANYLLKRNEDARR----NLRYGDRMKLAKNLQ----------IGDVV 462
            ++ ++NGP+  PGA+ +  +NED        +    R  LA  L           +   V
Sbjct: 515  RQAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 692

Query: 581  -----SMMSDGIEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPNHNSPVVINLDAKNKVFV 634
                         +    PPA+ KP  LWTGKQ+ + +L+    +    INL++ NK+  
Sbjct: 693  GCIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI-- 750

Query: 635  PPKSKSLPSEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++   +  ++ND  VI +  ++L G++DKS  G   K+ + +++   YGP  AA  +
Sbjct: 751  --KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVL 805

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY-----RKCD----ELITLF 745
            + + +L   ++    F+ G++D+   D+  + ++++++ +        C+    E  T  
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETAS 865

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMAT 796
            +  EL     E     N+   L+A     ++ +  +V   C+ +       +N+   MA 
Sbjct: 866  DDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMAL 925

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 926  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSGI 985

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y
Sbjct: 986  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLY 1045

Query: 917  GGDGLD 922
            GGD +D
Sbjct: 1046 GGDSVD 1051

 Score = 98.6 bits (244), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 1063 SEKSV--RKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1120
            S+KSV  +KF  +   KY ++ + PG ++G I +QS+GEP TQMTL TFHFAG  + NVT
Sbjct: 1152 SDKSVNEKKFRALMQLKYMRSLINPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVT 1211

Query: 1121 LGVPRIKEII-NASKSISTPIINAVLVNDNDERAARVVKGRVEKTLLSDV 1169
            LG+PR++EII  AS +I TP +   +++D  +  A V    + K LLS+V
Sbjct: 1212 LGIPRMREIIMTASAAIKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGI 1328
             V++ +P I R V    ++ KR L+ EG   + +   +  IG    T+N V  V    G+
Sbjct: 1488 TVIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGV 1547

Query: 1329 EAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +I+ EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1548 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1606

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431
            +E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1607 YETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTLECATCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G     L C+TC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKRHFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 130/291 (44%), Gaps = 31/291 (10%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSTL 65
           S  P R IK ++F   S  ++ A S  ++   +  D  + RA K  G  DP++G     +
Sbjct: 7   SSAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNV 65

Query: 66  ECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDKR-HFL 124
           +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E +++ +  
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQMNQA 125

Query: 125 HELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFR 184
            +++ P     +R   +  +   CK +   + C                        T R
Sbjct: 126 IKIKDPK----KRFNAVWTL---CKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIR 175

Query: 185 WVGKKSAPEKDIWVGEWKEVLTHN--PELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
             G K        VG WK+    N   E E+ V      L+  + LN+FK I S D   L
Sbjct: 176 KDGLK-------LVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRL 222

Query: 243 GIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
           G +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 223 GFNEEF--ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 267 CIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMY 326
           C +   ++ + P  + + +    T   +TS L+   L     +   + H+DY++ +    
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYL-----VAWAIGHYDYIEDSTEKK 214

Query: 327 INSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPN 386
           I        +  GSS   G + PIR F  + K  QGRF  N++ + VD        P P 
Sbjct: 215 IYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPL 273

Query: 387 LSIDEVAV 394
             +D V V
Sbjct: 274 PKLDIVCV 281

>Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 1015 KATALANLRKSRGMFEQLEPPEKELEGID-----LDEAVPDNVRTSVSQLYRISEKSVRK 1069
            KATAL  L  S G   +L    + LE ++     +DE  P N +  V QL     + ++ 
Sbjct: 27   KATALEYLEASNGNM-KLILAARRLEKLEELKKTIDEEFP-NAKVHVGQLDITQAEKIKP 84

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGV 1123
            F+E     ++   +    A  A+G++ +GE  TQ     F     A +NVT  V
Sbjct: 85   FIENLPEAFKDIDILINNAGKALGSERVGEIATQDIQDVFDTNVTALINVTQAV 138

>TDEL0F04070 Chr6 complement(753401..754264) [864 bp, 287 aa] {ON}
           Anc_8.280 YDR123C
          Length = 287

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 10/126 (7%)

Query: 715 NDVTPADDLKQKKEELVEIAYR---KCDELITLFNKGELETQPGCNEEQTLE--AKIGGF 769
           NDV     L+  K+   E AY+   K DE I+LFN G    +    E ++LE  A   G 
Sbjct: 7   NDVFDLFGLENDKDIDFETAYKMISKFDEEISLFNDGSALPKLDVAEHKSLEVLAFHHGS 66

Query: 770 LSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 829
             ++  E      +EL NW++     + G  GS   V+Q+      Q ++   +   ++ 
Sbjct: 67  PKELHTE-EQAKFDELPNWDS----HSRGKNGSEQQVAQLNNFEETQALARAELLSRYES 121

Query: 830 RSLPHF 835
            ++ HF
Sbjct: 122 NAIEHF 127

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 150,554,171
Number of extensions: 6629678
Number of successful extensions: 18151
Number of sequences better than 10.0: 75
Number of HSP's gapped: 18308
Number of HSP's successfully gapped: 177
Length of query: 1460
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1338
Effective length of database: 39,492,147
Effective search space: 52840492686
Effective search space used: 52840492686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)