Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1686.21ON34834816330.0
YOR007C (SGT2)6.21ON34634814590.0
Smik_15.1766.21ON34534714340.0
Suva_15.1826.21ON34634813340.0
SAKL0E01210g6.21ON3233319631e-130
Kpol_1037.266.21ON3423399241e-123
TDEL0G044806.21ON3433419121e-121
TPHA0J003406.21ON3383469091e-121
KNAG0M011706.21ON3393379071e-121
Kwal_56.224336.21ON3223329051e-121
NCAS0H008306.21ON3383429041e-120
ZYRO0C07788g6.21ON3343259001e-120
CAGL0E02739g6.21ON3433248871e-118
NDAI0D008106.21ON3493508821e-117
KLTH0C11220g6.21ON3273328401e-111
KAFR0L004106.21ON3313388251e-109
Ecym_30256.21ON3183328021e-105
TBLA0G010506.21ON3503348011e-105
KLLA0D01155g6.21ON3353397771e-101
ACR005W6.21ON3273437069e-91
Kpol_1032.86.21ON3433545541e-67
NDAI0I022406.21ON3503423921e-43
TPHA0M002706.21ON3773633922e-43
NCAS0D026706.21ON3512353632e-39
TBLA0A072706.21ON3733383414e-36
CAGL0H08195g5.617ON583992287e-20
TPHA0D028805.617ON5852322208e-19
NDAI0F009105.617ON583992172e-18
Kwal_55.199355.617ON5931002111e-17
Smik_15.2055.617ON5892332064e-17
YOR027W (STI1)5.617ON5892332056e-17
SAKL0G07084g5.617ON5852282056e-17
TBLA0E033005.617ON582992049e-17
NCAS0G008105.617ON5842282049e-17
ZYRO0A05676g5.617ON5721002022e-16
Kpol_1018.695.617ON5902272003e-16
KLTH0E02178g5.617ON5931001994e-16
KAFR0C058905.617ON5751001985e-16
KNAG0B032005.617ON5792291968e-16
KLLA0A07062g5.617ON5811001951e-15
AEL224W5.617ON5802291942e-15
Skud_15.1925.617ON5892351897e-15
Suva_8.805.617ON586991871e-14
NCAS0A00490singletonON6201011852e-14
Ecym_55825.617ON584991791e-13
TDEL0A048405.617ON576991791e-13
TBLA0C039503.481ON5121521561e-10
Ecym_44133.481ON510741497e-10
TDEL0D055003.481ON5121521452e-09
KNAG0A079003.481ON512751434e-09
NDAI0B057903.481ON523761426e-09
CAGL0D05060g3.481ON510741417e-09
Smik_6.2153.481ON513701409e-09
YGR123C (PPT1)3.481ON513701401e-08
TPHA0D032203.481ON5131401381e-08
NCAS0F034903.481ON5121531382e-08
Skud_7.4323.481ON513701372e-08
Suva_7.4083.481ON513701354e-08
SAKL0F03102g3.481ON513751311e-07
KAFR0B066103.481ON511741311e-07
KLLA0F24046g2.152ON604711302e-07
AAR083C3.481ON538751265e-07
KLTH0F14542g3.481ON5131571256e-07
Kwal_55.211753.481ON511861257e-07
Kpol_505.413.481ON513751257e-07
KNAG0A039508.506ON3861041221e-06
KAFR0E029808.506ON3801321167e-06
NCAS0G024802.152ON596801168e-06
KLLA0B10912g3.481ON512711169e-06
Smik_2.2958.506ON385891151e-05
KLTH0B05170g2.152ON593711151e-05
Kwal_33.147672.152ON594861142e-05
NCAS0B024008.506ON380921122e-05
TBLA0H033808.506ON3751341113e-05
ZYRO0B04224g3.481ON5131101104e-05
NDAI0F028102.152ON609801104e-05
CAGL0L04048g2.152ON587651104e-05
Suva_4.4058.506ON385891095e-05
Kwal_27.118908.506ON3341041095e-05
YBR155W (CNS1)8.506ON385891086e-05
ABR131W2.152ON594711071e-04
CAGL0H07425g8.506ON3801281061e-04
Ecym_82042.152ON597711062e-04
Kpol_1018.1067.412ON753961062e-04
SAKL0H10934g8.506ON3801041024e-04
NCAS0B070102.152ON6251041024e-04
Kpol_1043.605.689ON706571025e-04
Kpol_513.28.506ON3741051015e-04
KAFR0F007202.152ON608711025e-04
TBLA0I023106.328ON11661955e-04
Ecym_20906.328ON17259968e-04
TDEL0B051402.152ON5991041008e-04
KLLA0E20857g7.412ON710871000.001
Skud_2.2828.506ON38589990.001
TPHA0L014208.506ON374129980.001
NCAS0I008703.395ON58558990.001
Skud_8.1782.152ON63898990.001
CAGL0L12936g2.152ON600138990.001
CAGL0C01903g7.412ON76997990.001
TDEL0B013108.506ON380103980.001
CAGL0K09240g6.328ON14256930.001
NDAI0B043402.152ON66498970.002
ZYRO0G06512g2.152ON60471970.002
KLLA0B09966g8.506ON370130960.002
YBL084C (CDC27)7.412ON75897960.002
Suva_2.347.412ON76397960.003
Smik_2.367.412ON75197960.003
ZYRO0B03828g7.412ON72796940.004
AGL268C8.506ON379103930.004
YNL121C (TOM70)2.152ON61798930.006
Suva_15.3142.152ON64498930.006
KNAG0I025206.328ON11759870.006
ADR230W5.689ON68570930.006
TPHA0D038606.328ON12099860.007
Ecym_25598.506ON37089910.007
TPHA0E007407.412ON74697920.008
SAKL0A01672g6.328ON12853860.008
NCAS0E024907.412ON80996920.008
Ecym_40315.689ON688125910.011
Skud_14.2112.152ON61765900.013
Smik_8.1952.152ON63598890.017
KNAG0B012903.395ON53763880.019
YHR117W (TOM71)2.152ON63998880.020
Suva_14.2192.152ON61765880.026
Smik_14.2072.152ON61798870.027
SAKL0E10956g2.152ON60071870.031
TBLA0F032203.395ON53663870.032
KNAG0H035302.152ON61465870.033
TBLA0C055302.152ON61065860.035
TDEL0C027207.412ON70096860.039
Kpol_1048.212.152ON59771860.041
Skud_2.247.412ON76997850.050
KLTH0E11748g8.506ON378203840.056
KLLA0C08910g6.328ON11559790.058
NDAI0I004406.328ON12859780.093
Kwal_27.117378.470ON575117820.11
AGL294W7.412ON65696820.11
Suva_16.4173.395ON53964810.16
TPHA0G004305.689ON72856810.17
TDEL0A074306.328ON12461760.17
AFR453W8.470ON569132810.18
YCR060W (TAH1)6.328ON11163750.21
CAGL0K11209g8.470ON59092800.22
Ecym_71427.412ON67596800.23
NDAI0C043205.352ON70667800.24
NDAI0C051308.470ON59055790.29
Kpol_1028.516.328ON11758740.30
Kpol_1006.43.367ON73297790.31
KLLA0C15455g8.470ON566135780.32
TPHA0L012108.470ON58849780.38
KLTH0E10934g8.470ON568117770.43
TPHA0I015102.152ON60371770.44
KLTH0A00638g7.546ON141166780.45
NDAI0A081703.395ON53967760.57
SAKL0H11946g8.470ON573119760.65
CAGL0K07986g3.395ON53265750.82
NCAS0B025608.470ON57849750.84
NCAS0D045006.328ON12166700.93
Smik_4.4918.470ON61249740.99
SAKL0E14542g5.689ON69053741.1
Skud_4.5068.470ON61149741.1
AAR054C6.328ON13361701.2
Suva_2.4108.470ON61149741.2
KAFR0J025706.328ON12159691.3
YDR244W (PEX5)8.470ON61249731.3
KNAG0B022407.412ON73996721.9
SAKL0F12936g7.412ON63296721.9
NDAI0J001307.546ON140349722.1
CAGL0C03289g4.6ON164885722.3
Kwal_27.107407.412ON62893712.6
KAFR0L018707.412ON71285712.8
CAGL0H07095g5.352ON661113712.9
KAFR0L001904.6ON165374713.3
CAGL0J09570g8.470ON549145703.4
KNAG0B024607.373ON39886693.8
CAGL0E01573g3.32ON90499704.1
Smik_3.1596.328ON11555654.3
KLTH0F18150g5.689ON689141694.4
TBLA0A016908.470ON66249694.6
TDEL0B016608.470ON54948694.7
TBLA0H019705.352ON84067694.7
CAGL0M08030g1.456ON387116685.0
Kpol_1031.648.470ON60776685.6
Skud_3.1356.328ON11858645.8
NCAS0A147707.458ON30089676.0
KAFR0E028208.470ON56264686.5
ACR173W7.458ON285109676.9
ZYRO0C17138g3.395ON53626678.7
KNAG0J028304.27ON37752669.0
ZYRO0C02970g3.32ON896100679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.168
         (348 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   633   0.0  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   566   0.0  
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   556   0.0  
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   518   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   375   e-130
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   360   e-123
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   355   e-121
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   354   e-121
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   353   e-121
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   353   e-121
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   352   e-120
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   351   e-120
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   346   e-118
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   344   e-117
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   328   e-111
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   322   e-109
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   313   e-105
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   313   e-105
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   303   e-101
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   276   9e-91
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   218   1e-67
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   155   1e-43
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   155   2e-43
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   144   2e-39
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   135   4e-36
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    92   7e-20
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    89   8e-19
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     88   2e-18
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    86   1e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    84   4e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    84   6e-17
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    84   6e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    83   9e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    83   9e-17
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    82   2e-16
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    82   3e-16
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    81   4e-16
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    81   5e-16
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    80   8e-16
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    80   1e-15
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    79   2e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    77   7e-15
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    77   1e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       76   2e-14
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    74   1e-13
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    74   1e-13
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    65   1e-10
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    62   7e-10
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    60   2e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    60   4e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   6e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    59   7e-09
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    59   9e-09
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    59   1e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    58   1e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    58   2e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    57   2e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    57   4e-08
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    55   1e-07
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    55   1e-07
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    55   2e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    53   5e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    53   6e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    53   7e-07
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    53   7e-07
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    52   1e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    49   7e-06
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    49   8e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    49   9e-06
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    49   1e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    49   1e-05
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    49   2e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    48   2e-05
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    47   3e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    47   4e-05
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    47   4e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    47   4e-05
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    47   5e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    47   5e-05
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    46   6e-05
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    46   1e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    45   1e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    45   2e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    45   2e-04
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    44   4e-04
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    44   4e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    44   5e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   5e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    44   5e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    41   5e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    42   8e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    43   8e-04
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    43   0.001
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    43   0.001
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    42   0.001
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    43   0.001
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    43   0.001
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    43   0.001
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    43   0.001
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    42   0.001
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    40   0.001
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    42   0.002
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.002
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    42   0.002
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    42   0.002
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    42   0.003
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    42   0.003
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    41   0.004
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    40   0.004
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    40   0.006
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    40   0.006
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    38   0.006
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    40   0.006
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    38   0.007
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    40   0.007
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.008
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.008
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    40   0.008
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    40   0.011
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    39   0.013
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    39   0.017
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    39   0.019
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    39   0.020
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    39   0.026
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    38   0.027
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    38   0.031
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    38   0.032
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    38   0.033
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    38   0.035
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    38   0.039
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    38   0.041
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    37   0.050
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    37   0.056
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.058
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    35   0.093
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    36   0.11 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    36   0.11 
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    36   0.16 
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    36   0.17 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    34   0.17 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    36   0.18 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    33   0.21 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    35   0.22 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    35   0.23 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    35   0.24 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.29 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.30 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    35   0.31 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    35   0.32 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   0.38 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    34   0.43 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    34   0.44 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    35   0.45 
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    34   0.57 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   0.65 
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    33   0.82 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    33   0.84 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    32   0.93 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    33   0.99 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    33   1.1  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.1  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    32   1.2  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.2  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    31   1.3  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   1.3  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    32   1.9  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   1.9  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   2.1  
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...    32   2.3  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    32   2.6  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    32   2.8  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   2.9  
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...    32   3.3  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    32   3.4  
KNAG0B02460 Chr2 complement(480056..481252) [1197 bp, 398 aa] {O...    31   3.8  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    32   4.1  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    30   4.3  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    31   4.4  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    31   4.6  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    31   4.7  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    31   4.7  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    31   5.0  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    31   5.6  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    29   5.8  
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    30   6.0  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    31   6.5  
ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic hom...    30   6.9  
ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]...    30   8.7  
KNAG0J02830 Chr10 complement(542239..543372) [1134 bp, 377 aa] {...    30   9.0  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    30   9.5  

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/348 (91%), Positives = 317/348 (91%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
           DASQGA                   MNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348
           AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/348 (81%), Positives = 299/348 (85%), Gaps = 2/348 (0%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MSASK EIA+LIVNYFSSIVEKKEISED ADSLNVAMDCISEAFGFEREAV  IL  SEF
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KGQ+L D+LNS SRV ES KKDDA+NVE+NIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AINKYTEAIKVLPTNAIYYANRAAAHSSLK YD+AV+DAESAISIDP+YFRGYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDAD   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDAD--V 238

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
           DASQGA                   MNNPQLMQAAQKMMSNPGAMQNIQKMMQDP+I+QM
Sbjct: 239 DASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQM 298

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348
           AEGF SGGG PNLSDLMNNPALR+MAGNLFGGAGA ST++T D+ENKQ
Sbjct: 299 AEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQSTDETPDNENKQ 346

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/347 (80%), Positives = 297/347 (85%), Gaps = 2/347 (0%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M ASK EIA+LIVNYFSSIVEKKEISED ADSLNVAMDCISEAFGFER+A   IL  SEF
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KG++L D+LNS S+ SES +KDDAQNVEVNIP            LKMQGNKAMANKDYEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AINKYTEAI+VLPTNAIYYANRAAAHSSL+ YDEAV+DAES+ISIDP+YFRGYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK VPEQSRDADAN 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADAN- 239

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
            ASQGA                   MNNPQLMQAAQKMMSNPGAMQNIQKMMQDP+I+QM
Sbjct: 240 -ASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQM 298

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENK 347
           AEGFTSGGGAPNLSDLMNNPALR+MAGNLFGGA APS+E T DSENK
Sbjct: 299 AEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/348 (78%), Positives = 295/348 (84%), Gaps = 2/348 (0%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MSASK EIASLIVNYFSSIVEKKE+SEDSADSLNVAMDCISEAFGFER+AV SIL+ S F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           KGQ+L +LL+S+S++ ES KKDDAQNVEVNIP            LK+QGNKAMANK+YEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KYTEAI VLPTNAIYYANRAAAHSSLK YDEA++DAESAIS+DP+YFRGYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YAQGKPEEALEAYKKVLDIEGDNAT+AMKRDYESAKK+VEQSLNLEKT PEQ R  DA A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPR--DAGA 238

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
           +A QGA                   MNNPQLMQAAQKMMSNPGAMQNIQ MMQDP+I+QM
Sbjct: 239 NAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQM 298

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENKQ 348
           AEGFTSGGG PNLSDLM NPALR+MAG+LFGGA APSTEDT DSE KQ
Sbjct: 299 AEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETKQ 346

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  375 bits (963), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/331 (58%), Positives = 245/331 (74%), Gaps = 10/331 (3%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+ S  EIA+LIV++ SS VEK  +SED ADSLNVA+DCISEAF FER+AV  I++NS F
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNS-F 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
             + L +LL S +    +     ++ V+VNIP            LK+QGNKAMA+KD+E 
Sbjct: 60  DNRKLDELLKSAATALPT----QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KYTEAI+VLP+NA+YYANRAAA+SSLK Y+E+V+DAESAI ++P+Y +GYSRLGFAK
Sbjct: 116 AIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +++ 
Sbjct: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
           DA  GA                   +NNPQ+M AAQK+M NPGAM    +MM++P ++QM
Sbjct: 236 DAGAGA--SGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQM 290

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           AE F+SGGG PNL DLM+NPA++ MA NLFG
Sbjct: 291 AENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  360 bits (924), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 248/339 (73%), Gaps = 9/339 (2%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  +IA+LI+++ S++V+K E+SED+ADSLNVAMDCI+EAF FER++V  ++++S F
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSS-F 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           +G +L+  LN ++  S +T   D + V+VN+             LK++GNKAMA KDYEL
Sbjct: 60  QGNSLSSYLNGSTSASAATTTAD-ETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYEL 118

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KYTEAI  LPTNA+Y+ANRAAA+SSLK YDEAVEDA SAI I+PTY +GYSRLGFAK
Sbjct: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK+    S +A A +
Sbjct: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTV--SGNATAES 236

Query: 241 DASQGAXXXXXXX-----XXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDP 295
           D++  A                        +NNPQLMQAAQ+MM +P AM+ ++ MMQ+P
Sbjct: 237 DSASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNP 296

Query: 296 NIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAG 334
           ++KQMA+ F+SG G P+ S LMN+P++R MA N+FG  G
Sbjct: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGG 335

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  355 bits (912), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 186/341 (54%), Positives = 238/341 (69%), Gaps = 7/341 (2%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  E+ASLIV+Y S +VEKK +SE++ DSLNVA+DCI E+F  ++    ++     F
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV-----F 55

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+ L +LL + S  S  T    A++++VNIP            LK++GNKAMA KD++L
Sbjct: 56  GGKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDL 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KY++AI+VLPTNA+YYANRAAAHSS+K Y+EA++DAESAI  DPTY +GYSRLG+AK
Sbjct: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           +A G+ E+ALEAYKKVLDIEGD A++ MKRDYE+AKKKVEQSL+LEK    Q+R ADA A
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGA 235

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
             +                      +NNPQLMQAAQ+MM NP AM  ++ MMQ+P ++QM
Sbjct: 236 GGA--GGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQM 293

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDT 341
           AE F  G G PN+ DLMNNPALR MAG+LFGGA   +  D 
Sbjct: 294 AENFAQGNGMPNMGDLMNNPALRDMAGSLFGGANGNAPNDV 334

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  354 bits (909), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 190/346 (54%), Positives = 243/346 (70%), Gaps = 22/346 (6%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+AS  EIA+LIV+Y +++V+KKE+S D+ADSLNVAMDCI+EAF FER++V   ++ S F
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVK-SAF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXX--LKMQGNKAMANKDY 118
            G  LT  L+ ++            +++VNI               LK++GNKAMA KDY
Sbjct: 60  NGNGLTSFLSGSA----------TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDY 109

Query: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGF 178
           E AI KY+EAI+VLPTNA+YYANRAAA+SSLK YD+AV DAESAI ++PTY +GYSRLGF
Sbjct: 110 ESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGF 169

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADA 238
           AK+AQGK E+AL+AYKKVLDIEGD AT+ MKRDYE+AKKKVEQSLNLEK  P+++ + ++
Sbjct: 170 AKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETES 228

Query: 239 NADASQGAXXXX--------XXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 290
           NADA  GA                           + NPQ+MQAAQ+MM NP AMQ ++ 
Sbjct: 229 NADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMES 288

Query: 291 MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAP 336
           MMQ+P ++QMAE F SG G P+LS +MNNP L+ MA N+FG  G P
Sbjct: 289 MMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFP 334

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  353 bits (907), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 177/337 (52%), Positives = 242/337 (71%), Gaps = 7/337 (2%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+ S  E++SLI++Y + +V K E+S D  DSLNVA+DC++E FG E++ + + +E S+F
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIE-SKF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G++LT+LL++ S+ + +T +   + V++NIP            LK++GNKA+A+KDY+L
Sbjct: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDL 119

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           A+ KYTEAIK+LPTNA+Y+ANRAAA+++ + YDEAV+DAE AI +DP Y +GYSRL +AK
Sbjct: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     N 
Sbjct: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
            A  G                    MNNPQ+MQAAQ MMSNPGAM+ IQ MMQ+P I+QM
Sbjct: 240 AAGGG-----FPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQM 294

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPS 337
           AE F  GG  P+ S++MNNPA+R+MA +LF GAG P+
Sbjct: 295 AEQF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPA 330

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 236/332 (71%), Gaps = 13/332 (3%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  ++A+LIV++ S  VE KE+SED  DSLNVA+DCI+EAF F+RE+V + LE + F
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKT-F 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G++L  ++ + S  S S +    ++V+VNIP            LK++GNKAMA KD+E 
Sbjct: 60  AGRSLKQVVEAASVGSSSPQ----ESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQ 115

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           A+ KY+EAI+VLPTNA+YYANRAAAHSSLK Y+EAV+DAE AI ++P+Y +GYSRLGFA+
Sbjct: 116 AVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YA GKPEEAL+AYKKVLDIEG+ AT+AMKRDY++A KKV QSLN+EK+ P  +RD     
Sbjct: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDG---- 231

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
            A                       +NNPQLMQAAQ+MM NP AMQ +   M +P +KQM
Sbjct: 232 -AGSATGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEV---MNNPAVKQM 287

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332
           AE F SGGG P+++DLMNNPAL  MA N+FGG
Sbjct: 288 AEKFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  352 bits (904), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 239/342 (69%), Gaps = 11/342 (3%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  E+ SLIV++ S++++ KEISEDSADSLNVA+DCI+E+F FER+ V   L++ +F
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQD-KF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+ L ++L+S S  S  ++K+++  V+VNIP             K++GNKAMA KDY L
Sbjct: 60  SGKTLKEILSSASATSTGSEKEES--VKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KY+EAIK LPTN IYYANRAAA+SS+K YD A++DAE AI IDP Y +GYSRL FAK
Sbjct: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK---TVPEQSRDA- 236
           YA  KPEEALE YKKVLD+EGD AT AMKRD+E AK +VE S+NLEK   T PE SR A 
Sbjct: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237

Query: 237 --DANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 294
              AN  A  G                    +NNPQ+MQAAQ+MMS+P +MQ +Q+MMQ+
Sbjct: 238 QQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQN 297

Query: 295 PNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAP 336
           PN+++MA+   SG    NL DLMNNP+++ MA NLFG  GAP
Sbjct: 298 PNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPNGAP 337

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  351 bits (900), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 178/325 (54%), Positives = 232/325 (71%), Gaps = 11/325 (3%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+ S  +I+SLIV+Y + +V+KK +SEDS DSLNVA++CI+EAFG E+ +      ++ F
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGS-----SSAAF 55

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+NL +LL++ +    S      +NV+VNIP            LK++GNKAMA KDYEL
Sbjct: 56  GGKNLAELLSAGAGAPSSQ----GENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYEL 111

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KY+EAI V+PTNA+YYANRAAAHSSLK YDEA++DAESA+ +D +Y +GYSRLG+AK
Sbjct: 112 AIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAK 171

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           +AQGK EEALEAYKKVLDIEGD+AT+ MKRDYE+AK+KVEQ+L L KT  +++  +D   
Sbjct: 172 FAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKT--DETETSDRGT 229

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
               GA                   +NNPQ+MQAAQ+MM NP AM  ++ MMQ+PN++QM
Sbjct: 230 GEPAGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQM 289

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSM 325
           AE F  G G PNL+D+MNNPALR M
Sbjct: 290 AEKFAGGNGTPNLNDIMNNPALRDM 314

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 184/324 (56%), Positives = 225/324 (69%), Gaps = 8/324 (2%)

Query: 7   EIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEFKGQNLT 66
           E+A++I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER  V S+L+ S    + L 
Sbjct: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGLE 62

Query: 67  DLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYELAINKYT 126
           + L        + K +D   V+VNIP            LK++GNKAMA KD+ELAI KY+
Sbjct: 63  ECLECMK--GGAVKSED---VKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYS 117

Query: 127 EAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKP 186
           EAI+VLPTNAIYYANRAAAHSSLK YDEAV DAE AI IDP Y +GYSRLGFAKYAQ KP
Sbjct: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177

Query: 187 EEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANADASQGA 246
           EEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEKT P+           +  A
Sbjct: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKT-PDARGADSGAGAGAG-A 235

Query: 247 XXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQMAEGFTS 306
                              MNNPQ+MQAAQ+MMSNP A+Q +Q MMQDP+I+QMAE FTS
Sbjct: 236 GGAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTS 295

Query: 307 GGGAPNLSDLMNNPALRSMAGNLF 330
           G G PN+ DLM+NPALR+MA ++F
Sbjct: 296 GNGTPNMDDLMSNPALRNMASSMF 319

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  344 bits (882), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 243/350 (69%), Gaps = 15/350 (4%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS +  +I +LIV++ S+I+EK E+SED+ADSLNVAMDCISEA  F+RE VP  ++N +F
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKN-KF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+ L D+LN+TS  + +T  +  ++VEVNIP             K++GNKAMA KD+ L
Sbjct: 60  NGKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           A+ KYTEAIK+LPTNAIYYANRAAAHSSLK ++EA++DAESAI IDP+Y +GYSRL FAK
Sbjct: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT-VPEQSRDADAN 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239

Query: 240 ADASQ---------GAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK 290
            +++Q         G                    ++NP  M  AQK+MS+P AMQ +Q 
Sbjct: 240 NESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQS 299

Query: 291 MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTED 340
           MM DP+++ +A  F +G    +++D+MNNPA+R+MA NLF   G PS E+
Sbjct: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLF--KGNPSEEN 345

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 178/332 (53%), Positives = 236/332 (71%), Gaps = 8/332 (2%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+ +K E+ASLI++Y     E KEI ED  DSLNVA+DC++EAF  E+E+  S++E S F
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            GQ+L  ++ ++S+   +T+++    V+VNIP            LK++GNKAMA KD+E 
Sbjct: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEH 116

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSLK Y EAVEDAE+AI ++P+Y +GYSRLGFA+
Sbjct: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P  S     +A
Sbjct: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300
               G                    + NPQ+MQAAQ+MM NP AM   Q+MM +P IKQM
Sbjct: 237 AGGSG-FPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAM---QEMMSNPAIKQM 292

Query: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332
           A+ F SGGG P+++DLMNNPAL  MA N+FGG
Sbjct: 293 ADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  322 bits (825), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/338 (51%), Positives = 227/338 (67%), Gaps = 18/338 (5%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M  S  EI++LIV+Y   + EK ++SED  DSLNVA+DCI+++F FER++   +++ S+F
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIK-SKF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXX----XXXXXXXXXLKMQGNKAMANK 116
              +L +LL     +  S K    +NV VN+P                LK++GNKAMA K
Sbjct: 60  YNLSLPELLEVA--MENSAK----ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176
           D++LAI KY+EAI + P NAIYYANRAAA+SSLK +++A EDAESAI +DP Y +GYSRL
Sbjct: 114 DFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK--TVPEQSR 234
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK  + P++  
Sbjct: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233

Query: 235 DADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 294
             ++ A+A+ G                       PQLMQAAQ+MMS+P AM  IQ MMQ+
Sbjct: 234 VTESAANAAAGGFPDMSSMLGGGLNGLLNN----PQLMQAAQQMMSDPNAMSKIQSMMQN 289

Query: 295 PNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332
           P+I+QMAE F   G  P+ S LMN+P ++ MA N FGG
Sbjct: 290 PSIRQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  313 bits (802), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 172/332 (51%), Positives = 220/332 (66%), Gaps = 17/332 (5%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M  S  EIA+LIV + S+    K++ E+  DSLNVA+DCI+EAF  ERE    I+  + +
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57

Query: 61  KGQNLTDLLNS-TSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
            G+ L DL+ S  S  + S+ +    N + + P            LK++GNKA A KD+E
Sbjct: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAEN----LKLEGNKAFAAKDFE 113

Query: 120 LAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFA 179
            A+ KYTEAI+++P NA++Y NRAAA+SS K ++EAV DAESA+ I+P+Y RGYSRLG A
Sbjct: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173

Query: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADAN 239
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE  +P+        
Sbjct: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQ---- 228

Query: 240 ADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQ 299
              S+G+                   +NNPQ+MQAAQKMM NP AM   Q+MM +P IKQ
Sbjct: 229 -QTSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQ 284

Query: 300 MAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           MA+ F SGGG PNL D+M +P ++ MAG  FG
Sbjct: 285 MAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  313 bits (801), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 231/334 (69%), Gaps = 15/334 (4%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  +IA+L+V++ S+ +EKK +S D+ADSLNVA+DCI+EAF FE++ V S L  S+F
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXX----XXXXXXLKMQGNKAMANK 116
            G++LT+LL++ +      +    ++++V+I                 LK++GNKAMA K
Sbjct: 60  GGKSLTELLDAATNAK--GRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAK 117

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176
           DY LA+ KY  AIK++PT A+YYANRAAA+SS + YDEA++DAESAI ++P + +GYSRL
Sbjct: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA 236
           GFAK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK+    +  +
Sbjct: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASAS 237

Query: 237 DANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPN 296
            + +                         +NNPQ+MQAAQ+MMSNP AM+ ++ MMQ+P+
Sbjct: 238 ASASAGGM-------PDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPS 290

Query: 297 IKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLF 330
           I+QMAE  +S G +  + D MNNPA+R MA NLF
Sbjct: 291 IRQMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  303 bits (777), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 229/339 (67%), Gaps = 17/339 (5%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  EIA+LIV++ SS      ++ED  DSLNVA+DCI+EAF FER+   S++ +  F
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLI-SGPF 57

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
            G+ L +LL S    + S+     + V+V+IP            LK+QGNKAMA K ++ 
Sbjct: 58  NGKKLPELLAS----APSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDE 113

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KYT AI+V P+NA+YY+NRAAA+SSLK Y++AV+DAE AI +DPTY +G+SRLGFAK
Sbjct: 114 AIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK 173

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
           YA  KPEEAL+AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NLEK+    S +  ++ 
Sbjct: 174 YALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDK 233

Query: 241 DASQGAXX-------XXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQKMMQ 293
            A++G                           +NNPQ+MQAA+KMM NPG MQ+   MM 
Sbjct: 234 SATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQD---MMS 290

Query: 294 DPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332
           +P +KQMA  F+SGGG P+LS +MN+P++R MA N+FGG
Sbjct: 291 NPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  276 bits (706), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 220/343 (64%), Gaps = 30/343 (8%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPS---ILEN 57
           MS S  +IA+LIV++ ++    K + ED  DSL VA+DCI+EAF    E  P     L +
Sbjct: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAF----ELGPGEADTLVS 54

Query: 58  SEFKGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKD 117
            +  G++L+ LL  T+ ++ ++   DA   +V               LK++GN+AMA KD
Sbjct: 55  EKCGGRSLSQLL--TTGMAHTS---DAGEPKV----AAEELKKEAEALKLEGNRAMAAKD 105

Query: 118 YELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLG 177
           YE AI KYT AI+VLPT+A+YYANRAAA+SSL+ Y++AVEDAE A  +D +Y +G+SRLG
Sbjct: 106 YETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLG 165

Query: 178 FAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT--VPEQSRD 235
           +AKYA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E    
Sbjct: 166 YAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDS 225

Query: 236 ADANAD-------ASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNI 288
           A  +A        AS                      +NNPQ+MQAAQKMM NP A   I
Sbjct: 226 AAGSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA---I 282

Query: 289 QKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           Q+MM +P IK+MAE F SG G+  L DLM +PA+R+MA   FG
Sbjct: 283 QEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  218 bits (554), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/354 (37%), Positives = 193/354 (54%), Gaps = 23/354 (6%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGF----EREAVPSILE 56
           MS +  +  +LIVNY   I++ KE+SED+A+SLNVA+DCIS+ F      E + +  +  
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 57  NSEFKGQNLTDL-LNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMAN 115
            S+ K   L  L L + S V E         +EV               LK++GNK M+ 
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVE---------LEVKNEEISEDKKKEAEALKLEGNKQMSL 111

Query: 116 KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSR 175
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  ++ +  AV DA +AI +DPTY + YSR
Sbjct: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRD 235
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231

Query: 236 ADANADASQGAXXXXXXXXXXXXXXXXXXXMNNP--QLMQAAQKMMSNPGAMQNIQKMMQ 293
              N                          MNN              NP  MQ ++ +MQ
Sbjct: 232 PPLNT-------TDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQ 284

Query: 294 DPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENK 347
           +P ++Q AE   +G G   LSD++NNP+++ +A  L  G    S+    + E+K
Sbjct: 285 NPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  155 bits (392), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/342 (31%), Positives = 168/342 (49%), Gaps = 38/342 (11%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS +K + ASLI++Y S +     + ED  +SL VA+ CI E+F  + + +P+ L     
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSL----- 55

Query: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYEL 120
           K + L  +L       E+T+K   +  E                LK +GN+AM    YE 
Sbjct: 56  KERTLKTILQENLNTLEATQKIHNEEAEA---------------LKKEGNEAMIEGQYEE 100

Query: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180
           AI KYTEAI+    N  YY+NR+ A+S L  Y++AV DA  AI+IDP++ + YSRLG+AK
Sbjct: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159

Query: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ   L+K    + R +    
Sbjct: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEV 216

Query: 241 DASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGAMQNIQK--------MM 292
            + +                      +N    +  ++  S    + NI +        +M
Sbjct: 217 TSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLM 276

Query: 293 QDPNIKQMAEGFTSGGGAPNLS----DLMNNPALRSMAGNLF 330
            +P +KQM   F +    P+ S    D++NNP LR+    L 
Sbjct: 277 NNPQLKQMV--FQAINDNPDASRQVKDVLNNPLLRTTLSELM 316

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 172/363 (47%), Gaps = 49/363 (13%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           M+ +  EIAS+IV+YF+  +   ++++D+ DSLNVA+DCI++ F  +++ + +IL+ + +
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILK-TAY 59

Query: 61  KGQNLTDLL-------------NSTSRVSESTK------------KDDAQNVEVNI---- 91
           +  +L   L             N+T  VS  TK            KDD  NV V +    
Sbjct: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDI-NVPVKVIEDI 118

Query: 92  -----PXXXXXXXXXXXXLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH 146
                             LK +GN+ M  K Y  AI  Y++AIK+ PTN  YY NRA A+
Sbjct: 119 EETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAY 178

Query: 147 SSLKGYDEAVEDAESAISID----PTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI--- 199
                +D A+ DA  +I ID    PT F+ Y RLG AKY  G  E +L A+K++++I   
Sbjct: 179 IKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQE 238

Query: 200 --EGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXX 257
             +GD  T+ M  DYE AK+KV Q L   +      ++   N+                 
Sbjct: 239 NNKGDEITKQMDADYEKAKEKV-QELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNM 297

Query: 258 XXXXXXXXMNNPQLMQAAQKMM-SNPGAMQNIQKMMQDPNIKQMAEGFTSG--GGAPNLS 314
                   M+NP   +  ++++ SNP A Q    +M DP ++QM E   S      P L 
Sbjct: 298 AGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILK 357

Query: 315 DLM 317
           DL 
Sbjct: 358 DLF 360

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  144 bits (363), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 138/235 (58%), Gaps = 26/235 (11%)

Query: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60
           MS S  EIAS IV+Y SS++   +++ED A+S++VA++CI ++F  + E    +  +S+ 
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEE----VSADSDL 56

Query: 61  KGQNLTDL-LNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQGNKAMANKDYE 119
               L +L L    ++SE  ++                       LK++GNKA+  ++Y+
Sbjct: 57  ATVLLANLNLEPEPKLSEKERE---------------LVNEQAIKLKLEGNKAVERENYK 101

Query: 120 LAINKYTEAIKVLPTNAI-----YYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYS 174
            AI+KYT AI +L  N +     Y +N++ A +    Y+EA +DA + I IDPT+ +GYS
Sbjct: 102 DAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYS 161

Query: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTV 229
           RL  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 162 RLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  135 bits (341), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 161/338 (47%), Gaps = 40/338 (11%)

Query: 7   EIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEFKGQNLT 66
           ++A LIVN+  +++ KKEIS+D+ DSLNVA+DCI + +      + S L   +F   +LT
Sbjct: 10  DVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLI-LKFSKSDLT 68

Query: 67  DLLNSTSR---------------------VSESTKK-------DDAQNVEVNIPXXXXXX 98
            +LN+ ++                     ++ES KK       D+ + + +N+       
Sbjct: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128

Query: 99  -----XXXXXXLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYD 153
                       K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  +  Y+
Sbjct: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188

Query: 154 EAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYE 213
            A+ DA   ISID  + + Y RL   K  Q +  +AL+ YKK +++  D+  E + R++E
Sbjct: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248

Query: 214 SAKKKVEQSLNLEKTVPEQSRDADANADASQGAXXXXXX-XXXXXXXXXXXXXMNNPQLM 272
             K KV+  ++L     E S D   N                           ++NP L 
Sbjct: 249 DLKLKVQTDISLR----EISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQ 304

Query: 273 QAAQKMM-SNPGAMQNIQKMMQDPNIKQMAEGFTSGGG 309
           Q   K++ +NP A +NI  ++ +P +K + + F +G  
Sbjct: 305 QMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 69/99 (69%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDYE AI+ +++AI+V  T N ++Y+NR+A ++SLK + EA+ DAE  + 
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PT+ +GY+RLG A    G  +EA  +YKK L+++G N
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 91/207 (43%), Gaps = 27/207 (13%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G       D+  A+  YTE IK  P +A  Y+NRAAA S L  + EA+ED   AI  
Sbjct: 394 RLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEK 453

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD--YESAKKKVEQ 221
           DP + R Y R   A+ A  +   A+E     +  D E +N+    + D  Y  A ++  Q
Sbjct: 454 DPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKASQQRFQ 513

Query: 222 SLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSN 281
             +  +T PEQ  +  A  D    A                   M +P +    Q+   N
Sbjct: 514 PASSNET-PEQVYER-AMKDPEVIAI------------------MQDPVMQSILQQAQQN 553

Query: 282 PGAMQNIQKMMQDPNIKQMAEGFTSGG 308
           P A+   Q+ M++P++ +  +   + G
Sbjct: 554 PAAL---QEHMKNPDVFKKIQTLIAAG 577

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVEDAES 161
           GNKA   + ++ AI  Y  A   L  +  Y  NR+AA        ++LK  DEAVE    
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWN-LHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 162 AISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
             +      + ++R+G   +     ++A+E Y+K L
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 53/232 (22%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLP-TNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A + K+YE A++ +++AI+V P  N + Y+NR+A ++SLK + +A+ DA     
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----EAMKRDYESAKKKV 219
           I+PT+ +GY+R+G A Y  G  +EA ++YKK L+++  N       E +KR  E+ K + 
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKRTQEARKAQP 128

Query: 220 EQSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMM 279
           +  L                                           N+P L+   +K+ 
Sbjct: 129 DMGLT---------------------------------------SMFNDPNLI---EKLK 146

Query: 280 SNPGAMQNIQKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           SNP   +    MM DP +      + S   A + ++L ++P L ++   L G
Sbjct: 147 SNPKTAE----MMNDPQLVAKLLSYRSNSQALS-TELFSDPRLMTIMATLLG 193

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 89/212 (41%), Gaps = 37/212 (17%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG        +  A+  YTE I   P +A  Y+NRAAA S L  + EA+ D E A+  
Sbjct: 396 RIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEK 455

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI---------EGDNATEAMKRDYESAK 216
           DP + + Y R   A+ A  +   ALE     LDI          G N  E  +   ++ +
Sbjct: 456 DPNFVKAYIRKATAQIAIKEYSSALE----TLDIARSKDTELNNGSNIREINQLYAKATQ 511

Query: 217 KKVEQSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQ 276
           ++ E + + E   PEQ+    A  D    A                   M +P +    Q
Sbjct: 512 QRFEPASSNE--TPEQTYQR-AMKDPEVAAI------------------MQDPVMQSILQ 550

Query: 277 KMMSNPGAMQNIQKMMQDPNIKQMAEGFTSGG 308
           +  +NP A+   Q+ M++P I +  +   S G
Sbjct: 551 QAQTNPAAL---QEHMKNPEIFKKIQTLISAG 579

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 68/99 (68%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A  +KD+  AI  +T+AI+V PT N + Y+NR+AA++S K + EA+ DA   + 
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PT+ +GY+RLG A++  G  EEA + YK+ L ++ +N
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 84/206 (40%), Gaps = 25/206 (12%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  Y+E IK  P +A  Y+NRAAA S L  + EA++D ++AI  
Sbjct: 393 RLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKK 452

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKK---VEQS 222
           DP + R Y R   A+        A++ Y   LD              E AK K   V   
Sbjct: 453 DPNFVRAYIRKATAQI-------AIKEYANALDT------------LEEAKSKDSSVNNG 493

Query: 223 LNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 282
            N  + +  Q +       A  G                    M +P +    Q+  +NP
Sbjct: 494 ANSNEIMRLQMKATQERFQAPTGNETPEETYKRAMQDPEVAAIMQDPVMQSILQQAQTNP 553

Query: 283 GAMQNIQKMMQDPNIKQMAEGFTSGG 308
            A+   Q+ M++P I +  +   + G
Sbjct: 554 AAL---QEHMKNPEISKKIQILIAAG 576

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 64/131 (48%), Gaps = 10/131 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K++GNK      ++ AI +Y +A   L  +  Y  NR+AA        +++   +EAV+ 
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQ 317

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAK 216
                +      + ++R+G A + +G  +++++ Y+K L      D  T+    + E  K
Sbjct: 318 GRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKK 377

Query: 217 KKVEQSLNLEK 227
           ++ EQ ++ EK
Sbjct: 378 QEAEQYIDPEK 388

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K QGN A   KD+E A   +++AI+   T N + Y+NR+A ++SLK + EA+EDAE  +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I+PT+ +GY+R+G A+Y  G  ++A + YKK L+I+  N
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN 105

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 5/106 (4%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +     D+  A++ YTE IK  P +A  Y+NRAA  + L  + +A++D + AIS 
Sbjct: 405 RLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISK 464

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALE----AYKKVLDI-EGDNATE 206
           DP + R Y R   A+ A  +   A+E    A  K L+I +G NA E
Sbjct: 465 DPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANARE 510

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 112/233 (48%), Gaps = 55/233 (23%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SLK + +A+ DA+  I+
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P++ +GY+RLG A    G  +EA   YKK L+++  N         ++AK  ++Q   
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN---------KAAKDGLDQ--- 116

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           + +T  +Q+R A  +   +Q                                 + ++P  
Sbjct: 117 VHRT--QQARQAQPDLGLTQ---------------------------------LFADPNL 141

Query: 285 MQNIQK------MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           ++N++K      MM+DP +     G+     A    DL  +P L ++   L G
Sbjct: 142 IENLKKNPKTSDMMKDPQLVAKLIGYKQNPQAIG-QDLFTDPRLMTIMATLMG 193

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 29/208 (13%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G       D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA+ D   AI  
Sbjct: 400 RLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD---YESAKKKVE 220
           DP + R Y R   A+ A  +   ALE     +  D + +N   + + D   Y++++++ +
Sbjct: 460 DPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQ 519

Query: 221 QSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMS 280
                E   PE++    A  D    A                   M +P +    Q+   
Sbjct: 520 PGTGNE--TPEETYQR-AMKDPEVAAI------------------MQDPVMQSILQQAQQ 558

Query: 281 NPGAMQNIQKMMQDPNIKQMAEGFTSGG 308
           NP A+   Q+ M++P + +  +   + G
Sbjct: 559 NPAAL---QEHMKNPEVFKKIQTLIAAG 583

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GNK    + ++ AI  Y +A + L  +  Y  NRAAA        +++   ++AVE 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQ 324

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +      R ++R+G A +  G  ++ +E Y+K L
Sbjct: 325 GREMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 111/233 (47%), Gaps = 55/233 (23%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDY+ AI  +T+AI+V  T N + Y+NR+A ++SLK + +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P++ +GY+RLG A    G  +EA   YKK L+++  N         ++AK+ ++Q   
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN---------KAAKEGLDQ--- 116

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           + +T  +Q+R A  +   +Q                                 + ++P  
Sbjct: 117 VHRT--QQARQAQPDLGLTQ---------------------------------LFADPNL 141

Query: 285 MQNIQK------MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
           ++N++K      MM+DP +     G+     A    DL  +P L ++   L G
Sbjct: 142 IENLKKNPKTSEMMKDPQLVAKLIGYKQNPQAIG-QDLFTDPRLMTIMATLMG 193

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA+ D   AI  
Sbjct: 400 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD---YESAKKKVE 220
           DP + R Y R   A+ A  +   ALE     +  D E +N + A + D   Y++++++ +
Sbjct: 460 DPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQ 519

Query: 221 QSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMS 280
              + E   PE++    A  D    A                   M +P +    Q+   
Sbjct: 520 PGTSNE--TPEETYQR-AMKDPEVAA------------------IMQDPVMQSILQQAQQ 558

Query: 281 NPGAMQNIQKMMQDPNIKQMAEGFTSGG 308
           NP A+   Q+ M++P + +  +   + G
Sbjct: 559 NPAAL---QEHMKNPEVFKKIQTLIAAG 583

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GNK    + ++ AI  Y +A + L  +  Y  NRAAA        +++   ++AVE 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQ 324

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +      + ++R+G A +  G  ++ +E Y+K L
Sbjct: 325 GREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 116/228 (50%), Gaps = 46/228 (20%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVL-PTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A A KD+E AI  +T+AI+V    N + Y+NR+A ++S K +++A+EDA+  ++
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P + +GY+R+G A +  G  +EA + YKK L+++  N         ++A+  +EQ   
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN---------KAAQDGLEQ--- 114

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           + KT  +QSR    +    Q                      N+P L+   +K+ +NP  
Sbjct: 115 VHKT--QQSRQQQPDLGLGQ--------------------IFNDPNLI---EKLKNNPKT 149

Query: 285 MQNIQKMMQDPNIKQMAEGFTSGGGAPNLS-DLMNNPALRSMAGNLFG 331
            +    +M+DP +      F S    P +  +++ +P L ++   L G
Sbjct: 150 AE----LMKDPQLVAKILQFKSN---PQMGMEVLQDPRLMTIMAALMG 190

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +     D+  A+  YTE IK  P +A  Y+NRAAA S L  + EA++D   AIS 
Sbjct: 397 RLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISK 456

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 457 DPNFIRAYIRKATAQIA 473

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GNK    + ++ AI  Y++A + L  +  Y  NRAAA        +++K   EAVE 
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQ 321

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +      + ++R+G + +   + ++A+E Y+K L
Sbjct: 322 GRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   K+Y+ AI K+T+AI+V  T N + Y+NR+A ++S K + + +EDA   + 
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+PT+ +GY+R+G A +  G  +EA +AYKK L+++  N
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 92/207 (44%), Gaps = 27/207 (13%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE I   P++A  Y+NRAAA S L  + EA+ D  +AI  
Sbjct: 393 RLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEK 452

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYK--KVLDIEGDNATEAMKRD--YESAKKKVEQ 221
           DP + R Y R   A+ A      A+E     +  D E +N   + + D  Y  A ++  Q
Sbjct: 453 DPNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQQRFQ 512

Query: 222 SLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSN 281
             N  +T PEQ+ +  A  D    A                   M +P +    Q+  +N
Sbjct: 513 PSNANET-PEQTYER-AMKDPEVAA------------------IMQDPVMQSILQQAQTN 552

Query: 282 PGAMQNIQKMMQDPNIKQMAEGFTSGG 308
           P A+   Q+ M++P I +  +   + G
Sbjct: 553 PAAL---QEHMKNPEIFKKIQTLIAAG 576

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 113/228 (49%), Gaps = 43/228 (18%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           LK +GN A A+KD+  AI  +TEAI    T N + Y+NR+A ++SLK + EA+ DA+  +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSL 223
            I+P + +GY+R+G A    G  ++A   YKK L+++ +N         ++A + +EQ  
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLEQVH 117

Query: 224 NLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPG 283
            +     ++SR +  +   ++                      ++P L+   +K+  NP 
Sbjct: 118 RV-----QESRKSRPDFGMTE--------------------MFSDPNLI---EKLRQNP- 148

Query: 284 AMQNIQKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
                + MM DP++    + + S     + SDLM +P L ++   L G
Sbjct: 149 ---KTKDMMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA++D E AI  
Sbjct: 394 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEK 453

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 454 DPNFVRAYLRKATAQIA 470

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 62/129 (48%), Gaps = 10/129 (7%)

Query: 108 QGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVEDAE 160
           +GNK   +  ++ AI +Y +A   L  +  Y  NR+AA        +++   +EAVE   
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAKKK 218
              +      + ++R+G A   Q   ++A+E Y+K L      D  T+    + E  K++
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 219 VEQSLNLEK 227
           +E+ +N EK
Sbjct: 381 IEEYINPEK 389

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 69/100 (69%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K QGN A   KDY  AI+ +T+AI+V  T N + Y+NR+A ++S K ++EA++DAE  +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I P++ +GY+R+G A++   + +EA ++YK+ L+++  N
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +     D+  A+  YTE +K  P +A  ++NRAAA + L  + EA+ED   A+SI
Sbjct: 384 RLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSI 443

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 444 DPNFVRAYIRKATAQIA 460

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GNK    + +E AI  Y +A + L  +  Y  NR+AA        +++K  ++AVE 
Sbjct: 250 KAEGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQ 308

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +   T  + ++R+G A Y      +A+E Y + L
Sbjct: 309 GRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 113/227 (49%), Gaps = 43/227 (18%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDY+ AI+ +++AI V    N + Y+NR+A ++SLK +  A++DAE  + 
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P++ +GY+R+G A +  G  +EA   YKK L+++  N         ++A++ +EQ   
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN---------KAAQEGLEQ--- 116

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           + +T  ++SR    +   +Q                      N+P L++  +K   NP  
Sbjct: 117 VHRT--QESRRGMPDMGLTQ--------------------MFNDPNLIENLKK---NPKT 151

Query: 285 MQNIQKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
            +    MM+DP +      + S   A +  DL  +P L ++   L G
Sbjct: 152 AE----MMKDPQLVAKLIQYRSNPQAIS-QDLFTDPRLMTIMATLMG 193

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G       D+  A+  YTE IK  P +A  Y+NRAA  S L  + EA++D   AI  
Sbjct: 401 RLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEK 460

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALE 191
           DP + R Y R   A+ A  +   ALE
Sbjct: 461 DPNFVRAYIRKATAQIAVREFSSALE 486

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAA-------HSSLKGYDEAVEDAES 161
           GNK    + ++ A+ KY EA +    +  Y  NR+AA        +S+K  +EAVE    
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 162 AISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
             +      + ++R+G         ++A++ YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 63/100 (63%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K QGN A   KDYE A   +T+AI+     N + Y+NR+A  +SLK ++EA+ DA   +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I+P + +GY+R+G A +  GK +EA + YKK L+I+  N
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +     D+  A+  YTE  K  P +A  Y+NRAAA + L  + EA++D + AIS 
Sbjct: 405 RLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISK 464

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 465 DPNFIRAYIRKATAQIA 481

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K +GN A   KDY+ AI+ +T+AI+V  T N + Y+NR+AA++S K Y++A+ DA+  I 
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           I+P++ +GY+R G A     K EEA + Y + L I+ +NA
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  + +A+ D   AI  
Sbjct: 389 RLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEK 448

Query: 166 DPTYFRGYSR 175
           DP++ R Y R
Sbjct: 449 DPSFIRAYLR 458

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GNKA   + ++ AI+ Y +A +    +  Y  NR+AA        + +K   EAVE+
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVEN 313

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKK 218
           A    +      + ++R+G A       ++A+E Y+K L       TE    D  S  +K
Sbjct: 314 ARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL-------TEHRTPDILSKLRK 366

Query: 219 VEQSL 223
            E+ L
Sbjct: 367 AEKDL 371

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 113/229 (49%), Gaps = 47/229 (20%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A A K Y+ A++ +T+AI+V  T N + Y+NR+A+++S + ++EA++DA     
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P++ +GY+R G A +  G  ++A  +YKK L+++ +N           AK+ +EQ   
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKI---------AKEGIEQIQR 119

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           +     +  R A  +   ++                      N+P L+   +K+ +NP  
Sbjct: 120 V-----QSQRQAQPDLGLTE--------------------MFNDPNLI---EKLKNNPKT 151

Query: 285 MQNIQKMMQDPNIKQMAEGFTSGGGAPN--LSDLMNNPALRSMAGNLFG 331
            +    +M DP   Q+     S    PN    DL ++P L ++ G L G
Sbjct: 152 AE----LMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA S L  + +A+ D   AI  
Sbjct: 389 RLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEK 448

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 449 DPNFVRAYIRKATAQIA 465

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS- 164
           K++GNKA   ++++ AI  Y +A + L  N  Y  NR+AA      YD A+     AI  
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEK 313

Query: 165 ---IDPTY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++R+G A    G  +EA+  Y+K L
Sbjct: 314 GREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K +GN+A A+KDY  AI  +T+AI+V    N + ++NR+A ++S K + +A++DA   +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            I+P++ +GY+RLG A Y  G  +EA ++YKK L+++  N
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +     D+  A+  YTE IK  P +A  Y+NRAAA S L  + +A+ D + AI  
Sbjct: 393 RLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEK 452

Query: 166 DPTYFRGYSR 175
           DP + R Y R
Sbjct: 453 DPNFVRAYIR 462

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI-- 163
           K +GNK    + ++ AI KY EA +    +  Y  NRAAA      Y+ A+E    A+  
Sbjct: 259 KAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQ 317

Query: 164 --SIDPTY---FRGYSRLGFAKYAQGKPEEALEAYKKVL 197
              +   Y    + ++R+G + +  G  ++A++ Y+K L
Sbjct: 318 GRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 110/229 (48%), Gaps = 47/229 (20%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K +GN A A KD+E AI  + +AI+V    N + Y+NR+A ++S++ + EA+ DA+  + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN--ATEAMKRDYESAKKKVEQS 222
           I P + +G++RLG A Y  G  +EA E+YKK L+++  N  A + + +   + ++++EQ 
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQP 127

Query: 223 LNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNP 282
                             D   G                      +P L+   QK+ +NP
Sbjct: 128 ------------------DLGFG------------------QMFQDPNLI---QKLKNNP 148

Query: 283 GAMQNIQKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331
              +    MM+DP +      F S   A + ++LM +P L ++   + G
Sbjct: 149 KTAE----MMKDPQLVAKVLQFQSNPQAIS-TELMRDPRLMTVMAAILG 192

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++QG +   N D+  A+  YTE IK  P +A  Y+NRAAA + L  + +A++D + AI  
Sbjct: 392 RLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQK 451

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 452 DPNFVRAYIRKATAQIA 468

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAH-------SSLKGYDEAVED 158
           K +GN+    + ++ AI  Y +A   L  +  Y  NRAAA        S++K  ++AVE+
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEE 316

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +      + ++RLG A Y     ++A+E Y+K L
Sbjct: 317 GRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 112/235 (47%), Gaps = 59/235 (25%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   K+Y+ AI  +T+AI+V  T + + ++NR+A ++SLK + +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLN 224
           I+P++ +GY+RLG A    G  +EA   YKK L+++ +N         ++AK  +EQ   
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN---------KAAKDGLEQ--- 116

Query: 225 LEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPGA 284
           + +T  +Q+R A  +   +Q                                 + ++P  
Sbjct: 117 VHRT--QQARQAQPDLGLTQ---------------------------------LFADPNL 141

Query: 285 MQNIQK------MMQDPNIKQMAEGFTSGGGAPNL--SDLMNNPALRSMAGNLFG 331
           ++N++K      MM+DP   Q+     S    P     DL ++P L ++   L G
Sbjct: 142 IENLKKNPKTSEMMKDP---QLVAKLISYKMNPQAIGQDLFSDPRLMTIMATLMG 193

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 4/94 (4%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA+ D   AI  
Sbjct: 400 RLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 459

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           DP + R Y R+  A+ A  +   ALE     LD+
Sbjct: 460 DPNFVRAYIRMAAAQIAVKEFAAALE----TLDV 489

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 8/136 (5%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYD-------EAVED 158
           K +GNK      ++ AI  Y  A + L  +  Y  NRAAA      Y+       +AVE 
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEK 324

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKK 218
                +      + ++R+G A +  G  ++ +E Y+K L         A  R+ E  +KK
Sbjct: 325 GRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILAKLRNVEKEQKK 384

Query: 219 VEQSLNLEKTVPEQSR 234
            E    +     E++R
Sbjct: 385 AEAEAYINPDKAEEAR 400

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDY  AI+ +T+AI+V    N + Y+NR+A ++SLK + +A+ DA   + 
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P++ +GY+RLG A    G  ++A   YKK L+++  N
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +     D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA+ D   AI  
Sbjct: 397 RLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEK 456

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP + R Y R   A+ A
Sbjct: 457 DPNFVRAYIRKATAQIA 473

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTN-AIYYANRAAAHSSLKGYDEAVEDAESAI 163
           LK  GNK    K YE A++ +T A+    TN  I Y+NRAAAH  LK Y EA+ED ++ +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 164 SIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            + P + +GYSR+G A     K +EA E +KK L +   N 
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +   N++Y  A+  YTE IK  PT+ + + NRAA    L    + ++D + AIS+
Sbjct: 433 RIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISV 492

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAY 193
           DP+Y + Y R GFA+  +   +EALE +
Sbjct: 493 DPSYIKAYVRKGFAQITERDLDEALETW 520

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIK-VLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K +GN A   KD++ A+  +T AI+     N + Y+NR+ A++SLK +DEA+ DA   + 
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I   + +G++RLG A +  G  +EA E+YKK L+++  N
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           ++ G +     D+  A+  Y+E I   P +A  Y+NRAAA S L  + +A++D + AI I
Sbjct: 396 RLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEI 455

Query: 166 DPTYFRGYSRLGFAKYA 182
           DP++ R Y R   A+ A
Sbjct: 456 DPSFVRAYIRKATAQIA 472

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAA-------HSSLKGYDEAVED 158
           K +GN+    + ++ AI KY EA   L  +  Y  NRAAA       +S++K  +EAVE 
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQ 320

Query: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197
                +      + ++RLG A Y   + ++A+E Y+K L
Sbjct: 321 GRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPT-NAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           K QGN A   KDYE A   + +AI V    N + Y+NR+A ++SLK + E ++DAE  + 
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           I+P + +GY+R+G A++     E+A ++Y+K L+++  N
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 23/205 (11%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           +++G +  +  D+  A+  YTE IK  P +A  Y+NRAAA + L  + EA+ D + AI  
Sbjct: 386 RLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEK 445

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL--DIEGDNATEAMKRDYESAKKKVEQSL 223
           DP + R Y R   A+ A  +   A+E    V   D E +N   A + D      ++    
Sbjct: 446 DPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREID------QLYIKA 499

Query: 224 NLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXXXXXXXXMNNPQLMQAAQKMMSNPG 283
           N ++  PE     D N +  Q                     M +P +    Q+   NP 
Sbjct: 500 NNQRFQPE-----DVNENPEQ-------TYQRAMKDPEVAAIMQDPVMQSILQQAQQNPA 547

Query: 284 AMQNIQKMMQDPNIKQMAEGFTSGG 308
           A+   Q+ MQ+P++ +  +   + G
Sbjct: 548 AL---QEHMQNPDVFRKIQTLIAAG 569

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 75/152 (49%), Gaps = 11/152 (7%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K +GN A+  +DY  AI  YTEAIK+  T +IY++NRA  H  +  +   + D + A+ 
Sbjct: 15  FKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALE 74

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY-------ESAKK 217
           IDP   + Y R G +     + + A +  K VL  + ++AT     D        E  KK
Sbjct: 75  IDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATAKRGLDVCEKFIREERFKK 134

Query: 218 KV----EQSLNLEKTVPEQSRDADANADASQG 245
            +    +Q +NL  T+  ++ D++A+     G
Sbjct: 135 AIGGEEQQKVNLYLTLNLETFDSNADLTNWTG 166

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K QGNK +A+KDY  AI  YT+AI++    +I+++NRA A+  L  +  A+ED+  AI +
Sbjct: 13  KDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIEL 72

Query: 166 DPTYFRGYSRLGFA 179
           D +  +GY R G A
Sbjct: 73  DSSNVKGYHRRGMA 86

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 77/152 (50%), Gaps = 11/152 (7%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN  +  +D+  AI+ YT+AI +  T +IY++NRA AH  L  +  ++ D + A+ 
Sbjct: 15  LKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY-------ESAKK 217
           +DP   + Y R G +     + ++A    + VL  +  +AT +   D        E  +K
Sbjct: 75  LDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEKFIREERFRK 134

Query: 218 KV----EQSLNLEKTVPEQSRDADANADASQG 245
            +    E  +NL +T+  +S DA+A+     G
Sbjct: 135 AIGGGDEIKVNLCETLRLESYDANADLGKYDG 166

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K +GN  + ++DY+ AI  YT+AI++  T++I+Y+NRA AH  L  +  A+ D   AI 
Sbjct: 15  FKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIK 74

Query: 165 IDPTYFRGYSRLGFA 179
           +D    + Y R G A
Sbjct: 75  LDNNNIKAYHRRGLA 89

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GNK +  K Y  A+  YT+AI++  T +I+++NRA A   L  +   ++D  SA+ 
Sbjct: 16  LKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALE 75

Query: 165 IDPTYFRGYSRLGFAK 180
           +DP   + Y R G ++
Sbjct: 76  LDPKNIKAYHRRGLSQ 91

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN  +  +DY  AI KY +AI++  T ++Y++NRA  H  L  +  A +D + A+++
Sbjct: 13  KNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALAL 72

Query: 166 DPTYFRGYSRLGFA 179
           DP   + Y R G A
Sbjct: 73  DPKNVKAYHRRGLA 86

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A+ D + AI +
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPTYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN  +  K +  AI KYTEAI +  T +IY++NRA AH  +  +  A+ D + AI +
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPTYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 18/140 (12%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K +GN+ +   DY+ AI  Y++AI +  T +IY++NRA AH     +  AV D ++A+ 
Sbjct: 15  FKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALK 74

Query: 165 IDPT-----YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE------------- 206
           +DP      + RG S +G  ++ + K +  +    K  DI   NA +             
Sbjct: 75  LDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREERFKN 134

Query: 207 AMKRDYESAKKKVEQSLNLE 226
           A+    ++AK  + Q+LNLE
Sbjct: 135 AIGGSGDNAKSNICQTLNLE 154

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 77/153 (50%), Gaps = 13/153 (8%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K +GN  +  ++Y  AI  Y++AI++ PT +I+++NRA A   L  +   + D + A+ 
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALR 74

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--------EAMKRDYESAK 216
           +DP   + Y R G +     + ++A    + VL  +  +AT        E + R+ E  K
Sbjct: 75  LDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATAKRALAMCEKVIRE-ERFK 133

Query: 217 KKV----EQSLNLEKTVPEQSRDADANADASQG 245
           K +    +  LN  +T+  +S DA+++    +G
Sbjct: 134 KAIGGDDQDKLNFCQTMSLKSFDANSDLAKYEG 166

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN  +  K +  AI KYTEAI +  T  IY++NRA +H  +  +  A+ D + AI +
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 166 DPTYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN  +  K +  AI KYT+AI +  T +IY++NRA AH  +  +  A+ D + A+ +
Sbjct: 16  KNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKL 75

Query: 166 DPTYFRGYSR 175
           DP   + Y R
Sbjct: 76  DPKNIKAYHR 85

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K QGN  +  K++  A   Y++AI++  T +IY++NRA AH  L  +  A+ D   AI 
Sbjct: 15  FKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIE 74

Query: 165 IDPTYFRGYSRLGFA 179
           +DP   + Y R G +
Sbjct: 75  LDPKNVKAYHRRGLS 89

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GNK +  +D++ A   YT+AI+  PT +I+Y+NRA A+  L  +  A+ D  +AI +
Sbjct: 13  KDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIEL 72

Query: 166 DPTYFRGYSRLGFA 179
           + +  + Y R G A
Sbjct: 73  NSSNLKAYHRRGLA 86

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ VED  +A+ 
Sbjct: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165

Query: 165 IDPTYFRGYSR 175
           + P Y + + R
Sbjct: 166 LKPDYSKCWLR 176

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN+ +  KDY  A+  YT AI+   T +I+++NRA A+  L  +  A+ED+  AI +
Sbjct: 42  KNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIEL 101

Query: 166 DPTYFRGYSRLGFAK 180
           D    + Y R G A 
Sbjct: 102 DAGNVKAYHRRGLAH 116

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 30/157 (19%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K QGN  +  K Y  A+  Y++AI++  T +I+++NRA +   L  +  A+ED   +I 
Sbjct: 15  FKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIE 74

Query: 165 IDP-----TYFRGYSRLGFAKYA----------QGKPEE-----ALEAYKKVLDIEGDNA 204
           +DP      + RG S +G  +++          Q KP E     ALE  ++   I  +  
Sbjct: 75  LDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERF--IREERF 132

Query: 205 TEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANAD 241
            +A+  D E +K  V  SL L           D NAD
Sbjct: 133 KKAISGDGEESKVNVCASLQLS--------SFDGNAD 161

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 5/86 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K QGN  +  K Y+ A+  Y++AI++  T +IY++NRA +   L  +  A ED + AI+
Sbjct: 13  FKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIA 72

Query: 165 IDP-----TYFRGYSRLGFAKYAQGK 185
           +DP      + RG S +G  ++ + +
Sbjct: 73  LDPKNIKAIHRRGLSYVGLLEFFKAR 98

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
            K +GN  +  ++Y  AI  YT+AI++ P  +I+Y+NRA A   L  +  A  D   A++
Sbjct: 15  FKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALT 74

Query: 165 IDPTYFRGYSRLGFA 179
           +D    + Y R G A
Sbjct: 75  LDSKNVKAYHRRGLA 89

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K Q N     K +  A   YT+ IKV       N   +ANRAA    LK Y   V D +
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            A+ I+P   + + R+G A  A GK +EA +A    L I+ +N 
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIK----VLPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K +  A   YT+ I+    V   N   YANRAA    LK +   + D +
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----------EAMK 209
           +A++ +P   + Y R+G A  A  K E A E+ +    I+ DN +           E   
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEI 200

Query: 210 RDYESAKKKVEQ 221
           R YE  K K +Q
Sbjct: 201 RKYEEKKLKAQQ 212

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     KD+E AI  YT A+  L  + +YY+N +A +SSL  Y++ +E A  A++
Sbjct: 98  LKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALA 156

Query: 165 IDPTYFR-------GYSRLG 177
           + P Y +        Y +LG
Sbjct: 157 LRPDYSKVLVRRANAYEKLG 176

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 18/116 (15%)

Query: 125 YTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQG 184
           Y +A+K+   NA  Y +R   +   + Y++A ED + A  +DP     Y +L    Y + 
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 185 KPE--EAL--EAYKKVLDIEGDNATE---------AMKRDYESAKKKVEQSLNLEK 227
           K +  E L  EA +K       N++E         A K D+++A K+ E+++ LEK
Sbjct: 423 KFDDCETLFSEARRKF-----PNSSEVPNFYAEILADKGDFDAALKEYERAIELEK 473

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GNK +  K Y  A   YT+AI+  P N I Y+NRA  +  L  +  +++DA+ AI 
Sbjct: 16  LKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIE 75

Query: 165 IDPTYFRGYSR 175
           +D    + Y R
Sbjct: 76  LDNNNLKAYHR 86

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+    K ++ A   YT+ I V       N   +ANRAA    LK Y   +ED  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
            A++I+P   + Y R   A ++  K EEA
Sbjct: 146 KALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK Y+ AI  Y+ AI+V   + ++Y+NR+A + SL   ++ VED  +A+ 
Sbjct: 98  LKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 156

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 157 LKPDYSKCLLR 167

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK +E A+  Y+ AI+V   + ++Y+NR+A + SL   ++ VED  +A+ 
Sbjct: 99  LKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 157

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEAL 190
           + P Y +   R   A  + GK  +A+
Sbjct: 158 LKPDYSKCLLRRASANESLGKFADAM 183

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K +  A + Y + I++       N   +ANRAA    LK Y   + D +
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEA 192
            A++++P   + Y R+G A Y     EEA E+
Sbjct: 143 HALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 11/134 (8%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K +GN+    K Y  A   YT+ I V       N   YANRAA    LK + + +ED +
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT-----EAM-KRDYES 214
            A+S +    + Y R+G A  +  + +E+ E+ +  L I+ +N +     +A+ KR  E 
Sbjct: 137 KALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEI 196

Query: 215 AKKK-VEQSLNLEK 227
            ++K +E  + LEK
Sbjct: 197 QRRKDMEMKIKLEK 210

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K QGN  +  +D+  A   YT+AI++  T +I+++NRA AH     +  ++ D + A+ +
Sbjct: 16  KDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALEL 75

Query: 166 DPTYFRGYSRLGFAKYAQGKPEEALEAYKKVL-----DIEGDNATEAMKR 210
           D    + Y R G +     + ++A    K VL     D+  D A +  ++
Sbjct: 76  DSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+      +E AI  Y  A+K L  + IYY+N +A ++SL  Y++ +E A  A+ 
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171

Query: 165 IDPTYFRGYSRLGFAKYAQG 184
           + PT+ +   R   A  A G
Sbjct: 172 LRPTFSKVLMRRALAYEAMG 191

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     KDYE AIN Y  A++ L  + ++Y+N AA + SL+   EA+E    A+ 
Sbjct: 89  LKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147

Query: 165 IDPTY 169
           ++P Y
Sbjct: 148 LNPDY 152

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+    K ++ A   YT+ + V       N   +ANRAA    LK Y + VED  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
            A++I+P   + Y R+  + +   K EEA
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV-LPTNAI---YYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+    K Y+ A   Y + I++   +N I    ++NRAA    LK Y   V D  
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            A+  +PT  + + R+  A +   K E+A EA +  L ++ ++A
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+    K ++ A   Y++ + V       N   YANRAA    LK Y   +ED  
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
            A++I+P   + Y R   A +   K EEA
Sbjct: 146 KALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   ++ YE AI  Y  A+K L  + ++Y+NR+A +  L   ++ VED  +A+ 
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 157 LKPDYSKCLLR 167

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV-LPTNAI---YYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K +  A   Y++ I V    N I    YANRAA    +K Y   + D +
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN-ATEAMKRDYESAKKKV 219
            A+ ++P   + Y R+  A  A  + +EALE+ +    I+  N + + +K   E+ + ++
Sbjct: 144 QALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEI 203

Query: 220 E-QSLNLE 226
           E + L LE
Sbjct: 204 EARRLKLE 211

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           +K +GN+    K YE AI  Y+ A++ L  + ++Y+NR+A    L   ++ VED  +A+ 
Sbjct: 101 MKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 160 LKPDYSKCLLR 170

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD+E AI  + +A +V P  A  Y  +   HSS   +D A      A++ DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG +    G+ +EAL  ++K   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISID 166
           +QG++  +N  ++ A N Y +A+   P +   Y     +   L  YDEA+   E A SI+
Sbjct: 574 LQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN 633

Query: 167 PTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           P         G A       E+AL  Y+   +++  ++    KR
Sbjct: 634 PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     + Y+ A   Y + ++V       N   + NRAA    LK +   + D +
Sbjct: 83  FKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCK 142

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
            A+  +P   + + R+G A ++  K EEA EA +  L  + +NA
Sbjct: 143 EALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 14/104 (13%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GNK    KDY  AI  Y  A+  L  + I+Y+N +A + SL   D+ +E +  A+ 
Sbjct: 125 LKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           ++P Y +   R       +    E+LE Y        VL + GD
Sbjct: 184 LNPNYSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%)

Query: 139 YANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           Y N +A +  L+  D+A E +   I I+P   +GY R+G     QGK  EA + YKK
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKK 130

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K +  A   Y +AI V       N   YANRAA    LK Y   + D +
Sbjct: 77  FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCK 136

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
            A+S++P   + Y R+  A  A  K ++  EA +  L  + +N +
Sbjct: 137 MALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    KDYE A+  Y  A+ +L  + ++Y+N +A + SL   D+ +E +  A+ 
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 170 LKPDYSKALLR 180

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN +  N  Y  AI+ Y   I + P+N I Y+N+A A      +DEA+   E  + 
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 165 I 165
           +
Sbjct: 66  L 66

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           LK++GN    N DYE AI  Y +A  +  +N IY++N A A   L+ + EAV   +  +
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 14/104 (13%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    KDY+ A+  Y  A+ V+  + ++Y+N +A + SL   D+ VE++  A+ 
Sbjct: 104 LKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALE 162

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYK------KVLDIEGD 202
           + P Y +   R       +    E+LE Y        VL + GD
Sbjct: 163 LKPDYSKALLR-------RASANESLENYADAMFDLSVLSLNGD 199

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN    NKD++ AI  + +AI++ P  A  Y  +   +S+   +D A      A++I+ T
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKK 195
           ++     LG      GK EEAL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%)

Query: 135 NAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYK 194
           N I + +    HS  K +DEA+     AI +DP +   Y+  G         + A   ++
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFR 550

Query: 195 KVLDIE 200
           K L IE
Sbjct: 551 KALTIE 556

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+    K ++ A   Y + + V       N   +AN+AA    LK Y   +ED  
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
            A+SI+P   + Y R   A +   K EEA
Sbjct: 146 KALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN+A   K Y  A   Y   I+V       N + + N+AA    +K Y   + D +
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT--EAMKRDYESAKKK 218
            A+S +P   + Y R+  A  A  K +E+ E+ +  L ++  N++    +K   +  ++K
Sbjct: 137 KALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQEEK 196

Query: 219 VEQSLNLEK 227
               L LE+
Sbjct: 197 TAYRLKLER 205

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 18/58 (31%)

Query: 268 NPQLMQAAQ-KMMSNPGAMQNIQ-----------------KMMQDPNIKQMAEGFTSG 307
           +PQ+MQ AQ ++  NPG MQN+Q                 KMMQDPN+++MA+ F  G
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFGGAGGGMPDMNEMMKMMQDPNMQKMAQQFGMG 584

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S    ++ VE    A+ 
Sbjct: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 188 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 73/138 (52%), Gaps = 9/138 (6%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     K +E AI  Y  AIK L  + ++++N +A + SL   D+ VE +  A+ 
Sbjct: 96  LKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALE 154

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD---NATEAM-KRDY-ESAKKKV 219
           + P Y +   R   A    G+ ++A+     VL + GD   ++ E M +R+  + A + +
Sbjct: 155 LKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNLNKQALRVL 213

Query: 220 EQSLNLEKTVP--EQSRD 235
           ++ + ++ +VP  EQ R+
Sbjct: 214 KEDMGIDASVPQAEQPRE 231

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD+E AI  + +A K+ P  A  Y  +    SS   +D A +    AI+ DP 
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPR 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  +G      G  +EAL  ++K   I   NA 
Sbjct: 618 HYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAV 654

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K ++ A   Y + I++       N   YANRAA    +K Y   + D +
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           +A+  +P   + Y R+G A  A    EEA ++ +  L ++  N
Sbjct: 141 TALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSN 183

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           GN+     +Y+LAI +Y + I + PTNA+ Y+N A A+   +  DEA    E  +S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLS 97

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
           YD A+E     IS++PT   GYS L  A      P+EA
Sbjct: 51  YDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   +KD E AI  Y  A++ L  + ++Y+N +A + ++   D+ +E +  A+ 
Sbjct: 161 LKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALE 219

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A  A G  +EAL  +  +L + G+
Sbjct: 220 LKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    KDY+ A+  Y  A+  L  + ++Y+N +A + S+   D+ VE++  A+ 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALE 167

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 168 LKPDYSKALLR 178

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 13/130 (10%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKV----LPTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K ++ A   Y +A+ V    L  N   Y N AA    +K Y   +    
Sbjct: 73  FKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCR 132

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN---------ATEAMKRD 211
            A+ ++    + + R+G A    G+ E++LEA +  L ++ +N         ATE +KR 
Sbjct: 133 EALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRK 192

Query: 212 YESAKKKVEQ 221
            E   + + Q
Sbjct: 193 KELENRTLAQ 202

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 2/98 (2%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDE-AVEDAESAISIDP 167
           G  AM    YE A+  + +A  + P N +       +   L GY E A++  E A  + P
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKL-GYKEKALQYYELACHLQP 673

Query: 168 TYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           T      ++G   Y+  +   AL+ +++++ +  D+AT
Sbjct: 674 TSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 711

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A      A++ DP 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     +D++ AI  + +A +V P  A  Y  +   HSS    D A      AI+ DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ EEAL  ++K   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNA----IYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K +  A   Y + I+V   +A    +   NRAA    LK Y   + D  
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            A+ ++P   + + R+G A     K EEA EA    L ++ +N
Sbjct: 140 EALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    GK  +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     K +  AI  Y  AI++ P + ++Y+N +A + S    D+ VE    A+ 
Sbjct: 134 LKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALE 193

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 194 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           +K QGN A  N ++  A   Y + I + P N I Y+NRA A   L+ + E ++  +  +
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%)

Query: 133 PTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEA 192
           P   +   NRAA    L   D A+ DA   I++D    +GY R G      G+ EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 193 YKKVLDIEGD 202
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K +GN+      Y++A   Y + + + P N I Y+N+A A   L  Y E VE     ++ 
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 166 DP-TYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
            P T    Y +L +      + E AL+  K V D E  N
Sbjct: 67  TPNTTDTVYKKLNY------RLEMALKNMKHVNDQEQSN 99

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K QGN     K Y+ A   Y++ I+V       N   Y NRAA    L+ +   + D +
Sbjct: 82  FKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCK 141

Query: 161 SAISIDPTYFRGYSRLGFAKYAQGKPEEA 189
            A++ +    + + R+G A +   K EEA
Sbjct: 142 KALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     K++  AI  + +A +V P  A  Y  +   ++S   +D A      AI+ DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG      G+ EEAL  ++K   I   N  
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVE 157
           LK +GN      DYE A+  Y +AI   P+N I Y+N A     L+ + EAV+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVD 59

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A K+ P     Y  +   + S+  YD A      AIS D  
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  +G      G+ E+AL  ++K   I   NA
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           G  +M   +YE A+  + +A  + P+NAI           L   ++A+   E A  I PT
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
                 +     Y+  K  +AL+A+++++ I  + AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGF 178
           E A+N Y  A ++ PT+++    RA    S+  Y +A++  E  I I P        LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 179 AKYAQGKPEEALEAYKKV--LDIEGDN-ATEAMKRDYE 213
                G+ ++A++ Y     LD +G N  ++A+K+ +E
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 53/125 (42%), Gaps = 19/125 (15%)

Query: 133 PTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLG--FAKYAQGKPEEAL 190
           P   I   NRAA+   +    +A+ DA+  I +D    +GY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 191 EAYKKVLDIEGDNATEAMKRDY-----------ESAKKKVEQSLNLEKTVPEQSRDADAN 239
             Y++ L      A EA +  +           E  K +V + LNL+K  P        +
Sbjct: 125 YVYREGL----SKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTPTTGASKRTH 180

Query: 240 ADASQ 244
            +A Q
Sbjct: 181 IEAIQ 185

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPTY 169
           I P Y
Sbjct: 161 IKPDY 165

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182
           N + +A+K+ P N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S    ++ +E    A+ 
Sbjct: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 187 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 134 TNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAY 193
           T A+   N+     + K + EA++  + AI +DP     YS +     + G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 194 KKVLDIEGDNATEAMKR 210
            K L+I+ D++   ++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 21/63 (33%)

Query: 268 NPQLMQAAQ-KMMSNPGAMQNIQ--------------------KMMQDPNIKQMAEGFTS 306
           +PQ+MQ AQ ++  NPG M+N+                     KMMQDP ++QMA+ F +
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPNMNDMMKMMQDPKMQQMAQQFGA 533

Query: 307 GGG 309
           G G
Sbjct: 534 GMG 536

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     K++  AI  Y  AI++ P   ++Y+N +A + S    ++ +E    A+ 
Sbjct: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           I P + +   R   A  + G   +A+     VL + GD
Sbjct: 190 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 136 AIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKK 195
           A+   NR     + K ++EA++  + AI +DP     YS +     + G  E+ +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 196 VLDIEGDNATEAMKR 210
            L+I+ D++   ++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPTY 169
           + P Y
Sbjct: 161 LKPDY 165

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 161 LKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182
           N + +A+K+   N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 384 NYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443

Query: 183 QGK 185
           + K
Sbjct: 444 ENK 446

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    K ++ AI  Y  A++ L  + ++Y+NR+A + S+   ++ VED  +A+ 
Sbjct: 105 LKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALK 163

Query: 165 IDPTYFRGYSR 175
           +   Y +   R
Sbjct: 164 LKSDYSKCLLR 174

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 268 NPQLMQAAQ-KMMSNPGAMQNIQKMMQDPNIKQMAEGFTSGGGAPNLSD---LMNNPALR 323
           +PQ+MQ AQ ++  NPG M+N   MM          G  S GG PN++D   +M +P ++
Sbjct: 472 SPQMMQQAQQRLRQNPGMMEN---MMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQ 528

Query: 324 SMA 326
            MA
Sbjct: 529 EMA 531

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL  +++ +E+   A+ 
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167

Query: 165 IDPTY 169
           + P Y
Sbjct: 168 LKPDY 172

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN       +E AI  Y  AI+ L  N I+Y+N +A + SL   +E ++    A+ 
Sbjct: 114 LKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 165 IDPTY 169
           + P Y
Sbjct: 173 LKPDY 177

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     +D+E AI  + +A K+    A  Y  +   HSS    D A      A++ DP 
Sbjct: 489 GNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQ 548

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      G+ ++AL  ++K  +I   N 
Sbjct: 549 HYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV 584

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISID 166
           +QG++  +N   + A N Y  A+   P +   Y      +  L  YD+A+   E A +I+
Sbjct: 521 LQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNIN 580

Query: 167 PTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           P         G A       E+AL+ Y++  +++  ++    K+
Sbjct: 581 PVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKK 624

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL   ++ VE +  A+ 
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 165 IDPTYFRGYSR 175
           + P Y +   R
Sbjct: 161 LKPDYSKALLR 171

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A ++ P  A  Y  +   HSS    D A      A++ D  
Sbjct: 558 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQ 617

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNAT 205
           ++  Y  LG +    G+ EEAL  ++K   I   N  
Sbjct: 618 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 33/203 (16%)

Query: 50  AVPSILENSEFKGQNLTDLLNSTSRVS------ESTKKDDAQNVEVNIPXXXXXX---XX 100
           A+P  L  SEF+ ++  D++   +R+       + T  +  QNVE+              
Sbjct: 19  ALPPQL--SEFQNKSTDDVMEELNRMPFFMSKLDGTDGEGGQNVELEALKALAYEGEPHE 76

Query: 101 XXXXLKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAV 156
                K QGN     K Y+ A   Y   I +       N   ++NRAA    LK Y   V
Sbjct: 77  VAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCV 136

Query: 157 EDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAK 216
            D + A+  +    + Y R+  A     K E+A +A +  L ++ +N             
Sbjct: 137 NDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPEN------------- 183

Query: 217 KKVEQSLN-LEKTVPEQSRDADA 238
               Q+LN L + V ++ +DADA
Sbjct: 184 ----QALNALRQNVDKKKQDADA 202

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K++GN A    ++  A+N Y +AI   PTN + Y+N A A   L  Y +A +  +  +
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 34.7 bits (78), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           LK +GN      DY  A   Y + IK+ PTN I Y+N+A +      +  AVE  +  +
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGL 64

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           +N DY+  ++ +  A+ V P + + +    A+ ++    +EA++    A+ + PT+ R  
Sbjct: 438 SNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 497

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG         +N  E +KR +   +++
Sbjct: 498 CNLAVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERR 554

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      A++I+P 
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLK--GYDEAVEDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K   YDEA+   E A S
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 534

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 535 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 24/64 (37%)

Query: 268 NPQLMQAAQ-KMMSNPGAMQN-----------------------IQKMMQDPNIKQMAEG 303
           +PQ+MQ AQ K+  NPG MQN                       + KMMQDP +++MA+ 
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 304 FTSG 307
           F  G
Sbjct: 536 FGMG 539

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 139 YANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYK 194
           Y N +A +  L+  D+A + ++  I++DP   +GY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK QGN     +DY  A+  Y + ++   TN I ++NRA     L    EA +  ++ ++
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 165 I 165
           +
Sbjct: 67  L 67

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           AN+D++  I+ +  A+ V P +   +    A+ ++    +EA++    AI + PT+ R  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG------------DNATEAMKRDYESAKKK 218
             L  +    G   EA E     L   ++EG             N  E +KR + +  ++
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAFIAMDRR 548

Query: 219 VEQSLNLEKTVP 230
                 LE+ VP
Sbjct: 549 DL----LERVVP 556

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISI 165
           K QGN       Y  A++ Y + I   P N + Y+N+A A   L  Y +A++  +  +  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 166 DPT 168
             T
Sbjct: 68  TST 70

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           AN +++  I+ +  A+KV P + + +    A+ ++    +EA++    A+ + P++ R  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEGD 202
             L  +    G  +EA E     L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN    N+D++ AI    +A  + P  A  Y  +   +S+   +D A      A++I+P 
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  +  LG +    G+ +EAL  ++K   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLK--GYDEAVEDAESAIS 164
           +QG++   N  ++ A   Y +A+ + P +  Y A+     S +K   YDEA+   E A S
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARS 553

Query: 165 IDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210
           I+P         G A    G+ E+AL+ Y+   +++ +++    K+
Sbjct: 554 INPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K +G++   N DY  A+ +Y +++  LP       I Y+N  A    +  Y +++ED +
Sbjct: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476

Query: 161 SAISIDP 167
            A+S+ P
Sbjct: 477 IALSLFP 483

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 33/55 (60%)

Query: 146 HSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           H S   +D+ +E  ++A+ I+P     ++RLG +     + EEA++AY K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 41/87 (47%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           +N D++  +  +  A+K+ P + + +    A+ ++    +EA++    AI++ P++ R  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 174 SRLGFAKYAQGKPEEALEAYKKVLDIE 200
             L  A    G  +EA      VL + 
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMH 539

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           K  GN    + +Y  A+  Y + I+V P N I Y+N A +   L  Y EA+E   + +
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 1/97 (1%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           G   M   DY  A   + +A+     N I++ +    +  +  Y +A++    AI ++P 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 169 YFRGYSRLG-FAKYAQGKPEEALEAYKKVLDIEGDNA 204
               +  LG   +    +  +AL+AYK+   +E DN 
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDNT 389

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 60/135 (44%), Gaps = 17/135 (12%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           G    AN+++   I+ +  A++V P + + +    A+ ++    +EA++    A+++ P+
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLD-------------IEGDNATEAMKRDYESA 215
           + R    L  +    G  +EA E+    L              ++ +N  E +KR + + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAM 542

Query: 216 KKKVEQSLNLEKTVP 230
            ++      LEK +P
Sbjct: 543 DRRDL----LEKVMP 553

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ ++  ++A+ I P     ++RLG +     +PEEA++AY K L ++
Sbjct: 447 FDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLK 495

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 12/117 (10%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           +N DY+  ++ +  A+ V P + + +    A+ ++    +EA++    A+ + PT+ R  
Sbjct: 431 SNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRAR 490

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG          N  E +KR +   +++
Sbjct: 491 CNLAVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRAFIGMERR 547

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           LK +GN     +D+E A+  Y  A+  L  + ++Y+N +A + SL   ++ VE +  A+ 
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALK 166

Query: 165 IDPTYFRGYSR 175
           +   Y +   R
Sbjct: 167 LKHDYSKALLR 177

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%)

Query: 139 YANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
           Y     AH   +   E++E  +SA+ ++P     +  LG A Y+ G+ E +++ ++K L+
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 199 IEGDNA 204
           +   NA
Sbjct: 744 VSPGNA 749

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 26/67 (38%)

Query: 268 NPQLMQAAQKMMS-NPGAMQNIQ-------------------------KMMQDPNIKQMA 301
            PQLMQ AQ+ +S NP  M+N+                          KMMQDP +++MA
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMA 531

Query: 302 EGFTSGG 308
           + F  GG
Sbjct: 532 KQFGMGG 538

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           AN+DY+  I+ +  A+ V P + + +    A+ ++    +EA++    A+ + P++ R  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 174 SRLGFAKYAQGKPEEALEAYKKVL---DIEG-----------DNATEAMKRDYESAKKK 218
             L  +    G  +EA E     L   ++EG            N  E +KR + + +++
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 26/65 (40%)

Query: 269 PQLMQAAQ-KMMSNPGAMQN-------------------------IQKMMQDPNIKQMAE 302
           PQLMQ AQ K+  NPG M+N                         + KMMQDP ++ MA 
Sbjct: 467 PQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQDPQMQDMAR 526

Query: 303 GFTSG 307
            F  G
Sbjct: 527 QFGMG 531

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 31/49 (63%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ +E  + ++ I+P     ++RLG +     KPE+A++AY + L+++
Sbjct: 447 FDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI-- 163
           K +GN+     DY  A   Y   I   PTN I Y+N+A +    + +D+A+    + +  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 164 SIDPTY 169
           S DP +
Sbjct: 67  SSDPEH 72

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ ++  ESA+ ++P     ++RLG +     + EEA++AY + L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 36/73 (49%)

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176
           D++  I+ +  A+KV P + + +    A+ ++    +EA++    A+ + P++ R    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 177 GFAKYAQGKPEEA 189
             +    G  +EA
Sbjct: 533 AVSSMNIGCFKEA 545

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 141 NRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAY 193
           NRAA+   L   D+A++DA++ I ++P   + Y R G       K +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ ++  ESA+ ++P     ++RLG +     + EEA++AY + L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 39/84 (46%)

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176
           D++  I+ +  A+KV P + + +    A+ ++    +EA++    A+ + P++ R    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 177 GFAKYAQGKPEEALEAYKKVLDIE 200
             +    G  +EA      VL + 
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMH 555

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164
           L+ +GN   +  +YE A+  Y  A    P+N ++ AN + A   L+ +++A+   + A+ 
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 165 I 165
           I
Sbjct: 71  I 71

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ ++  ESA+ ++P     ++RLG +     + EEA++AY + L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
            K +GN+     +Y  AI  Y + I++ P N I Y+N+A A        EAV   +  +
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           +D+ ++  ESA+ ++P     ++RLG +     + EEA++AY + L ++
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD+  AI  + +A  +    A  Y  +   H++ + YD A      AI+ DP 
Sbjct: 528 GNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQ 587

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++  Y  LG      GK ++AL  ++K   I   NA
Sbjct: 588 HYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA 623

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN    NKD++ AI  + +A ++ P     Y  +   +SS   +D A      A++ +  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNA 204
           ++     LG      G+ EE+L  ++K   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 155 AVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 203
           ++E  +SAI +DP     +  LG A  A G+ E +++ ++K ++++G +
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSH 736

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score = 32.3 bits (72), Expect = 2.3,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 161  SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVE 220
            + I  DPT F G  R     Y +   EE   A K+V  +  +    +      ++ K V 
Sbjct: 1450 TIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVN 1509

Query: 221  QSLNLEKTVPEQSRDADANADASQG 245
            + LNLE  +      A+  ++ SQG
Sbjct: 1510 KFLNLESEI------AEGGSNFSQG 1528

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 10/93 (10%)

Query: 118 YELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLG 177
           YE  +  + +A  + P N I       A   L   + A+++ + A  + P      S L 
Sbjct: 494 YEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM-----SSLA 548

Query: 178 FAKYAQ-----GKPEEALEAYKKVLDIEGDNAT 205
             K AQ     GK   ALE+++K++ I  D AT
Sbjct: 549 LFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 116 KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSR 175
           ++YELA+  Y  A K+ P +A+    +A    SL  Y  AVE  E  I +D      +  
Sbjct: 610 RNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHYM 669

Query: 176 LGFAKYAQGKPEEALEAYKKVLDIE 200
           LG      G+ ++A++ Y   ++++
Sbjct: 670 LGKIYQTMGRKKDAVKEYTVAMNLD 694

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           GN     KD++ AI  + +A ++ P  A  Y  +   ++S + +D A      A++ D  
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 169 YFRGYSRLGFAKYAQGKPEEALEAYKK 195
           ++  Y  LG      G  + +L  ++K
Sbjct: 561 HYNAYYGLGTCDSQNGNHDRSLLFFEK 587

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 20/113 (17%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVL----PTNAIYYANRAAAHSSLKGYDEAVEDAE 160
            K +G     N DY  A+ +Y +++  L    P   I Y+N  A+   +  + ++V DA+
Sbjct: 365 FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQ 424

Query: 161 SAISIDPTY-------------FRGYSRLGFAK--YAQGKPEEALEAYKKVLD 198
            A+ + P                R Y+ + + K    Q +  EA+E YK  LD
Sbjct: 425 EAMKLLPEEKSLWTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score = 32.0 bits (71), Expect = 3.3,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 161  SAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKK---VLDIEGDNATEAMKRDYESAKK 217
            + I  DPT F G  +     Y + K EE  EA ++   V + E  + TE    +   + K
Sbjct: 1455 TIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSK 1514

Query: 218  KVEQSLNLEKTVPE 231
             + + L+LE  + E
Sbjct: 1515 NINRFLDLESEIAE 1528

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 61/145 (42%), Gaps = 7/145 (4%)

Query: 59  EFKGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPXXXXXXXXXXXXLKMQG--NKAMANK 116
           E KG  ++   N    +S    ++  +NV ++IP            L +    N  +   
Sbjct: 351 ELKGVTIS---NWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLALFNYLLGRS 407

Query: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176
           D   AI  + + ++  P + I + +  A  ++ K YD A++   + I + P++ R    L
Sbjct: 408 DN--AIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNL 465

Query: 177 GFAKYAQGKPEEALEAYKKVLDIEG 201
           G      G+ +  +E+    L ++G
Sbjct: 466 GSTLVKNGELQRGIESLLTALVMQG 490

>KNAG0B02460 Chr2 complement(480056..481252) [1197 bp, 398 aa] {ON}
           Anc_7.373 YBL055C
          Length = 398

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 135 NAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYK 194
           NAI+Y         +  + +++ED  S + + P  + G +   F      +  E ++  +
Sbjct: 247 NAIFYKFNPDRKFVVHSFTDSLEDLSSLLQLSPNCYIGMNGASF------RSSENIDCVR 300

Query: 195 KV----LDIEGDNATEAMKRDYESAK 216
           +V    L +E D+    MKR +ESAK
Sbjct: 301 EVPLDRLLLETDSPWCEMKRTHESAK 326

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           G  A+     E+A   +T    + PT+A+ ++N +AA+       EA    + AIS D  
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 169 Y-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATE 206
             +R +           + E+ L A K++++I+ D + E
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 25/55 (45%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           GN       Y  A++ Y + I   P N + Y+N+A A   L  Y  A++  +  +
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGL 69

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 53/141 (37%), Gaps = 22/141 (15%)

Query: 141 NRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           NRAA    +    +A++DA  A   +P   + Y R G          +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 201 GDNATEAMKRDYE-SAKKKVEQSLNLEKTVPEQSRDADANADASQGAXXXXXXXXXXXXX 259
           G  A   M R Y     KK+ ++L  +K +  +       + AS+               
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQKNLVSRRLKGPKTSVASKSERKRTLL------- 183

Query: 260 XXXXXXMNNPQLMQAAQKMMS 280
                    PQ+MQ  +K M+
Sbjct: 184 ---------PQVMQPTEKKMA 195

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 30/49 (61%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIE 200
           YD+ ++  ++A++++P     ++RLG +     + EEA+ AY + L ++
Sbjct: 509 YDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLK 557

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 30/48 (62%)

Query: 152 YDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDI 199
           +D+ ++  ++A+S++P     ++RLG +     + EEA++AY K L +
Sbjct: 412 FDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKGYDEAVEDAE 160
            +  G +     DY+ A+++Y +++  LP       I Y+N  AA   +  Y ++V+D +
Sbjct: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608

Query: 161 SAISIDP 167
            A+ + P
Sbjct: 609 VALELFP 615

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 22/116 (18%)

Query: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPT------------------NAIYYANRAAAH 146
           +K  G+     KDY+ +  KY +A+K + T                      Y N   A 
Sbjct: 237 IKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLAL 296

Query: 147 SSLKGYDEAVEDAESAISIDPT----YFRGYSRLGFAKYAQGKPEEALEAYKKVLD 198
            +LK YDE+++     + +D        + Y R+G + +A+ + +EAL+ Y+   D
Sbjct: 297 FNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRD 352

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 39/76 (51%)

Query: 114 ANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGY 173
           +N +++  I+ +  A+KV P + + +    A+ ++    +EA++    A+++ P++ R  
Sbjct: 462 SNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRAR 521

Query: 174 SRLGFAKYAQGKPEEA 189
             L  +    G  +EA
Sbjct: 522 YNLAVSSINIGCYKEA 537

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 106 KMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAI 163
           K QGN       Y  A++ Y   I   P N + Y+N+A A   L  + +A++  +  +
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL 69

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 16/89 (17%)

Query: 107 MQGNKAMANKDYELAINKYTEAIKVLPTNAI---------YYANRAAAHSS---LKGYDE 154
           M G   M  KD++ AI  + E + ++P N +         YY  ++ +HSS   ++   E
Sbjct: 169 MLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKE 228

Query: 155 AVE----DAESAISIDPTYFRGYSRLGFA 179
            V+    +A  +I +   Y +G+S +   
Sbjct: 229 IVQKSMNNALRSIELSGLYLKGWSMVAIT 257

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 137 IYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKV 196
           +YYAN          +D+ +E  ++A++ +PT    ++RLG A     + E++++AY K 
Sbjct: 415 LYYAN--------DDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKA 466

Query: 197 LDIE 200
           + ++
Sbjct: 467 IQLK 470

>ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR088C
          Length = 285

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 46/109 (42%), Gaps = 13/109 (11%)

Query: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGF 178
           EL + K    ++  P +A  +   A  +  L  +D+A+   E  + I P  +  +++L  
Sbjct: 142 ELWMKKLLSLLEKFPLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAE 201

Query: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK 227
             Y +   E+ +             +T+ ++   E+A + VE S N  K
Sbjct: 202 VLYCKAMREKPV-------------STDVLQEALENALRAVELSSNCLK 237

>ZYRO0C17138g Chr3 complement(1330370..1331980) [1611 bp, 536 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 536

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 268 NPQLMQAAQ-KMMSNPGAMQNIQKMM 292
            PQ+MQ AQ ++  NPG M+N+Q M+
Sbjct: 468 TPQMMQQAQQRLKQNPGLMKNMQNML 493

>KNAG0J02830 Chr10 complement(542239..543372) [1134 bp, 377 aa] {ON}
           Anc_4.27 YHL025W
          Length = 377

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 303 GFTSGGGAPNLSDLMNNPALRSMAG--NLFGGAGAPS----TEDTSDSENKQ 348
           GF +G   P L    NNP   +++   N+ GGA  PS    T+D   + N+Q
Sbjct: 294 GFDAGQNIPQLMGPENNPVTATVSNNPNILGGADQPSVPLGTQDVDQNGNEQ 345

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query: 109 GNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPT 168
           G   + +   ELA   ++  + + PT+   ++N +AA+  L    EA    + A+S D  
Sbjct: 638 GCVGLESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDAR 697

Query: 169 Y-FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEA 207
             +R +           + ++ L A K ++ I+ D   EA
Sbjct: 698 KNWRIWENYMLVAMKLNEWQDVLMACKNLVTIKRDRVGEA 737

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,050,721
Number of extensions: 1243802
Number of successful extensions: 5136
Number of sequences better than 10.0: 244
Number of HSP's gapped: 5009
Number of HSP's successfully gapped: 325
Length of query: 348
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 238
Effective length of database: 40,868,139
Effective search space: 9726617082
Effective search space used: 9726617082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)