Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1676.19ON31231215880.0
YOR006C (TSR3)6.19ON31331212471e-173
Suva_15.1816.19ON33631212211e-169
Smik_15.1756.19ON31231212081e-168
Kpol_1037.246.19ON36633310411e-141
TDEL0G045006.19ON30127610031e-137
SAKL0E01144g6.19ON43024010011e-134
TPHA0J003206.19ON3423229911e-134
ZYRO0C07832g6.19ON2812409671e-131
CAGL0E02717g6.19ON3252789551e-129
KNAG0M011506.19ON3073139491e-128
Ecym_30236.19ON3492389421e-127
KLLA0D01111g6.19ON3142759351e-126
ACR007W6.19ON3133129231e-124
KLTH0C11264g6.19ON3462928981e-120
Kwal_56.224216.19ON3373208781e-117
NCAS0H008106.19ON3233258771e-117
NDAI0D007906.19ON4012688641e-114
KAFR0L003906.19ON3293027871e-103
TBLA0A072506.19ON3043147821e-103
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.167
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   616   0.0  
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   484   e-173
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   474   e-169
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   469   e-168
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   405   e-141
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   390   e-137
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   390   e-134
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   386   e-134
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   377   e-131
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   372   e-129
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   370   e-128
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   367   e-127
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   364   e-126
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   360   e-124
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   350   e-120
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   342   e-117
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   342   e-117
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   337   e-114
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   307   e-103
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   305   e-103

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/312 (95%), Positives = 298/312 (95%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFLDLNKELLEIYQRCTDADSV              TQERKSHTKKTDIWMMGNINRRGN
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300
           GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE
Sbjct: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300

Query: 301 KPVNYDSLGNLI 312
           KPVNYDSLGNLI
Sbjct: 301 KPVNYDSLGNLI 312

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  484 bits (1247), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 249/312 (79%), Positives = 270/312 (86%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKN R QRGANGHS+RQNH+ MEMKYD SEKMKFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+DLEIVEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFL+LNKELLEIYQ+CTD DSV              TQERKS  K+ DIWMMGNINRRGN
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300
           G QSD  ES E+SEQS LE + Q IEYD+LGNAI +D++KSR   S  SEDEES   EN 
Sbjct: 241 GSQSDTSESEENSEQSDLEGNNQCIEYDSLGNAIRIDNMKSREAQSEESEDEESGSKENG 300

Query: 301 KPVNYDSLGNLI 312
           +P++YD LGNLI
Sbjct: 301 EPLSYDPLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  474 bits (1221), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 249/312 (79%), Positives = 274/312 (87%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNKTHEPKN R QRGANGHS+RQNHK MEMKYD SE   FPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG GVVCP+DLE+VEQHGASVVECSWARLEEV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWAS LLSHFSWGL
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFLDLN+ELLEIYQ+CTD++SV              TQERKS +K  DIWMMGN+NR+ N
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264

Query: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300
           G QSDE ES EDS+QS LE+ +Q IEYD+LGNAI +D+VKSR MLS  SEDEES+F E+E
Sbjct: 265 GAQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEESEFEEDE 324

Query: 301 KPVNYDSLGNLI 312
           +PV+YDSLGN+I
Sbjct: 325 EPVSYDSLGNII 336

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  469 bits (1208), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 245/312 (78%), Positives = 271/312 (86%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK HEPKN R QRGANGHS+RQNH+ MEMKY+ S+K+KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+DLE+VEQHGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWASELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFL+LNKELLEIYQ+CTDADSV              TQERKS  K+ DIWMMGNINRRG 
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300
           G QSDE ESG  S +S  E  +Q +EYD+LGNAI +DS+ SR  LS  SEDEE+D  EN+
Sbjct: 241 GWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEENK 300

Query: 301 KPVNYDSLGNLI 312
           +PV+YDSLGNLI
Sbjct: 301 EPVSYDSLGNLI 312

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  405 bits (1041), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 245/333 (73%), Gaps = 24/333 (7%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMK-YDK--SEKMKFPVKLAMWDFDHCD 57
           M KGKNK HE +  +  RG+NGHS++ NHKHMEMK Y K  S+  KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARL 117
           PKRCSGK+LERLGLI+SLRVGQKFQGVVVSPNG+GV+CPND EIVE+ GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 118 EEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFS 177
           +EVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWA+ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 178 WGLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINR 237
           WGLGFL++N+ELL+IYQ+CTD++SV               QERK+  +++DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 238 RGNGV------QSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIM------- 284
             NG        S E  SG+D E+   EN+ +   YD LGN I  +              
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEE---ENNNKSARYDNLGNIIESEEDYDDYDDEEDRVE 297

Query: 285 -----LSGVSEDEESDFGENEKPVNYDSLGNLI 312
                L  + E+ + +  E EK + YDSLGNLI
Sbjct: 298 VKYDSLGNIIENSDYEQYEEEKELRYDSLGNLI 330

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  390 bits (1003), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/276 (69%), Positives = 215/276 (77%), Gaps = 3/276 (1%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E KN    +G+NGHS+RQNHK MEMK   +E  KFPVKLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG GVVCP+D  IVE+HGASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVG+MDWASELLSHFSWGL
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFL+LN+ELLEIYQ+CTDADSV               +ERKS  K  DIWM GN+NR+G 
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239

Query: 241 GVQSDELESGEDSEQSGLENSE--QPIEYDALGNAI 274
               D  E      +   E  +  + + YD LGN I
Sbjct: 240 TFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  390 bits (1001), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 203/240 (84%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY--DKSEKMKFPVKLAMWDFDHCDP 58
           MGKGKNK HE ++ R  RGANGHS+R NHK MEMK   D S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 59  KRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLE 118
           KRCSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCPND  IVE+HGASVVECSWARL+
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 119 EVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSW 178
           EVPF +IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D ASELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 179 GLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRR 238
           GLGFL+LNKELLEIYQ+CTDADSV               Q+RK  +K+ DIWMMGN+NRR
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  386 bits (991), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 232/322 (72%), Gaps = 13/322 (4%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDK------SEKMKFPVKLAMWDFD 54
           M KGKNK+ E ++ +  RG+NGH  R NHK MEMK+        S++  FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCP+D E VE+ GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 115 ARLEEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLS 174
           ARL+EVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG++D A+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 175 HFSWGLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGN 234
           HFSWGLGFL+LNKELLE+YQ+CTD++SV               QERKS +++ DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 235 INRRGNGVQSDELESGEDSEQ-SGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSED-- 291
            NR    +  DE     DSEQ    EN+E+ I YD LGN +  +          V  D  
Sbjct: 241 TNRDLQDMSDDE---EFDSEQYYSEENTERKIRYDNLGNVLISEEENESEEEEEVRYDAL 297

Query: 292 -EESDFGENEKPVNYDSLGNLI 312
               +  E    + YDSLGNLI
Sbjct: 298 GNIIESEEEAAELKYDSLGNLI 319

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 200/240 (83%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY---DKSEKMKFPVKLAMWDFDHCD 57
           MGKGKNK HE ++ R  RGANGH+++QNHKHMEMK+     S K  FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 58  PKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARL 117
           PKRCSGKKLERLGLIRSLRVGQKFQGVVV+PNG GVVCPND  IVE+HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 118 EEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFS 177
           +EVPFN+IGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVG+MDWASELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 178 WGLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINR 237
           +G  FL++N ELLEIYQ+CTDA+SV               ++RK+  K  DIWM GN+NR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 212/278 (76%), Gaps = 5/278 (1%)

Query: 2   GKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY-DKSEKMKFPVKLAMWDFDHCDPKR 60
           GKGKNK+H+     +  G+NGH  R+NH+HMEMKY   S+   FPVKLAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+ VVCP+D EIVE HGASVVECSWARLEEV
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D A ELLSHFSWGL
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFL+LNK+LLE YQ+CTD++S+               QERK   +  D+WMMGN NR  +
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243

Query: 241 GV----QSDELESGEDSEQSGLENSEQPIEYDALGNAI 274
           G+     S+E    E  E+     + + + YD LGN I
Sbjct: 244 GLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNII 281

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 229/313 (73%), Gaps = 23/313 (7%)

Query: 2   GKGKNKTHEPKNER-QQRGANGHSARQNHKHMEMK-YDKSEKMKFPVKLAMWDFDHCDPK 59
           GKGKNK+   +  R   +G+NGHS+R NHK ME++ +D  +  KFPVK+AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 60  RCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEE 119
           RCSGKKLERLGLI SL+VGQKFQG+VVSPNGQGVVCP+D  IVE+ GASVVECSWARL+E
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 120 VPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWG 179
           VPFN+IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD AS+LLS+FSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 180 LGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRG 239
           LGFL+LNKELLE+YQ+CTD +SV               Q+RK+  +  DIWMMGN+NR  
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243

Query: 240 NGVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGEN 299
           N +      +  D E    E     I YD LGNAI +D           S++EE +    
Sbjct: 244 NKM------TLSDEESDEEETEASSIRYDNLGNAI-IDE----------SDEEEPEIS-- 284

Query: 300 EKPVNYDSLGNLI 312
              + YD+LGN+I
Sbjct: 285 --SIRYDNLGNVI 295

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 195/238 (81%), Gaps = 2/238 (0%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKG+NK ++  +   Q+G+NGHS+R NH+ +E KY+  +  KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGRNKDYDKNH--SQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRV QKFQG+VVSPNG+ VVCPND EI E++G SVVECSWARLEE+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PF KIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD A  LLSHFSWGL
Sbjct: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRR 238
           GFL+LNKE+LEIYQ+CTD DS+                ER+  TK+ DIWMMGN+NR+
Sbjct: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 210/275 (76%), Gaps = 2/275 (0%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           MGKGKNK    +  R Q+G+NGHS+R NHK MEMK+  S   KFPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKESSTR-PRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLRVGQKFQGVVVSPNG+ VVCP+D  +VE++GASVVECSWARL+EV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEV 119

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGGK ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D A++LLS+FSWG 
Sbjct: 120 PFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGP 179

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
            FL+LNKELL+IYQ+CTD DSV                ERK   K  DIWM+GN+NR   
Sbjct: 180 AFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASR 239

Query: 241 GVQSDELESGEDSEQSGLENSE-QPIEYDALGNAI 274
            +     E  E+   +G    + + I+YD+LGN I
Sbjct: 240 DLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVI 274

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/312 (56%), Positives = 226/312 (72%), Gaps = 21/312 (6%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK  E + ++  +G++ H+ + N +  E+K+  +++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKKTEER-QKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLGLI+SLR+GQKFQG+VVSPNG+ VVCPND EIVEQHG SVVECSWARL+E+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PF+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVG+ D A ELLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRRGN 240
           GFL+LN+ELLE YQ+CTD  S+               ++R+  T + DIWMMGN+NR+  
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239

Query: 241 GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENE 300
            ++S  L+S ++S+           EY     A  VD      ++S   E E+   G ++
Sbjct: 240 NMRSSMLDSDDNSDS----------EY-----ASDVD----HDLVSDTEEGEDIAIG-SK 279

Query: 301 KPVNYDSLGNLI 312
           + V YDSLGN+I
Sbjct: 280 RDVTYDSLGNVI 291

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 214/292 (73%), Gaps = 24/292 (8%)

Query: 2   GKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMK-FPVKLAMWDFDHCDPKR 60
           GKG NK    +     + ++GH++   H+H+E K+  ++  K FPVKLAMWDFD CDPKR
Sbjct: 7   GKGSNKQ---RGAHSSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLERLG+I+SLRVGQKFQG+VVSPNG+ VVCPND  IVE++GA+VVECSWARL+EV
Sbjct: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121

Query: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180
           PFNKIGG+ ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG++D A+ELLSHFSWGL
Sbjct: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181

Query: 181 GFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNIN-RRG 239
            FL+LNKELLE+YQRCTDADS+               QERK+     D+W+ GN+N ++G
Sbjct: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKG 241

Query: 240 NGVQSDE----------LESGEDSE-------QSGLENSEQPIEYDALGNAI 274
           +GV  +E           E GE+SE         G E    P++YD+LGN I
Sbjct: 242 HGVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEI 293

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 220/320 (68%), Gaps = 25/320 (7%)

Query: 12  KNERQQRGAN----GHSARQNHKHMEMKYDKSEKMK-FPVKLAMWDFDHCDPKRCSGKKL 66
           K  R  +G+N    GHS R +  ++E K+      + FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 67  ERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEVPFNKIG 126
           ERLG+I+SLRVGQKFQG+VVSPNG+GVVCPND +IVE+ GA+VVECSWARL E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 127 GKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGLGFLDLN 186
           G+ ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD A+ELL+HFSWGLGFL+LN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 187 KELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRR---GN--- 240
           KEL+E+YQ+CTDA+SV                ER++H+   D+WM GN+NRR   GN   
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242

Query: 241 --------GVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDE 292
                    V + + E  ++ +     N ++ ++YD LGN I+              +++
Sbjct: 243 SSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEIYPSESSESSEERDDLDEQ 302

Query: 293 ESDFGENEKPVNYDSLGNLI 312
           E      E    +DSLGN+I
Sbjct: 303 E------EVKYKFDSLGNII 316

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  342 bits (877), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 172/325 (52%), Positives = 224/325 (68%), Gaps = 33/325 (10%)

Query: 1   MGKGKNKTHEPKNE--RQQRGANGHSARQNHKHMEMKY----DKSEKMKFPVKLAMWDFD 54
           MGKGKNK  +  +   RQ RGANGHS+R NHK+MEM+     D S   K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 55  HCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSW 114
           HCDPKRCSGKKLERLGLI+SL++GQ+FQG+++SPNG+ VV P D +I+++ GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 115 ARLEEVPFNKI----GGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWAS 170
           ARL+E+PF+K+    GGK ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+G+ DWA+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 171 ELLSHFSWGLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIW 230
           +LLS+FSWG+ FL LN+EL E+Y +CTD+DS+               +ERK   +  DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 231 MMGNINRRGNGVQSDELESGEDSEQSGLEN---SEQPIEYDALGNAIHVDSVKSRIMLSG 287
           +MGN NR  + ++   L  G++ E+        +E+ ++YD LGN I             
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVI------------- 287

Query: 288 VSEDEESDFGENEKPVNYDSLGNLI 312
                  +  E+E  + YD+LGN+I
Sbjct: 288 -------ESSEDEITLRYDNLGNVI 305

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  337 bits (864), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/268 (60%), Positives = 199/268 (74%), Gaps = 24/268 (8%)

Query: 1   MGKGKNKTHE--PKNERQQRGANGHSARQNHKHMEMKYDK---SEKM------------- 42
           MGKGKNK+ +  PKN R  RGANGHS+R NHK+MEMK      S +M             
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLE 100
             K PVKL MWDFDHCDPKRCSGKKLERLGLI+SL++GQ+FQG+++SPNG+ VV P+D +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 101 IVEQHGASVVECSWARLEEVPFNKI----GGKYERLLPYLVAANQVNYGRPWRLNCVEAL 156
           I+++ GA+VVECSWARL+E+PF+K+    GGK ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 157 AACFAIVGKMDWASELLSHFSWGLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXX 216
           AACFAI+G+ DWAS+LLS+FSWGL FL LN+EL E+Y +CTD+DSV              
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 217 TQERKSHTKKTDIWMMGNINRRGNGVQS 244
             ERK   ++TDIWMMGN NR    ++S
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRS 312

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 200/302 (66%), Gaps = 19/302 (6%)

Query: 20  ANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKRCSGKKLERLGLIRSLRVGQ 79
           +NGH +R N+K ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LIRSL++ Q
Sbjct: 23  SNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQ 82

Query: 80  KFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEVPFNKIGG-KYERLLPYLVA 138
           KFQG+ VSPNG+  V P D E+V + G +VVECSWAR++E+PF+K    K +RLLPYLVA
Sbjct: 83  KFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVA 142

Query: 139 ANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGLGFLDLNKELLEIYQRCTD 198
           ANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL LN+ELLEIYQ+CTD
Sbjct: 143 ANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTD 202

Query: 199 ADSVXXXXXXXXXXXXXXTQERKS--HTKKTDIWMMGNINR------RGNGVQSDELESG 250
           +D +               QERK+  + +  DIWM GN+NR            S++ E  
Sbjct: 203 SDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSEDEEVT 262

Query: 251 EDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENEKPVNYDSLGN 310
            D+  + +EN  + + YD LGN          I+     E    +  + E+ V YDSLGN
Sbjct: 263 YDNLGNIIENEPREVRYDNLGN----------IIEESSEESSGEEEEDEEEDVKYDSLGN 312

Query: 311 LI 312
           +I
Sbjct: 313 VI 314

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  305 bits (782), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/314 (53%), Positives = 201/314 (64%), Gaps = 15/314 (4%)

Query: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60
           M KGKNK HE   ER  R +N  ++R+N     +   KS K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MAKGKNKGHE---ERSNRKSN--NSRRNESKHSLSI-KSTKTNFPVKLAMWDFDHCDPKR 54

Query: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120
           CSGKKLER GL +SLRVGQ+F G+VVSPNG+ VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114

Query: 121 PFNKIGGK--YERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSW 178
           PFNK+GGK   E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174

Query: 179 GLGFLDLNKELLEIYQRCTDADSVXXXXXXXXXXXXXXTQERKSHTKKTDIWMMGNINRR 238
           G  FL+LN ELL+IY  CTD+ SV               +ERK      D W++GN NR+
Sbjct: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234

Query: 239 GNGVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGE 298
                 +  ES ED+  +     E+   YDALGN I  DS   +    G   + E D   
Sbjct: 235 NLNDFDNSSESTEDNISTVSSADER---YDALGNLISNDSHSLKYDSLGNVIESEGD--- 288

Query: 299 NEKPVNYDSLGNLI 312
              P  YD LGN+I
Sbjct: 289 -ALPPKYDKLGNII 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,925,681
Number of extensions: 1407294
Number of successful extensions: 3747
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3779
Number of HSP's successfully gapped: 29
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)