Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1666.18ON94794750300.0
YOR005C (DNL4)6.18ON94494639570.0
Suva_15.1806.18ON94894638970.0
Smik_15.1746.18ON94594538700.0
ZYRO0C07854g6.18ON94494326360.0
NCAS0D026506.18ON95095325600.0
TDEL0G045106.18ON96994425260.0
NDAI0I022606.18ON96796325210.0
KAFR0A050506.18ON94895125120.0
KNAG0F028706.18ON95495023850.0
Kpol_1032.76.18ON96595023580.0
TBLA0G010406.18ON97295323230.0
TPHA0M002606.18ON96695523130.0
CAGL0E02695g6.18ON94694122930.0
Kwal_56.224146.18ON96394322710.0
KLTH0C11286g6.18ON95195521840.0
ACR008W6.18ON98194919730.0
KLLA0D01089g6.18ON90794118530.0
ACL155W7.343ON6974022881e-25
KLLA0D12496g7.343ON7004122791e-24
SAKL0F10912g7.343ON6932972683e-23
NDAI0A019407.343ON7654222612e-22
CAGL0I03410g7.343ON7242972568e-22
TPHA0D045707.343ON7362772523e-21
Kwal_56.246167.343ON7152642504e-21
YDL164C (CDC9)7.343ON7552682514e-21
KAFR0B008307.343ON7104162505e-21
Skud_4.937.343ON7552682505e-21
Smik_4.747.343ON8452682505e-21
TBLA0E020507.343ON7204132496e-21
KLTH0H01408g7.343ON7232642488e-21
TDEL0C020407.343ON7054442443e-20
Suva_4.827.343ON7554132443e-20
KNAG0C037407.343ON7274182381e-19
Kpol_2001.717.343ON7262902343e-19
NCAS0A141107.343ON7532682221e-17
ZYRO0F11572g7.343ON7314072122e-16
Suva_8.4007.46ON985901112e-04
NDAI0E039307.46ON10281151000.004
CAGL0E05588g7.46ON88799990.005
KAFR0C051907.46ON896123970.008
YOR346W (REV1)7.46ON98590890.078
Skud_15.5137.46ON98690880.091
KNAG0E004107.46ON81791860.17
NCAS0E023707.46ON89766830.40
Ecym_63411.276ON76756781.5
ZYRO0E07150g6.228ON449120771.7
TPHA0H028307.46ON923118771.7
AFR095C1.276ON67094771.8
Ecym_21886.228ON461105771.8
ZYRO0G15180g1.276ON68866762.1
KNAG0I004101.462ON86575762.3
KAFR0E006708.594ON16160722.9
TDEL0H040507.46ON855148744.3
Ecym_82575.245ON802100744.3
Kpol_367.97.46ON88066735.0
CAGL0A00913g4.136ON142674745.0
Smik_4.4108.357ON98897726.7
TBLA0A020706.228ON453118726.8
Suva_2.4675.319ON135689727.3
TDEL0E053706.228ON457107717.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.166
         (947 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...  1942   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...  1528   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1505   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...  1495   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1019   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   990   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   977   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   975   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   972   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   923   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   912   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   899   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   895   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   887   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   879   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   845   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   764   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   718   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   115   1e-25
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   112   1e-24
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   107   3e-23
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   105   2e-22
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   103   8e-22
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   101   3e-21
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   100   4e-21
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   101   4e-21
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   100   5e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   100   5e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   100   5e-21
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   100   6e-21
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   100   8e-21
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    99   3e-20
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...    99   3e-20
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    96   1e-19
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...    95   3e-19
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    90   1e-17
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    86   2e-16
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    47   2e-04
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    43   0.004
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    43   0.005
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    42   0.008
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    39   0.078
Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346...    39   0.091
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    38   0.17 
NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.4...    37   0.40 
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    35   1.5  
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    34   1.7  
TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.4...    34   1.7  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    34   1.8  
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    34   1.8  
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    34   2.1  
KNAG0I00410 Chr9 (59772..62369) [2598 bp, 865 aa] {ON} Anc_1.462...    34   2.3  
KAFR0E00670 Chr5 (146215..146700) [486 bp, 161 aa] {ON} Anc_8.59...    32   2.9  
TDEL0H04050 Chr8 (693662..696229) [2568 bp, 855 aa] {ON} Anc_7.4...    33   4.3  
Ecym_8257 Chr8 (522575..524983) [2409 bp, 802 aa] {ON} similar t...    33   4.3  
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    33   5.0  
CAGL0A00913g Chr1 (92985..97265) [4281 bp, 1426 aa] {ON} weakly ...    33   5.0  
Smik_4.410 Chr4 complement(744262..747228) [2967 bp, 988 aa] {ON...    32   6.7  
TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {O...    32   6.8  
Suva_2.467 Chr2 (828049..832119) [4071 bp, 1356 aa] {ON} YDR301W...    32   7.3  
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    32   7.6  

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 1942 bits (5030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 947/947 (100%), Positives = 947/947 (100%)

Query: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60
           MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES
Sbjct: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60

Query: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120
           WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS
Sbjct: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120

Query: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180
           RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC
Sbjct: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180

Query: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240
           LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR
Sbjct: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300
           LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360
           FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360

Query: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420
           AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS
Sbjct: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420

Query: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480
           TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI
Sbjct: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540
           IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC
Sbjct: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSL 600
           SVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSL
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSL 600

Query: 601 DNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQL 660
           DNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQL
Sbjct: 601 DNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQL 660

Query: 661 AHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHG 720
           AHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHG
Sbjct: 661 AHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHG 720

Query: 721 GKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSY 780
           GKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSY
Sbjct: 721 GKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSY 780

Query: 781 CFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLF 840
           CFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLF
Sbjct: 781 CFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLF 840

Query: 841 LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV 900
           LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV
Sbjct: 841 LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV 900

Query: 901 NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVNCG 947
           NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVNCG
Sbjct: 901 NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVNCG 947

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 1528 bits (3957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/946 (77%), Positives = 836/946 (88%), Gaps = 4/946 (0%)

Query: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60
           M  A + IPEPQNFAPSPDFKWLCEELFV+I  V+INGTAGTGKS SFKYYEIISNFVE 
Sbjct: 1   MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM 60

Query: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120
           WRK VGNNIYPALVLALPYRDRRIYNIKDY+LIRTICSYLKLP+NS TEQRLK WKQRV 
Sbjct: 61  WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG 120

Query: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180
           +  NLSSLLVEEIAKRR EP+ K+ITID VN YLD LS +R  SGRGFK LV SKPFL C
Sbjct: 121 KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC 180

Query: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240
           +E+MSFVELKYFFDIVLKNRVIGGQEH+ LNCWHPDAQDYLSV+SDLKVVTSKLYDP+VR
Sbjct: 181 VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300
           LK+DDLSIKVGFAFAPQLAKKV+L YEKICR LH+DFL+EEKMDGERIQVHYMNYG+SIK
Sbjct: 241 LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360
           FFSRRGIDYTYLYGASLSSGTISQ+L+ T++VKECVLDGEMVTFD+ R+VILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS 360

Query: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420
           AK  LS + INN DF PLYMVFDLLYLN  SL PLPLHQRK+YL+SIL+P KN+VEIV+S
Sbjct: 361 AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS 420

Query: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480
           +RCY V+S+K SLEVAISLGSEGVVLKYYNSSYN+ASRN NWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540
           +IGRDSGKKDSFMLGLLV+DE E ++   +  SSE+V+ S  E+ + NS+++VKK+LSFC
Sbjct: 481 VIGRDSGKKDSFMLGLLVLDEEEYKKHQGD--SSEIVDHSSQEKHIQNSRRRVKKILSFC 538

Query: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599
           S+ANGIS EEFKEI+R+TRGHWKRTS+ +PP SIL+FGS+IPAEWI+PS+SIVLEIKSRS
Sbjct: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598

Query: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659
           LDNTET++++YAT+CTLYGGYC+RIRYDK+WTDCYTL  LYE R +KS P+ Q E  QL 
Sbjct: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658

Query: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719
           L  KKRKR LISD FHQ R+Q  IS+IFAGL FYVLSDYVT+DTG+RITRA LE  IV+H
Sbjct: 659 LIRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEH 718

Query: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779
           GGKLI+NVILKRH IGDVRLISCKTT EC+ LIDRGYDI+HP+WV+DCIAYK+LI IEP+
Sbjct: 719 GGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPN 778

Query: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839
           YCF+VS K+R VAEKRVDCLGDSFEN+ISE KLS L+KS+  L  +GE+ IDSE +  PL
Sbjct: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPL 838

Query: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899
           FLFSNRI Y+PR K    E+ ++EMKI+LFGG+IT QQSLCNLIIIPY D   RKDC+ +
Sbjct: 839 FLFSNRIAYVPRRKIST-EDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNE 897

Query: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVN 945
           V+E+IKEQ+KAS T+PK+AR+V+P WVDHSINENCQVPEEDFPVVN
Sbjct: 898 VHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVN 943

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1505 bits (3897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/946 (77%), Positives = 821/946 (86%), Gaps = 4/946 (0%)

Query: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60
           M  A + IPEP NFAPSPDF+WLCEELF +++ V INGTAGTGKS SF+YYEIISNF E 
Sbjct: 1   MASALQAIPEPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTEL 60

Query: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120
           WRK VGNNIYPAL+LALPYRDRRIYNIKDY+LIRT+CSYLKLP+NS TEQRLK WKQRV 
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVG 120

Query: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180
           + R+LSSLLVEEI+KRR EP  KSIT+D VN YLDELSKE + SGRGFK+LV SKPFL C
Sbjct: 121 KGRSLSSLLVEEISKRRTEPTRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHC 180

Query: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240
           LE+M+FVELK+FFDI+LKNRVIGGQEH+ LNCWHPDAQDYLSVVSDL+VVTSKLYDP +R
Sbjct: 181 LENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300
           LKNDDLSIKVGFAFAPQLAKKV+L YEKIC AL NDF +EEKMDGERIQVHYMNYGKSIK
Sbjct: 241 LKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIK 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360
           FFSRRGIDYTYLYG +L SGTISQYLK +++VKECVLDGEMVTFD+ RKVILPFGLVKGS
Sbjct: 301 FFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGS 360

Query: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420
           AK  LS +DINN+DF PLYMVFDLLYLN  SL PLPL+QRK+YLSSIL P K+VVEIV+ 
Sbjct: 361 AKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRY 420

Query: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480
           +RCYD +SVK SLEVAISLGSEGVVLK+Y+SSYN+ASRN NWIKVKPEYLEEFGENLDLI
Sbjct: 421 SRCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540
           IIGRDSGKKDSFMLGLLV+DE+E  + DQE   SE++NDS  E+   N KK+V+KVLSFC
Sbjct: 481 IIGRDSGKKDSFMLGLLVVDEQETGKTDQE-GPSEILNDSSTERRATNPKKRVRKVLSFC 539

Query: 541 SVANGISHEEFKEINRRTRGHWKRTSDFS-PPSILQFGSRIPAEWIEPSDSIVLEIKSRS 599
           S+ANGIS EEFKEI+R+TRGHWK+TS  S PPSIL+FGS++PAEWIEPS+SIVLEIKSRS
Sbjct: 540 SIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRS 599

Query: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659
           LDNTET++++YAT+CTLYGGYCRRIRYDKDWT+CYTL +LYE+R  KS P+ Q EN QLQ
Sbjct: 600 LDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQ 659

Query: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719
           L  KKRKRAL+SDPF Q REQK IS +FAGLFFYVLSDY+   TGVRITR+ L D IVKH
Sbjct: 660 LVPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKH 719

Query: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779
           GGKLIHNVILKRHCIGDVRLI CK T ECR LIDRGYDI+HP W+MDC AY +L+ IEPS
Sbjct: 720 GGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPS 779

Query: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839
           YCFSVS KLR VA +RVDC GDSFEN+ISE KLS L KS+ DL S  +     E Q+IPL
Sbjct: 780 YCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPL 839

Query: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899
           FLFSNRIVYIPR+K G ++E LLEMKIRLFGG+IT QQSL NLIIIPY D   R DC+E+
Sbjct: 840 FLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEE 899

Query: 900 VNEQIKEQMKASH--TVPKVARIVSPGWVDHSINENCQVPEEDFPV 943
           V+ QI E +KAS+  TVP++ RIV+P WVDHSI+ENCQVPEEDFPV
Sbjct: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 1495 bits (3870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/945 (75%), Positives = 828/945 (87%), Gaps = 3/945 (0%)

Query: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVES 60
           M    + +PEPQNFAPSPDFKWLCEELF +ID V++ GT GTGKS SFKYYE++SNFVE 
Sbjct: 1   MVSTLDSVPEPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEM 60

Query: 61  WRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVS 120
           WRK VGNNIYPAL+LALPYRDRRIYNIKDY+LIRTICSYLKLP+NS TE RLK WKQRV 
Sbjct: 61  WRKTVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVG 120

Query: 121 RARNLSSLLVEEIAKRRPEPNGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSC 180
           + +NLSSLLVEEIAKRR EPNGK+ITIDG+N  LDELSK+RS SGRGFK+LV S PFL C
Sbjct: 121 KGKNLSSLLVEEIAKRRSEPNGKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHC 180

Query: 181 LESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVR 240
           LESMSFVELKYFFDI+LK+RVIGGQEH+FL+CWHPDAQDYLSVVSDLKVV SKLYDPRVR
Sbjct: 181 LESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVR 240

Query: 241 LKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIK 300
           LKNDDL+IKVGFAFAPQLAKKV+LPYEKICRALHNDFL+EEKMDGERIQVHYMNYGKS++
Sbjct: 241 LKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVR 300

Query: 301 FFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGS 360
           F+SRRGIDYTYLYGASLSSGTIS +L  T+ V+ECVLDGEMVTFD+ RKVILPFGLVKGS
Sbjct: 301 FYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGS 360

Query: 361 AKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQS 420
           AK  LS + INN DF PLY+VFDLLYLN  SL PLPLHQRK+YL SILTP KNVVE+V++
Sbjct: 361 AKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRT 420

Query: 421 TRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLI 480
           +RCY+V+S+K SLEVAISLGSEGVVLKYYNSSYN+ASRN NWIKVKPEYLEEFGENLDL+
Sbjct: 421 SRCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 481 IIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540
           IIGRD GKKDSFMLGLL+++E+EM++RDQE+SS  + N+SK E +++ S+KKVKK+LSFC
Sbjct: 481 IIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSG-IANNSKNE-NILYSQKKVKKILSFC 538

Query: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599
           SVANGIS EEFKEI+R+TRG WK+TS+ +PP SI +FGS+IPAEWIEP++SIVLEIKSRS
Sbjct: 539 SVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRS 598

Query: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659
           LDNTET++++YATSCTLYGGYC+RIR+DKDWTDC+TL +LY+ R  +  P+ Q E   L+
Sbjct: 599 LDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLK 658

Query: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719
           L  KKR+  L S+ F Q  EQ   S IFAGL+FYVLSDYVT  + VRITR  LE+AIV+H
Sbjct: 659 LVRKKRREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718

Query: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779
           GG+LI+N+ILKRH IGDVRLISCK T ECR LI+RGYDI+HPSWV+DC+AYK+LI IEP 
Sbjct: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778

Query: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPL 839
           YCF+VS K+R VAEKRVDCLGDSFEN+ISE KLSLL+KS+ +L    E+  D+E QV PL
Sbjct: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPL 838

Query: 840 FLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEK 899
           FLFSNRIVYIP  K G++ EK LEMKIRLFGG+IT +QSLCNL+IIPY D + RKDCI++
Sbjct: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKE 898

Query: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
           VNEQIKEQ+KA  T+PK+ RIV+P WVDHSI  NCQVPEEDFPVV
Sbjct: 899 VNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/943 (54%), Positives = 669/943 (70%), Gaps = 16/943 (1%)

Query: 10  EPQNFAPSPDFKWLCEELFVRIDNV-RINGTAGTGKSASFKYYEIISNFVESWRKGVGNN 68
           +P NFAPSPDFKWLC+ELFV+IDNV +     G  KS + KY+EIIS FV+ WRK VG+N
Sbjct: 10  KPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDN 69

Query: 69  IYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSL 128
           IYPAL+L LPYRDRRI+NIKDY LI+ ICS+L+LP NSVTE+RL  WK+R  R   LS  
Sbjct: 70  IYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDF 129

Query: 129 LVEEIAKRRPEP-NGKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFV 187
            VEEI +RR EP NG+ ITID +N+ LD+L++ER+  GRGFK L +S  F  CLE+MSF 
Sbjct: 130 CVEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFT 189

Query: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247
           E+KY+FDI+LK+RVIGGQEH+FLNCWHPDA+DYLSVVSDLK V  KL+DP  RLKNDDL 
Sbjct: 190 EMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLG 249

Query: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307
           + +G  FAP LAK++ + Y+K+   L +DF IEEKMDGERIQ+HYM+YG+ +K+FSRRG 
Sbjct: 250 VNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGN 309

Query: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367
           DYTYLYG  + +GT+++YL+L   V+ECVLDGEM++FD+    +LPFGLVK SA+  L+ 
Sbjct: 310 DYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTA 369

Query: 368 SDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427
             I    +RPLYMV D LYLN +SL  +PL+ RK+YLS+IL P  + VEI+QS  CYD  
Sbjct: 370 EGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDT 429

Query: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           S+K+SLE AI +GSEG++LK++ S Y I +R  NWIK+KPEYLE+FGENLDL++IGRD G
Sbjct: 430 SIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPG 489

Query: 488 KKDSFMLGLLVIDEREMEERDQELSSSEVVN-DSKIEQDVINSKKKVKKVLSFCSVANGI 546
           KKDS M GL V+   E +E     S  +VVN DS+ E++    +K VKK +SFC++ANGI
Sbjct: 490 KKDSLMCGLAVL---EGDEEPGAQSDKQVVNLDSEEEEE---PRKAVKKFISFCTIANGI 543

Query: 547 SHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTETS 606
           S EEFK+I R+T G WK T D  PP IL+FGS++P EWI P DS+VLE+K+RSLDNTE+S
Sbjct: 544 SQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESS 603

Query: 607 IRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKRK 666
            R++   CTL+GGYCRRIR DK+WT+CYTL +L+++R  K  P  +D N Q  +  KK +
Sbjct: 604 GRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKPMKSKKIR 662

Query: 667 RALISDPFHQI---REQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKL 723
           R  I    +Q     ++   SSIF GL FYV+SDY+      RI++  L D I  +GGKL
Sbjct: 663 RPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKL 722

Query: 724 IHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCFS 783
             NVI      G +R+IS K T+EC+ LI+RGYDI+ P W+MDC+    L+ IEP +CFS
Sbjct: 723 TFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFS 782

Query: 784 VSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS--SIGEIGIDSEAQVIPLFL 841
           VS  + ++A  RVD  GDS++  I+E +L  +  S++  S  S G + + S+ + IPLFL
Sbjct: 783 VSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLFL 842

Query: 842 FSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKVN 901
           FS RIV+IP   + L + +LL+ K+RL+GG++T   + CNLII+P    + R   I  + 
Sbjct: 843 FSRRIVFIPEGFSYL-DTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLR 901

Query: 902 EQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
             +      +   P +  IV P W+D SI EN QVPEEDF  V
Sbjct: 902 RLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/953 (50%), Positives = 677/953 (71%), Gaps = 18/953 (1%)

Query: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRIN-GTAGTGKSASFKYYEIISNFVE 59
           ++  P  +  P NF+PSP F+WLC+ELFV++++++        GK  + +YYE+I++F+ 
Sbjct: 7   LSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIA 66

Query: 60  SWRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRV 119
            WRK VGN+I+PAL+L LPYRDRR++NI+DY LI+ IC+YLKLPRNS TE+RL SWK R 
Sbjct: 67  LWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARA 126

Query: 120 SRARNLSSLLVEEIAKRRPEPNGK-SITIDGVNDYLDELSKERSISGRGFKDLVNSKPFL 178
            +   LS   V EI KR+ EP  K  ITID +N+ LD+L++ER+  GRGFK L +S  F 
Sbjct: 127 GKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFK 186

Query: 179 SCLESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPR 238
            CLE+MSF+EL++FFDI+LKNRVIGGQEH+FLN WHPDAQDYLSVVSDL+ VT++L+DP 
Sbjct: 187 FCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPE 246

Query: 239 VRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKS 298
           +RL+N+DL I  GFAFAPQLAKK+S+ YEKIC  L NDF+IEEKMDGERIQ+HY +YG+ 
Sbjct: 247 IRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEK 306

Query: 299 IKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVK 358
           +KFFSRRG DYTYLYG S+  G I ++LKL   VK+C+LDGEM+T+D T+ +ILPFGLVK
Sbjct: 307 LKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVK 366

Query: 359 GSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIV 418
            SA+ +L+   I N  ++PL+MVFDL+++N  SLA +PL+ RK+YL+ I TP  +++E++
Sbjct: 367 SSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELL 426

Query: 419 QSTRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLD 478
            S   ++  S++ SLE+AIS+GSEG+VLK Y+S Y +ASRN +WIKVKPEYLE+FGEN+D
Sbjct: 427 SSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMD 486

Query: 479 LIIIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLS 538
           LI+IGRD GKKDS M GL V++E E  + ++    + ++ D   E   +  ++ + K +S
Sbjct: 487 LIVIGRDPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDD-EDAPVEQERTIHKFVS 545

Query: 539 FCSVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKS 597
           FC +ANG+S EEFK+I+R+TRG W R+ +  PP ++LQFG+R+P EWI+P  S+V+E+K+
Sbjct: 546 FCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKA 605

Query: 598 RSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQ 657
           RS+D  E++ R++AT CTLYGGYCR IR DKDW  CYTL++    + +KS+ N  D+   
Sbjct: 606 RSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIH 665

Query: 658 LQLAHKKRKRALISDPFHQIREQKLI---SSIFAGLFFYVLSDYVTKDTGVRITRAGLED 714
                KK +R  I D    + E+  +   ++ F  L+FYV+SD      G RI +  +  
Sbjct: 666 GVKRQKKNRRKYILD--QSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYK 723

Query: 715 AIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774
            I + GG LIHN+I K+    ++R+IS K T EC  LI+RGYD+++P W++DC+  K L+
Sbjct: 724 YIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLL 783

Query: 775 FIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGI---D 831
            +EP YCF+VS +L+++ EKRVD  GDS+E  I+E +LS L ++  +L  +  +     D
Sbjct: 784 KLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYAD 843

Query: 832 SEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSS 891
            E   IPLFLF +RI+  P T++  +    L+ KI+L+GG++T     CNLII+P    +
Sbjct: 844 EELIKIPLFLFQDRIMLFPNTES--KTISFLQEKIKLYGGKLTTDIGKCNLIILP----N 897

Query: 892 RRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
             +  +++  + + + +  S  VP +  IV+P W++ SI EN QVPEED+PV+
Sbjct: 898 GNQQLLQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/944 (52%), Positives = 661/944 (70%), Gaps = 13/944 (1%)

Query: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTG-KSASFKYYEIISNFVESWRKGVGNNI 69
           P NFAPSPDF WLCEELFV++++V+  G    G K  S +YYE+IS+F+  WRK VGNNI
Sbjct: 27  PPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGNNI 86

Query: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129
           +PALVL+LPYRDRRIYNIKDY L++ ICSYL LP+ S TE+RL  WK+R +R   LS+  
Sbjct: 87  FPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSNFC 146

Query: 130 VEEIAKRRPEPN-GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188
           VEEI KR+ EP+ G+ ITID +N+ LD L +ER+  G GFK L +S  F  CL++MSF+E
Sbjct: 147 VEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSFIE 205

Query: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248
           L++FFDIVLKNRVIGGQEH+ LNCWHPDA DYLSVVSDL+ V S+L+DP  RL+ DDLSI
Sbjct: 206 LRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDLSI 265

Query: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G+AF PQLAKK+++ YEKIC  L+NDFLIEEKMDGERIQVHYM+YG  I+F SRRG+D
Sbjct: 266 NLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVD 325

Query: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368
           YT LYG +L SGT++ YL   + V++CVLDGEM+TFD+ R V+LPFG+VK SA+  LS  
Sbjct: 326 YTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTE 385

Query: 369 DINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQS 428
            I +   RP+ MV DL+YLN +SL  LPL+QRK++L+ +L P  + VEI+   RC +  +
Sbjct: 386 GICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTA 445

Query: 429 VKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           ++ SLE +IS+GSEG+VLK Y + Y I +RN  WIKVKPEYLE+FGENLDL+IIGR  GK
Sbjct: 446 IRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPGK 505

Query: 489 KDSFMLGLLVID-EREMEERDQELSSSEVVNDSKIEQ-DVINSKKKVKKVLSFCSVANGI 546
           KDS M GL V + E ++ E + +  S+ V  DS+ ++ D  + KK +K  +SFC +ANGI
Sbjct: 506 KDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIANGI 565

Query: 547 SHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTET 605
           S +EFKEI+R+TRG W ++    P + +L+FGS+IP EWI+P +SI+LE+K+RSLDNTE+
Sbjct: 566 SQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNTES 625

Query: 606 SIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR 665
           S +++A  CTL+GGYCRRIR DKDWT CY+ ++L+++R  KS       +F  Q + K +
Sbjct: 626 SKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVG--SFNKQYSKKMK 683

Query: 666 KRALISDPFHQIREQKL----ISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721
            +    DPF     +K      ++IF GL FYVLSDY+     VRIT++  +D I+++ G
Sbjct: 684 SKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743

Query: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYC 781
           KL+ N+I K H     R+IS K T ECR LI+RGYDI+ P W++DCI  + ++ +EP +C
Sbjct: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803

Query: 782 FSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEI-GIDSEAQVIPLF 840
           F+VS +L  +   RVD  GDSF N I+E++L  L  +    +    +   +SE  V+PLF
Sbjct: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDVVPLF 863

Query: 841 LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV 900
           LFS R VYIP       +   L  K +L GG I      CNLII+P  +       + ++
Sbjct: 864 LFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLVEM 923

Query: 901 NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
            + + + M  + + P +  IV+P WV+ SI ENCQVPEEDF  V
Sbjct: 924 RQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/963 (52%), Positives = 664/963 (68%), Gaps = 43/963 (4%)

Query: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKS----ASFKYYEIISNFVESWRKGVG 66
           P NFAPSP F+WLC+ELFV+++ ++   T+   K      + +YYE+I +F+  WRK VG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 67  NNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLS 126
           N+IYPAL+L LPYRDRRIYN++DY LI+ ICSYLKLP+NS TE+RL SWKQR  R+  LS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 127 SLLVEEIAKRRPEP---NGKSITIDGVNDYLDELSKERSISGR-GFKDLVNSKPFLSCLE 182
           S +V EI KR+ EP     + ITID +N  LD LS+ER+  G  G++ L +S  F+ CLE
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 183 SMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLK 242
           +M+FVEL++FFDI+LK+RVIGG EH+FLN WHPDAQDYLSVVSDLK V +KL+DP V LK
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302
           NDDL+I VG  FAPQ AKK+S+ YEKIC  L +DF IEEKMDGERIQ+HY +YG  + F 
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362
           SRRG DYTYLYG S+  GT+S+YL L N V+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422
            +++   + N  +RPL MVFDL+YLN +SL  +PL+QRK YL  I TP +++VE+++S R
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482
           C D +S+KN+LE AIS+GSEGVVLK+YNS Y +ASRN +WIKVKPEYLE+FGEN+DLI+I
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 483 GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVN-DSK--------IEQDVINSKKKV 533
           G+D GKKDS M GL V+   E +E + +   +E+VN DS+         E + I  +K +
Sbjct: 499 GKDPGKKDSLMCGLAVV---EEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTI 555

Query: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIV 592
           K+ +SFCS+ANGIS EEFK I R T+G WK++ +  PPS +L+FGSR+PAEWI+P DSIV
Sbjct: 556 KRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIV 615

Query: 593 LEIKSRSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQ 652
           +E+K+RSL+N E + +++ T  TLYGGYCR+IR DKDW  CYTL++L   +  K   N++
Sbjct: 616 IEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKR 675

Query: 653 DENFQLQL--AHKKRKRALISDPFHQIREQKLI----SSIFAGLFFYVLSDYVTKDTGVR 706
             N       + K+RK   I   F +  EQ       S IF GL+FYV+SD V   TG R
Sbjct: 676 ANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSR 734

Query: 707 ITRAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMD 766
           ++R  L D I+  GG ++HNVI K H     R++  K T EC+ LIDRGYDI+ P WV+D
Sbjct: 735 VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLD 794

Query: 767 CIAYKQLIFIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKS-----RQD 821
           CI    L+ +EP YCF+VS +L ++A++RVD  GDSFE  ISE   S L +      R  
Sbjct: 795 CIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNA 854

Query: 822 LSSIGEIGIDSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCN 881
             SI    +D+    +PLFLF  R + +      L  +  L+++IRL+GG+ TG  + CN
Sbjct: 855 PPSIQYDMVDT----VPLFLFYGRTILLRIKDKALFTK--LKVQIRLYGGKTTGDLASCN 908

Query: 882 LIIIPYVDSSRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDF 941
           L++I   + +  KD    V   + +    +   P +  IV+P W+D SI+E CQVPEED 
Sbjct: 909 LVVIQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964

Query: 942 PVV 944
           PVV
Sbjct: 965 PVV 967

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/951 (51%), Positives = 673/951 (70%), Gaps = 27/951 (2%)

Query: 8   IPE---PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKG 64
           +PE   P+NFAPSP FKWLCEELF +++ V  N    T K  + +YYEII+NFV  WR  
Sbjct: 5   VPEVEVPRNFAPSPQFKWLCEELFSKLEEVP-NQRHLTTKRITLRYYEIITNFVNLWRTT 63

Query: 65  VGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARN 124
           VG++IYPAL+LALPYRDRR+YN+KDY LI+ IC+YLKLP+NS TE+RL +WKQR  R+  
Sbjct: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123

Query: 125 LSSLLVEEIAKRRPEPNGKS-ITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLES 183
           LS   V E+ KR+ EP  KS IT+D +N  LD LS++R+I GRG+K+L  S  F  C+E 
Sbjct: 124 LSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEK 183

Query: 184 MSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKN 243
           MSF+EL+YFFDI+LK RVIG  EH+ LN WHPDA+DYLSVVSDLK V ++L++P +RL++
Sbjct: 184 MSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRH 243

Query: 244 DDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFS 303
           D+LSI +G+AFAP LAKK+S+ Y+KIC+ L NDF IEEKMDGERIQ+HYM+YG  IKF S
Sbjct: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLS 303

Query: 304 RRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKG 363
           RRG+DYTYLYG +LS+GTI+ YLKL   VKECVLDGEMVT+D  + ++LPFG+VK +A  
Sbjct: 304 RRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMN 363

Query: 364 VLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRC 423
            L+  +I+  D+ PL MVFDL++LN  SL   PL+QRK YL+S+L P++  V+IV  TRC
Sbjct: 364 ALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRC 423

Query: 424 YDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIG 483
            +   ++ SLE AIS+GSEG+VLK YNS Y I SRN +WIK+KPEYLE+FGEN+DLI+IG
Sbjct: 424 SNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483

Query: 484 RDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVIN--SKKKVKKVLSFCS 541
           RDS KKDSF  GL V+DE E +    E     VVN    E D  N  + + +KKV+SFC 
Sbjct: 484 RDSAKKDSFYCGLTVLDEEEEKL--VEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCM 541

Query: 542 VANGISHEEFKEINRRTRGHWKRTSDF-SPPSILQFGSRIPAEWIEPSDSIVLEIKSRSL 600
           +ANGIS  E+KEI R+TRG WK+T +   PP +++FG+++P EWIEP  S+VLEIK+RSL
Sbjct: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601

Query: 601 DNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQL 660
           DNTE+S +R+   CTLYGGYCRRIR D DW   ++LA+L  DR IK  P   +++  L+ 
Sbjct: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKS 661

Query: 661 AHKKRKRALISDPFHQ---IREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIV 717
             +++K+ L   P +Q    R+ +  S IF GLFFY+LSDY   +  VRI++  L+  ++
Sbjct: 662 KKRRKKQLLT--PLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLL 719

Query: 718 KHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIE 777
           ++GGK+ HN++ KR    ++R++  K T EC +LI RGYDI+ P WV+DC+  K+++ IE
Sbjct: 720 ENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIE 779

Query: 778 PSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS----SIGEIGIDSE 833
           PS+CFSVS  L  +A +RVD  GDS+E+ +S  +LS + +S +D+S    S   + +D E
Sbjct: 780 PSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFE 839

Query: 834 AQVIPLFLFSNRIVYIPR---TKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDS 890
              +P FLF  R  ++      K+ +RE  L   KI+L+GG++    S CN++I P  + 
Sbjct: 840 K--VPYFLFWRRKAFVMEHNFDKSSIRETIL---KIQLYGGKVVKNISECNIVIFPKAEI 894

Query: 891 SRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDF 941
           +  ++ ++ +   + + +  S  +P + RIVS  W+D SI +N QVPEED+
Sbjct: 895 TVIRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/950 (49%), Positives = 634/950 (66%), Gaps = 19/950 (2%)

Query: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIY 70
           P NFAPSPDF+WLC+ELFV+ D V         K  + +YYE++SNFV+ WRK VGNN Y
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68

Query: 71  PALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLV 130
           P L+LALPYRDRR YNIKD  LI+ IC YL LP+ S TE++L +WKQR SR   LSS  V
Sbjct: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128

Query: 131 EEIAKRR--PEPNGK-SITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFV 187
            EI KR+  P+P+ + +IT+D +N  LD+L+  +S  G+G + L +S  F  CLE+MSF+
Sbjct: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188

Query: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247
           ELKYFFDI+LK R+IGG EH+ LN WHPDA DY SVVSDL  VT KLY+P VRL+N+DL+
Sbjct: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248

Query: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307
           +K+G AFAP LAK++++ YEKI + L +DF IEEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308

Query: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367
           DYTYLYG   S+GTI+ YLKL   VKEC+LDGEMVT+D  +++ILPFGLVK SAK  LS 
Sbjct: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368

Query: 368 SDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427
             I+N  + PL+M FDL+YLN  SL  LPL+QRK YLS ILT     V+IV   RC +++
Sbjct: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428

Query: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           S+  SL  AIS+GSEG++LK  NS Y +ASRN +WIK+KP+YL++FGEN+DLIIIGRD G
Sbjct: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488

Query: 488 KKDSFMLGL-LVIDEREMEERDQELSSSEVVN---DSKIEQDVINSKKKVKKVLSFCSVA 543
           KKD+FM  L + ID+ +     QE    E VN   D++  +       ++ K +SFC++A
Sbjct: 489 KKDAFMCALGVTIDDPQPRVLQQE----ENVNLDLDTEDSEPETPKASRIVKFVSFCTIA 544

Query: 544 NGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDN 602
           NGIS+ EFKEI+++TRG W+R     PPS  LQFG++ P EWI+P +S+VLE+KSRSLDN
Sbjct: 545 NGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDN 604

Query: 603 TETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAH 662
           TE+++++Y    TL+GGYCR +RYDKDWT CYT+++   DR  K       E+       
Sbjct: 605 TESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKG 664

Query: 663 KKRKRAL----ISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVK 718
           +K++       +  P  +   +   S IF  L F VLSDY+   TG RI R  L   I+ 
Sbjct: 665 RKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724

Query: 719 HGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEP 778
           +GGK+I+NV+ K    G +R+I     +EC  LI RGYDI+ PSWV+DCI   +L+ +E 
Sbjct: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784

Query: 779 SYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFK---SRQDLSSIGEIGIDSEAQ 835
           ++CF+VS +L E++  RVD   DSFEN IS  +L  L           S     +D E +
Sbjct: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844

Query: 836 VIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKD 895
            +P  LF +R V+I  TK   R    +  + +LFGG++T     CNLIIIP  D   +  
Sbjct: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904

Query: 896 CIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVN 945
            ++K+  ++   ++  ++  ++  IVS  W+  SI EN QVPEE++ V++
Sbjct: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/950 (48%), Positives = 638/950 (67%), Gaps = 25/950 (2%)

Query: 8   IPEPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASF-KYYEIISNFVESWRKGVG 66
           I EP NF+PSPDFKWLC+ELFV++D ++       G    + +YY+II+NF++ WR+ VG
Sbjct: 28  IEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVG 87

Query: 67  NNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLS 126
           N+IYPAL+L +PYRDRR+YNIK+  LIR +C YLKLP+NS TE+RL  WK R  R   LS
Sbjct: 88  NDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLS 147

Query: 127 SLLVEEIAKRRPEPNGK-SITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMS 185
           +  VEEI KR+ EP  K  ITID +N+ LD L  ER   G   + +  S+ F  C E+M+
Sbjct: 148 TFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMT 207

Query: 186 FVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDD 245
           +VELKYFFDI+LK++++GG EH+FLNCWHPDAQDYLSVVSDLK+V+SKL++P  RLK DD
Sbjct: 208 YVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDD 267

Query: 246 LSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRR 305
           L+I +  AF P+ AK+++  Y+ I R L NDF IEEKMDGERIQ+HYMNYG  +KF SRR
Sbjct: 268 LTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRR 327

Query: 306 GIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVL 365
           G+DY+YLYG + ++G I +YL     VKEC+LDGEMVT+DS +  ILPFGLVK SA   L
Sbjct: 328 GLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSL 387

Query: 366 SCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYD 425
           S SDI    + PLYM FDL+YLN  SL+ LPLHQRK YL  +L P  + VEI+ +  C D
Sbjct: 388 SVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCND 447

Query: 426 VQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRD 485
              +K+SLE AI LGSEG++LK ++S Y +A R+ +WIK+KPEYLE+FGEN+DLI+IGRD
Sbjct: 448 SSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGRD 507

Query: 486 SGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANG 545
            GKKDS M GL++  + E EE     S+     +S ++ D        +K++SFC++ANG
Sbjct: 508 PGKKDSLMCGLILTGDNEPEEITSLDSNPTDTAESFLKPD-------KRKIISFCNIANG 560

Query: 546 ISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTE 604
           IS +EF++I+R T GHW +  D  PP  + +FG++ P EWI P  S+VLEIK+RSL+  E
Sbjct: 561 ISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNE 620

Query: 605 TSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKK 664
           ++  +Y T  TL+GGYCR+IRYDKDW  C+T  +  E R +K+      +N  L +  KK
Sbjct: 621 SARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNL-IGRKK 679

Query: 665 RKRALISDPFHQIREQKLISS-----IFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719
           R +  + +   +I E    +      IF GL FYV+SDY+ +  G R++++ L + +++H
Sbjct: 680 RPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEH 739

Query: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779
            GKL+HN I +   +  +R+IS K T E   LI+RGYDI+HP W++DCI+ ++L+ + PS
Sbjct: 740 NGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPS 799

Query: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQ---V 836
           +CF+VS  L EV + RVD  GDS+E +++E+   +L  +RQ L S       +E +    
Sbjct: 800 HCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILI-NRQVLKSESADKRITEGENHLK 858

Query: 837 IPLFLFSNRIVYIPRT--KTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRK 894
           IP+ LF NR  +IP T   T + E   L+ K+ L+GG++  + S CN+I+     +  RK
Sbjct: 859 IPILLFCNRRFFIPETLPSTPIYE---LKSKVELYGGKLVNKISDCNVIVFTNTHTENRK 915

Query: 895 DCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
           + ++K+   +      S  VP + RIV   W+D  I+E  QVPEED+P V
Sbjct: 916 EVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/953 (47%), Positives = 652/953 (68%), Gaps = 22/953 (2%)

Query: 11  PQNFAPSPDFKWLCEELFVRIDNVR---INGTAGT--GKSASFKYYEIISNFVESWRKGV 65
           P+NFAPSPDFKWLC+ELFV+ID +R    N TA T   K  S +Y++ I++F++ WR  +
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 66  GNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNL 125
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLP+NSV E+RL  WK +  R   L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 126 SSLLVEEIAKRRPEPNG---KSITIDGVNDYLDELSKER-SISGRGFKDLVNSKPFLSCL 181
           ++  + EI+KR+ EP     + I+ID +N+ LD+L   R + + +   +L+  + F  CL
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202

Query: 182 ESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRL 241
           E+M+F+ELKYFFDI++KN+++G  E+ FL  WHPD+++YLSVVSDL+ +++KL++P +++
Sbjct: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262

Query: 242 KNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKF 301
            N DLSIKVG+ FAPQLAK++ L Y+ I   L+NDF IEEKMDGERIQ+HYMNYG+++KF
Sbjct: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322

Query: 302 FSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSA 361
           FSR G DYTYLYG   S+GTI+++L+L   VKECVLDGEMVTFDST K +LPFGLVK SA
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 362 KGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQST 421
              L+  DI+N  F PL+MVFD+LYLN  SL  LPL +RK++L+++LTP+K+ VEI+ S 
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 422 RCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLII 481
           RC D   +K  L+ AIS+GSEG+VLK Y S Y   +R+ NWIKVKPEYLEEFGEN+DLI+
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502

Query: 482 IGRDSGKKDSFMLGLLVIDER-EMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540
           IGRDSGKKD  + G+LV +E+ E+ E  +  S  E+++DS  +       + +KKV+SFC
Sbjct: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISFC 562

Query: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599
           ++ANG+S  E KEINR TRG WK  ++ +PP  +L+FG++ P EWI P DS+VLEIK+RS
Sbjct: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622

Query: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQ 659
           LD T+ +  +YAT CTLYGGYCR+IR DKDWT CYTL  L  +  IK +  ++++N Q  
Sbjct: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNE-IK-RHEKKNKNKQTL 680

Query: 660 LAHKKRKRALISDPFHQI---REQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAI 716
           +    RK++ I  P   +    + +LIS +F GL+FY++SDY+      RI R  +   I
Sbjct: 681 IRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLI 740

Query: 717 VKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFI 776
           +K+GG++I+NVI K + I  +R++S K+TIEC  L+ RGYD+++ SW+ DC+    ++ +
Sbjct: 741 IKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPL 800

Query: 777 EPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKS-----RQDLSSIGEIGID 831
           EP++C  VS++L  +A  R+D  GDS+E  + + KL  L  S      +  S++  I  D
Sbjct: 801 EPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLINKD 860

Query: 832 SEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSS 891
                IP+FLF+NR  ++ +    L +   L  +I+L+GG +  +   CN+I+       
Sbjct: 861 EGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQL 920

Query: 892 RRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
             K   +   + +K+ + A+   P + R V+  W+  SI    Q+  ED+P++
Sbjct: 921 VNKKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDYPIL 972

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/955 (48%), Positives = 635/955 (66%), Gaps = 24/955 (2%)

Query: 10  EPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNI 69
           EP+NF+PSPDFKWLC ELFV++D VR+   +   +  + +Y  +I+NF+  WR  VGN+I
Sbjct: 15  EPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGNDI 74

Query: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129
           YPAL L LPYRDRR Y I+++ LIR +C YLKL +NSVTEQRL+ WKQ+  R+ NLSS  
Sbjct: 75  YPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSFC 134

Query: 130 VEEIAKRRPEPNGKS-ITIDGVNDYLDELSKERSIS----GRGFKDLVNSKPFLSCLESM 184
           ++EI KR  EP  K  ITID +N  LD LS ERS S    G   K L   +    C E+M
Sbjct: 135 IQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFENM 194

Query: 185 SFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKND 244
           SF+EL+YFFDI++K R+IGG EH+FLN WHPDA DYLSVVS+L +VT KL++P  RL + 
Sbjct: 195 SFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSK 254

Query: 245 DLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSR 304
           DL+I +  AF PQLAKKV+L YE + R ++N F IEEKMDGERIQ+HYM+YG  IK+FSR
Sbjct: 255 DLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSR 314

Query: 305 RGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGV 364
           RG DYTYLYG   S+ TIS+YL+L   VKEC+LDGEMV++D +R  ILPFG+VK  A   
Sbjct: 315 RGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANS 374

Query: 365 LSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCY 424
           L    + N    PL++VFD+L+LN   L  LPL+QRK+YLS+ILTP K+ +EI++ +  +
Sbjct: 375 LKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 425 DVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGR 484
           D +S++++L+ AIS+GSEG+VLK Y+S Y++  RN +WIKVKPEYLE+FGENLDLI+IGR
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGR 494

Query: 485 DSGKKDSFMLGLLVIDERE-----MEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSF 539
           D GKKDS M G+ V++  E     ++E    L+S +  + + I +D     K++ K +SF
Sbjct: 495 DPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISF 554

Query: 540 CSVANGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSR 598
           C +ANGIS+EEFKEI+R+T G WK+ SD +PP+  L+FG+R+P EWI P DS+VLE+K+R
Sbjct: 555 CVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKAR 614

Query: 599 SLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQL 658
           SL+N E    ++ T  TLYG YCRRIR DKD+ DCYT + L     I +   +       
Sbjct: 615 SLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLV----IATNKKRSSSELYG 670

Query: 659 QLAHKKRKRALISDPFH-------QIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAG 711
             +H K+KR+  S           Q  +    S IF GL F+V+SDYV  ++  R+    
Sbjct: 671 NHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRIDE 730

Query: 712 LEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYK 771
           L + I  +GG+LI N++ +      VR++SCK T EC  LI RGYDI+HP W++DCIA  
Sbjct: 731 LINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIAND 790

Query: 772 QLIFIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSI--GEIG 829
           +L+  EPS+CF+VS  L  ++++RVD LGDS++  I+E +L LL  S+     +    + 
Sbjct: 791 KLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQLYSNPLQ 850

Query: 830 IDSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVD 889
            D + + IP+FLFSN+  Y P+     +  K   + I+L+GG      + CN+III    
Sbjct: 851 FDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVIIIGDEH 910

Query: 890 SSRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
           S    + I  + +++     +S+ V  + RIVS  W++ SI +  QV EEDFP++
Sbjct: 911 SKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPII 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/941 (47%), Positives = 624/941 (66%), Gaps = 33/941 (3%)

Query: 13  NFAPSPDFKWLCEELFVRIDNVRINGTAGT-GKSASFKYYEIISNFVESWRKGVGNNIYP 71
           NFAPSPDF WLCE+LF +ID+V+         K  + +YYE+ISNF   WR  VGNNIYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 72  ALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVE 131
           AL L LPYRDRR++NIKDY LI+ IC++LKLP++S TE++L +WKQ   R+  LS   VE
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 132 EIAKRRPEPN---GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188
           EI KRR EP     + ITID +N YLD+L+ ER+  GR FK+L NS     CL SM+F+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248
           ++YFFDI+LKNR +GG EH+ LNCWHPDAQDYLSVVSDL+ V  +L+DP  RL N DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G AFAPQLA K+ + Y+KI   L  DF IEEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368
           YTYLYG +L +GT++ ++ L   VK+CVLD E+VTFDS  K++LPFG+VK SAK +LS  
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 369 DINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQS 428
            I+   F PL MVFD+LYLN  +L  LP ++R++YL  ILTP  + +EI++S R  D Q 
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 429 VKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSGK 488
           +K SLE A+S+GSEG++LK Y+S Y IASR+ +WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 489 KDSFMLGLLVIDEREMEERDQELSSSEVVNDSKI---EQDVINSKKKVKKVLSFCSVANG 545
           KDS MLGLL          D E    EV+ DS I    Q    + ++ +  +S C +ANG
Sbjct: 504 KDSLMLGLL----------DYE----EVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANG 549

Query: 546 ISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTET 605
           IS+EE+KEI+R+T+G W  +    P   ++FGS++P +WI+P  S++LEIK+RSLDNT +
Sbjct: 550 ISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRS 609

Query: 606 SIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR 665
           S R++A  CTL+GGYCR+IR DK+W  CYTL Q +E     +   ++  +   ++  KKR
Sbjct: 610 SERKFAAGCTLFGGYCRQIREDKNWKTCYTL-QEFERAKSGNNWRKRGSSKPQKVISKKR 668

Query: 666 KRALISD---PFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGK 722
           +  +IS          E +  S IF G++FYVLSDY       RI ++ ++  IV +GG+
Sbjct: 669 RYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQ 728

Query: 723 LIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCF 782
           L+ NVI + + + D+R+IS + T+EC  LI RGYDI+ P WV DC+   +++ +EPS+CF
Sbjct: 729 LVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCF 788

Query: 783 SVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSR--QDLSSIGEIGIDSEAQVIPLF 840
           + S +L + A KR+D  GD +E +I++ + S L   +         ++  D+    +P F
Sbjct: 789 NFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHF 848

Query: 841 LFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCIEKV 900
           LF  RIV++      +++E  +   +  +GG++T + S  NL+I+    + RR   I  +
Sbjct: 849 LFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRR---INDI 902

Query: 901 NEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDF 941
            +QI  ++      P++  +VS GW+   I +N QV E+++
Sbjct: 903 RKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/943 (46%), Positives = 615/943 (65%), Gaps = 26/943 (2%)

Query: 10  EPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNI 69
           +PQNFAPSPDF+WLC+ELF +++ +        GK+ + K  E+I  F++ WR  VG+NI
Sbjct: 35  KPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNI 93

Query: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129
           YP L L LPYRD R YNIKDY L++ +C  L LP++S+TE+RL +WKQ   R  +LS   
Sbjct: 94  YPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFC 153

Query: 130 VEEIAKRRPEPNG-KSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188
           VEEI KRR EP G + +TID +N  LDELSKE S    GF  L  S  F +CL++MSF E
Sbjct: 154 VEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSE 213

Query: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248
            +YFFDI+LK RVIGG EH+FLNCWHPDAQDYL VVSDLKV++  L++P +RL  ++LSI
Sbjct: 214 QRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSI 273

Query: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308
            +G AFAP LAK++ L YE++C  L  DF+IEEKMDGERIQ+HY+  G  I+F SRRG D
Sbjct: 274 NIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTD 333

Query: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368
           +T+LYG SL  G ISQ+LK  N V++CVLDGEMV+FD  + V+LPFG+VK +A   L  S
Sbjct: 334 FTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNS 393

Query: 369 D--INNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
           D  ++   +RPLYM+FDL+YLN +SL  LPLH RK YL SIL+P  N+VEI+   R  + 
Sbjct: 394 DTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEP 453

Query: 427 QSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDS 486
            ++K SLE AI +GSEG++LK ++S Y I +RN +WIK+KPEY EE GE +DL++IGRD 
Sbjct: 454 NAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDP 513

Query: 487 GKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGI 546
           GKKDS M GL++ DE          +    VN +  + D +  K++  KV+SFC++ANG+
Sbjct: 514 GKKDSLMCGLILADE----------TDGSSVNLAS-QDDPLRPKQRNPKVISFCNIANGV 562

Query: 547 SHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTET 605
           S  EFKEI R+TRG W  T+   PPS +L+FG+++P EWI+P  S+VLE+K+RS+D  E 
Sbjct: 563 SDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDEL 622

Query: 606 SIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR 665
           S ++Y T  TL G YCR +R++KDW+ C T+ Q  + +   +    + ++ Q+    K+R
Sbjct: 623 SSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQIS-PRKQR 681

Query: 666 KRALISDPFHQI----REQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721
           K A +S+ +  +    RE    S+IF GL FY+LSDY+      R  +  +   + K+ G
Sbjct: 682 KLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSG 740

Query: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYC 781
            ++HN  ++R     +R+IS K T+ECR L ++GYDI+HPSW+ DC+ Y  L+ +EP +C
Sbjct: 741 HVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHC 800

Query: 782 FSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLFL 841
           F  S KL E + +RVD  GDSF   +S  +   L   +  +S    +    E   IPLFL
Sbjct: 801 FRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSP--HLSAPEELDGIPLFL 858

Query: 842 FSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRK--DCIEK 899
           F N  +Y  R      +E+ LE  +RLFGGE +     CNL+++      ++K    +E 
Sbjct: 859 FQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918

Query: 900 VNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFP 942
           + ++I     +S    ++  +VS  W++  INE C VPEEDFP
Sbjct: 919 LRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/955 (45%), Positives = 615/955 (64%), Gaps = 43/955 (4%)

Query: 10  EPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNI 69
           EP NFAPSPDF+WLCEELF R+D +        GK+ + K  EII+ F++ WR  VG++ 
Sbjct: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L R+S+TE+RL +WKQ   R  +LS   
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 130 VEEIAKRRPEP-NGKSITIDGVNDYLDELSKERS-ISGRGFKDLVNSKPFLSCLESMSFV 187
           V+EI+KRR EP   + +TIDG+N+ LDEL+KE S     G   L  S  F  CL+++SF+
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198

Query: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247
           EL+YFFDIVLKNRVIGG EH+FL CWHPDAQ YL VV+DLK+++ KL++P VRL   DLS
Sbjct: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258

Query: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307
           I +G AFAP LAK++ + YE+IC  L +DF++EEKMDGERIQ+HY+N G  +KF SRRGI
Sbjct: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318

Query: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367
           D+++LYG  ++ G ISQYLKL + V++CVLDGEMV++D  RK+ILPFG+VK +A   L  
Sbjct: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378

Query: 368 SDINNSD--FRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYD 425
           S++ N +  +RPLYMVFDL+YLN +SL  +PLH RK+YL  IL+P  +VVEI++  R  D
Sbjct: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438

Query: 426 VQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRD 485
            +++KN ++ AI +GSEGV++K  +S+Y + +RN +W+K+KPEY E+ GE +DL++IGRD
Sbjct: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498

Query: 486 SGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANG 545
            GKKDS M GLLV D   + E           N   IE         + K +SFC+VANG
Sbjct: 499 PGKKDSLMCGLLVSDSEHILE-----------NFGPIEHG--KEGDPIIKCVSFCNVANG 545

Query: 546 ISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTE 604
           +S EEFKEINR+TRG W    +  PP S+L+FGS+IP EWI+P +S+V+E+K+RS++N+E
Sbjct: 546 VSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSE 605

Query: 605 TSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKK 664
            S +RY    TL+  YCRRIR DKDWT C ++AQ  +    K+  N      ++     +
Sbjct: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQ---AKAAHNYHRYKRKVHQVSPR 662

Query: 665 RKRALISDPFHQIRE----------QKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLED 714
           RKR +     H+I E              SSIF GL FY+LSDYVT     R  R  +  
Sbjct: 663 RKRNV-----HEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAA 716

Query: 715 AIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774
            +VKHGG ++ N+ ++   +  +R++S KTTIECR L++RGYDI+ P W+ DCI+    +
Sbjct: 717 KVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQL 776

Query: 775 FIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFK----SRQDLSSIGEIGI 830
            IEP +CF  S +L + + +RVD  GDSF   +   +   LFK    S  D SS     +
Sbjct: 777 GIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSML 836

Query: 831 DSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIP-YVD 889
             +    PLFL     +Y+       ++  +L  KI L+GG ++      NL+++P  + 
Sbjct: 837 QDDLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALS 896

Query: 890 SSRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
           ++R    ++++ ++I     A +T  ++  IV   W+D    E C VPEEDF  +
Sbjct: 897 TARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/949 (41%), Positives = 583/949 (61%), Gaps = 33/949 (3%)

Query: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIY 70
           P NF+PSPDF WLC+ELF++++ V +      GK    +  EI SNFV  WRK VGN+IY
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109

Query: 71  PALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLV 130
           PALVL+LPY DRR Y +KD  L++ +C ++KLPRNS TE+RL  WKQ   R   LS+  V
Sbjct: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169

Query: 131 EEIAKRRPEPN-GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVEL 189
           EE+ KRR EP   K ++ID VN  LD+L  E ++    +  L  S  F  CLE MS+VEL
Sbjct: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229

Query: 190 KYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIK 249
           ++FFDIVLK  ++ G E   L+CWHPDA+ Y  VVSDL++V   LYDP  RL+ +DLS++
Sbjct: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289

Query: 250 VGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDY 309
           +G+AFAP +A++V +PYEK+   L NDF +EEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349

Query: 310 TYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSD 369
           TYLYG + S G+IS +LK    VKEC+LDGEMV++D   + ILPFGL K  A   ++   
Sbjct: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409

Query: 370 INNSD--FRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427
             +++  +RPLY VFDLLYLN   L    + +RK+YL  IL P KNVV ++   RC D +
Sbjct: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469

Query: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           ++  +L  A++ GSEG+VLK   S Y++  R+ +WIK+KPEYLE FGEN+DL++IGRD G
Sbjct: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529

Query: 488 KKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGIS 547
           +KDSF+  L V D+    E++   S     +     + +I  + K++K +SFCS+ANGIS
Sbjct: 530 RKDSFICALAVTDD---SEKNNPSSYESGSDSDSDSEPII-VQPKIEKFISFCSIANGIS 585

Query: 548 HEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTETS 606
           +EEFKEI+R TRG+W    +  PP+  ++FG++ P EWI+P +S+VLE+K+RS+DN E+ 
Sbjct: 586 NEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESK 645

Query: 607 IRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPN-QQDENFQLQLAHKKR 665
              Y T  TLY  YC+RIR+DK+W+   T+A+    R  +S  N  Q+  F    +  ++
Sbjct: 646 SDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRK 705

Query: 666 KRALISDPFHQIREQKLI----SSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGG 721
           +R      FH + +  +     +    G +FYV S Y    +   I  + + +A+V  GG
Sbjct: 706 RRT-----FHLVGDIDVTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGG 760

Query: 722 KLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYC 781
             IHN+ + R  +  + ++ CK T E ++LI+RGYDI+HP W+MDC+ Y  ++ IEP Y 
Sbjct: 761 TYIHNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYV 819

Query: 782 FSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQVIPLFL 841
           +S S +L + A  + D  G+S++  ++E  L  L   + +     E+G D+ ++   L +
Sbjct: 820 YSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLI 879

Query: 842 FSNRIVYIPRTKTGLRE-EKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDC---- 896
           F   + YI            +++  I   GGE+T    L  +++         KDC    
Sbjct: 880 FKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVA-------VKDCFSQL 932

Query: 897 -IEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944
            ++ V   I  ++  S+ V  + +IV+  WV+  +     V E+++  +
Sbjct: 933 SLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/941 (42%), Positives = 577/941 (61%), Gaps = 68/941 (7%)

Query: 12  QNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIYP 71
           +NF+PSP+FKWLC+EL  +I     +     GK  + +Y EII+NF++ WR  VGN IYP
Sbjct: 5   ENFSPSPEFKWLCDELLGKIYETS-SKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63

Query: 72  ALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVE 131
           AL L +P+RDRRIYN+K+  LI+ +C YL+LP++S TE RL  WKQR +R   LS   VE
Sbjct: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123

Query: 132 EIAKRRPEPNGKS-ITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVELK 190
           EI KR+ +  G + ITID +N YLDE+S+E +    G+  L +S+ F  CL  M+F+E+K
Sbjct: 124 EIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMK 183

Query: 191 YFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKV 250
           +FFDI+LK RV+ G E+ FL  WHPDA DYLSVVSDL V++ +LY+P  RL+  DLSI +
Sbjct: 184 FFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITI 243

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
             AF PQLAK+  L YE++   L +DF+IEEKMDGER+Q+HY+NYG+ IK+ SRRG+D++
Sbjct: 244 SHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFS 303

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
           YLYG + SSG IS  LKL   VK+C+LDGEM+T+D+ + ++LPFGLVK SA   +     
Sbjct: 304 YLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELA 363

Query: 371 N---NSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427
                  ++PL++ FDL+YLN  SL  L L +RK YL+ ILTP +  VEI+Q  +  + +
Sbjct: 364 GIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAE 423

Query: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487
           ++K+SLE AIS+GSEG+VLK+ +S Y + SRN +WIK+KPEYLE+FGEN+DL+IIGR+ G
Sbjct: 424 AIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQG 483

Query: 488 KKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGIS 547
           KKDSF  GL + D  E+ E+                           + +SFC++ANG+S
Sbjct: 484 KKDSFFCGLSISDPNEVAEK--------------------------PRFISFCTIANGLS 517

Query: 548 HEEFKEINRRTRGHWKRTSDFSP-PSILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTETS 606
           +EEFK+I R+T G W   S+  P P++L FG+++P EWI P DS+VLE+K+R++D  E+ 
Sbjct: 518 NEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESE 577

Query: 607 IRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKKR- 665
            R+Y + CTL+ GYC++IRYDKDW    T+A   E   +K   N  ++    Q+   K+ 
Sbjct: 578 KRKYRSGCTLHFGYCKQIRYDKDWK---TVASFSEFEDMKDARNFYNKRKSHQVTDGKKR 634

Query: 666 --KRALI-----SDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVK 718
             KRA I     S+P   +     +S+ F+   F V+SDY       RI++  L   I++
Sbjct: 635 ASKRAKIGIVNSSEPTALVAP---VSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILE 691

Query: 719 HGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI--AYKQLIFI 776
           HGG++++          ++ +I  K T EC+IL++    I+ PSW+  CI   YK     
Sbjct: 692 HGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKT---- 747

Query: 777 EPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEAQV 836
                F+ S   R   E  +DC    F  + +   L+ L ++    ++ G    DS+  +
Sbjct: 748 ----PFTESDIFRGELESSMDC--SQFYTDFNTASLNHLLET----ANRGIKNPDSDLLL 797

Query: 837 --IPLFLFSNRIVYIPRTKTGLREEKL-LEMKIRLFGGEITGQQSLCNLIIIPYVDSSRR 893
             +PLFLFSN  + +  ++  L    L +E  I+  GGE+   ++    III + D   R
Sbjct: 798 PEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENAS--IIIVFNDFISR 855

Query: 894 KDCIEKVNEQIKEQMKAS-HTVPKVARIVSPGWVDHSINEN 933
           +D      +   + +K S  + P++ R+V   W   SI +N
Sbjct: 856 EDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN 896

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 105/402 (26%), Positives = 165/402 (41%), Gaps = 55/402 (13%)

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
             Y          Q+L    T +  ++D E V +D+ ++ ILPF ++    +  +   D+
Sbjct: 389 ERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444

Query: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430
                R     FDLLYLN  SL    L  R+K+L S+L      ++        ++  ++
Sbjct: 445 K---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501

Query: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII----- 482
             LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++     
Sbjct: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYG 561

Query: 483 -GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCS 541
            G+ +G    F+LG    D  E E                                + C 
Sbjct: 562 RGKRTGTYGGFLLGCYNPDLEEFE--------------------------------TCCK 589

Query: 542 VANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAE-WIEPSDSIVLEIKSRSL 600
           +  G S E  + ++       K T   +P   + +    P + W EP+    +     SL
Sbjct: 590 IGTGFSEEVLQSLH----AQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSL 645

Query: 601 DNTETSIRR-YATSCTLYGGYCRRIRYDKDWTDCYTLAQLYE 641
                + R  Y    +L      RIR DK  TD  +  Q+ E
Sbjct: 646 SPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVE 687

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 101/412 (24%), Positives = 170/412 (41%), Gaps = 59/412 (14%)

Query: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302
           N  + ++ G    P LAK      E + R     F  E K DGER QVH    G S+K +
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384

Query: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362
           SR G D T  Y        +  Y+K     K  ++D E V +D  +  ILPF ++    +
Sbjct: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422
             +   D+     R     FD+L LN+  L     H+R++ L       +   +      
Sbjct: 441 KGVELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479
             +   ++  L+ ++    EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533
           +++      G+ +G    F+LG   +D  E E                            
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFE---------------------------- 589

Query: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAE-WIEPSDSIV 592
               + C +  G S E  +++  +     K T+   P + + + S  PA+ W EP  S++
Sbjct: 590 ----TCCKIGTGFSDEMLQDLYTK----LKDTTVEHPSTNVIYDSSAPADVWFEP--SML 639

Query: 593 LEIKSRSLDNT---ETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYE 641
            E+ +  L  +   +     +    +L      RIR DK+ TD  +  Q+ E
Sbjct: 640 FEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIE 691

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 133/297 (44%), Gaps = 17/297 (5%)

Query: 218 QDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDF 277
           +D    V + ++V +   +  +   N    +K G    P LAK      E + R     F
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352

Query: 278 LIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVL 337
             E K DGER QVH +  G S+  +SR G + T  Y        I  YL    T    +L
Sbjct: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERY----PELHIRDYLADPETTHSLIL 407

Query: 338 DGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPL 397
           D E V +D+ +  ILPF ++    +  +   D+     R     FD+L  N  SL    L
Sbjct: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSL 464

Query: 398 HQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYN 454
            +R++YL  +L P     +        +++ V+  LE ++    EG+++K      S Y 
Sbjct: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524

Query: 455 IASRNYNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVIDEREME 505
            + R+ NW+K+K +YL+  G++LDL ++      G+ +G    F+LG    D  E E
Sbjct: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFE 581

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 177/422 (41%), Gaps = 64/422 (15%)

Query: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302
           N+  S++ G    P LAK      E + R     F  E K DGER QVH +  G +++ +
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448

Query: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362
           SR G + T  Y        I  ++K  N  K  +LD E V +D  ++ ILPF ++    +
Sbjct: 449 SRNGENMTERY----PEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504

Query: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422
             +   D+     R     FD+L  N   L    L +R++ L  + TP     +      
Sbjct: 505 KDVLAKDVK---VRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELT 561

Query: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479
             ++  ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 562 TSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDL 621

Query: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533
            ++      G+ +G    F+LG    +  E E                            
Sbjct: 622 CVLGAYYGRGKRTGTYGGFLLGCYNDNTGEFE---------------------------- 653

Query: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVL 593
               + C +  G S E  ++++ + +       D    + +   S  P  W EP  S++ 
Sbjct: 654 ----TCCKIGTGFSDEMLQQLHEKLKA---TVIDGPKATYIYDSSAEPDVWFEP--SLLF 704

Query: 594 EIKSRSLDNTETSIRRYATSCTLYGGYCR-----RIRYDK---DWTDCYTLAQLYEDRPI 645
           E+ +  L  + + I +  +S    G   R     RIR DK   D T    + +LYE++  
Sbjct: 705 EVLTADL--SLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762

Query: 646 KS 647
           +S
Sbjct: 763 RS 764

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 137/297 (46%), Gaps = 17/297 (5%)

Query: 218 QDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDF 277
           +D    V + ++V +   D  +   ++  +I+ G    P LAK      E + R     F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 278 LIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVL 337
             E K DGER QVH +  G +++ +SR G + T  Y        I  +L    +    +L
Sbjct: 384 TSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERY----PEIQIKDFLADPASTTSLIL 438

Query: 338 DGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPL 397
           D E V +D  +  ILPF ++    +  +   +IN    R     FD+L  N++ L   PL
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKRKDV---NINEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 398 HQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYN 454
            +R++ L  +  P +   +        ++  ++  L+ ++    EG+++K  +   S Y 
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 455 IASRNYNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVIDEREME 505
            + R+ NW+K+K +YLE  G++LDL ++      G+ +G    F+LG    D  + E
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFE 612

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 129/277 (46%), Gaps = 22/277 (7%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E +      +F+ E K DGER QVH +  G  ++ +SR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 307 IDYTYLYGASLSSGTISQYLKLTN---------TVKECVLDGEMVTFDSTRKVILPFGLV 357
            + T  Y        +     +TN          VK+ +LD E+V +D  +K ILPF ++
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 358 KGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEI 417
               +  +   D+     R     FDLLYLN   +    L +R++ L  +        + 
Sbjct: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527

Query: 418 VQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFG 474
             S    D+  ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +YL+  G
Sbjct: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587

Query: 475 ENLDLIII------GRDSGKKDSFMLGLLVIDEREME 505
           ++LDL+++      G+ +G    F+LG    D +E E
Sbjct: 588 DSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE 624

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 122/264 (46%), Gaps = 17/264 (6%)

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH +  G S++ +SR G + T
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
             Y        IS ++   +     +LD E V +D  + VILPF ++    +  +   D+
Sbjct: 408 ERY----PEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463

Query: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430
                R     FD+L  N+  L    L +R+ YL  IL P    +++        +  ++
Sbjct: 464 K---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520

Query: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII----- 482
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++     
Sbjct: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 580

Query: 483 -GRDSGKKDSFMLGLLVIDEREME 505
            G+ +G    F+LG    D  E E
Sbjct: 581 RGKRTGTYGGFLLGCYNQDTGEFE 604

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 128/268 (47%), Gaps = 17/268 (6%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I+ +++  +T K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 443 ENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
            +D+     +     FD+L  N+  L    L +R++YL+ +        +        ++
Sbjct: 499 LNDVK---VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNL 555

Query: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
             ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 556 DELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 483 -----GRDSGKKDSFMLGLLVIDEREME 505
                G+ +G    F+LG    D  E E
Sbjct: 616 AYYGRGKRTGTYGGFLLGCYNQDTGEFE 643

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 100/416 (24%), Positives = 173/416 (41%), Gaps = 60/416 (14%)

Query: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302
           ++  S++ G    P LAK      E   R  +  F  E K DGER QVH MN G S++ +
Sbjct: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393

Query: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362
           SR G + T  Y        ++ ++K  N  K  ++D E V +D   K ILPF ++    +
Sbjct: 394 SRNGENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKR 449

Query: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422
             +   DI     R     FD+L  N+  L    L +R++ L S+           +   
Sbjct: 450 KDVDIKDIK---VRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479
             ++  ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533
            ++      G+ +G    F+LG    D  E E                            
Sbjct: 567 CVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFE---------------------------- 598

Query: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVL 593
               + C +  G S E  + +  R +     T D    + +   S  P  W EP  +++ 
Sbjct: 599 ----TACKIGTGFSDEVLQSLYDRLKS---TTIDGPKATYIYDSSAQPDVWFEP--TLLF 649

Query: 594 EIKSRSLDNT---ETSIRRYATSCTLYGGYCRRIRYDK---DWTDCYTLAQLYEDR 643
           E+ +  L  +   +     Y+   +L      R+R DK   + T    + +LYE++
Sbjct: 650 EVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQ 705

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 129/268 (48%), Gaps = 17/268 (6%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I+ +++  N+ K  +LD E V +D  +K ILPF ++    +  + 
Sbjct: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
             D+     +     FD+L  N+  L    L +R+++L+ +        +        ++
Sbjct: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNL 555

Query: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
             ++  L+ +++   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 556 DELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 483 -----GRDSGKKDSFMLGLLVIDEREME 505
                G+ +G    F+LG    D  E E
Sbjct: 616 AYYGRGKRTGTYGGFLLGCYNQDTGEFE 643

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 130/268 (48%), Gaps = 17/268 (6%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I+ +++  +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 533 ENMTERY----PEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV- 587

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
             ++N+   R     FD+L  N+  L  + L +R++YL+ +        +        ++
Sbjct: 588 --ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNL 645

Query: 427 QSVKNSLEVAISLGSEGVVLKYYNSS---YNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
             ++  L+ +++   EG+++K  + S   Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 646 DELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 705

Query: 483 -----GRDSGKKDSFMLGLLVIDEREME 505
                G+ +G    F+LG    D  E E
Sbjct: 706 AYYGRGKRTGTYGGFLLGCYNQDTGEFE 733

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 108/413 (26%), Positives = 166/413 (40%), Gaps = 70/413 (16%)

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E +    +  F  E K DGER QVH +  G S++ +SR G D T
Sbjct: 353 GIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDMT 411

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
             Y        I  YL  + T  + +LD E V +D   + ILPF ++    +  +   DI
Sbjct: 412 QRY----PELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDI 467

Query: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430
                R     FD+L  N  SL    L +R+  L SI  P     +        ++  ++
Sbjct: 468 K---VRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQ 524

Query: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII----- 482
             L+ AI    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++     
Sbjct: 525 TFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYG 584

Query: 483 -GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCS 541
            G+ +G    F+L     D  E E                                + C 
Sbjct: 585 RGKRTGTYGGFLLACYNQDTEEFE--------------------------------TCCK 612

Query: 542 VANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRI-PAEWIEPSDSIVLEIKSRSL 600
           +  G S E  + +        K T+  SP +   F S   P  W  P  ++V E+ +  L
Sbjct: 613 IGTGFSDEMLQTL----YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADL 666

Query: 601 DNTETSIRRYATSCTLYGG-----YCR--RIRYDKDWTDCYTLAQL---YEDR 643
             +      Y    T+YG      + R  RIR DK   D  +  Q+   YE++
Sbjct: 667 SLSPI----YKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQ 715

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 120/264 (45%), Gaps = 17/264 (6%)

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E + R     F  E K DGER QVH +  G S++ +SR G + T
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
             Y        IS ++         +LD E V +D  +  ILPF ++    +  ++  D+
Sbjct: 416 ERY----PEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471

Query: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430
                R     FD+L  N+  L   PL +R+  L   L P    +++        +  ++
Sbjct: 472 K---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528

Query: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII----- 482
           + L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++     
Sbjct: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 588

Query: 483 -GRDSGKKDSFMLGLLVIDEREME 505
            G+ +G    F+LG    D  E E
Sbjct: 589 RGKRTGTYGGFLLGCYNQDSGEYE 612

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 104/444 (23%), Positives = 182/444 (40%), Gaps = 66/444 (14%)

Query: 218 QDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDF 277
           +D    V + ++V +   D  +   +    ++ G    P LAK      E + R     F
Sbjct: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365

Query: 278 LIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVL 337
             E K DGER QVH +  G +++ +SR G + T  Y       +I  ++      K  +L
Sbjct: 366 TSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY----PEISIRDFVADLEHTKTLIL 420

Query: 338 DGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPL 397
           D E V +D  ++ ILPF ++    +  +   D+     R     FD++  N        L
Sbjct: 421 DCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK---VRVCLFAFDIICHNGERQINKSL 477

Query: 398 HQRKKYLSSILTP----FKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN--- 450
            +R++ L+ +  P    F+  VE+  S+    V+ ++  L+ ++    EG+++K  +   
Sbjct: 478 RERRELLAQVTKPVAGEFQYAVELTTSS----VEELQKFLDQSVKDSCEGLMVKMLDGPE 533

Query: 451 SSYNIASRNYNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVIDEREM 504
           S Y  + R+ NW+K+K +YL+  G++LDL ++      G+ +G    F+LG    D  E 
Sbjct: 534 SHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEF 593

Query: 505 EERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANGISHEEFKEINRRTRGHWKR 564
           E                                + C +  G S E  +++  R    + +
Sbjct: 594 E--------------------------------TCCKIGTGFSDEMLQQLYER----FSK 617

Query: 565 TSDFSPPSILQFGSRI-PAEWIEPSDSIVLEIKSRSLDNT-ETSIRRYATSCTLYGGYCR 622
           T+   P +   F S   P  W EP+    +     SL    +     Y    +L      
Sbjct: 618 TTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFV 677

Query: 623 RIRYDKDWTDCYTLAQ---LYEDR 643
           R+R DK   D  + AQ   LY+D+
Sbjct: 678 RLRDDKSVEDATSSAQIVELYQDQ 701

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 171/413 (41%), Gaps = 62/413 (15%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           ++K G    P LAK      E + R     F  E K DGER QVH ++ G +++ +SR G
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I+ +++  +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 443 ENMTERY----PEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
            SD+     R     FD+L  N   L    L +R++ L+ +        +        ++
Sbjct: 499 LSDVK---VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555

Query: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
             ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 483 -----GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVL 537
                G+ +G    F+LG    D  E E                                
Sbjct: 616 AYYGRGKRTGTYGGFLLGCYNQDTGEFE-------------------------------- 643

Query: 538 SFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRI-PAEWIEPSDSIVLEIK 596
           + C +  G S E  ++++ R       T    P +   F S   P  W EP  + + E+ 
Sbjct: 644 TCCKIGTGFSDESLQQLHER----LTPTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVL 697

Query: 597 SRSLDNT---ETSIRRYATSCTLYGGYCRRIRYDK---DWTDCYTLAQLYEDR 643
           +  L  +   +     +A   +L      RIR DK   D T    + +LYE++
Sbjct: 698 TADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQ 750

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 170/418 (40%), Gaps = 72/418 (17%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           S++      P LAK      E   R     F  E K DGER QVH +  G +++ +SR G
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I  ++   +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 415 ENMTERY----PEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV- 469

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
             DIN    R     FD+L  N+  L    L +R+  L SI        +        ++
Sbjct: 470 --DINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527

Query: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
           + +++ L+ ++    EG+++K      S Y  + R+ NW+K+K +YL   G++LDL ++ 
Sbjct: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587

Query: 483 -----GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVL 537
                G+ +G    F+LG    D  E E                                
Sbjct: 588 AYFGRGKRTGNYGGFLLGCYNQDTGEFE-------------------------------- 615

Query: 538 SFCSVANGISHEEFKEINRRTRGHW----KRTSDFSPPSILQFGSRIPAEWIEPSDSIVL 593
           + C +  G S E  ++++ R +       K T  F P       S  P  W EP  +++ 
Sbjct: 616 TACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDP-------SAEPDVWFEP--TLLF 666

Query: 594 EIKSRSLDNTETSIRRYATSCTLYGGYCR-----RIRYDK---DWTDCYTLAQLYEDR 643
           E+ +  L  + + + +  +S    G   R     R+R DK   D T    + ++YE++
Sbjct: 667 EVLTADL--SLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 135/290 (46%), Gaps = 22/290 (7%)

Query: 229 VVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERI 288
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392

Query: 289 QVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYL--KLTNTVKEC--VLDGEMVTF 344
           QVH ++ G+ ++ +SR G + T  Y        I  +L    +NT KE   +LD E+V +
Sbjct: 393 QVHLLSNGE-MRIYSRNGENMTERY----PELHIEDFLVKDESNTDKEVSLILDCEVVAW 447

Query: 345 DSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYL 404
           D+ +  ILPF ++    +  +   D+     R     FD+LY N   L    L +R+K L
Sbjct: 448 DNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKTLRERRKIL 504

Query: 405 SSILTPFKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYN 461
             +        +   S    ++  ++  L+ AI    EG+++K  +   S Y  + R+ N
Sbjct: 505 HEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRN 564

Query: 462 WIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVIDEREME 505
           W+K+K +YL   G++LDL ++      G+ +G    F+LG    D  E E
Sbjct: 565 WLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYE 614

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 126/268 (47%), Gaps = 17/268 (6%)

Query: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306
           S++ G    P LAK      E + R     F  E K DGER QVH ++ G +++ +SR G
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441

Query: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366
            + T  Y        I+  L +T+T+   +LD E V +D+ +  ILPF ++    +  + 
Sbjct: 442 ENMTERYPEIHIRDFIADPL-VTSTL---ILDCEAVAWDNEQNKILPFQVLSTRKRKDVD 497

Query: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426
             D+     +     FD+L  N+  L    L +R++ L  +        +        ++
Sbjct: 498 LKDVK---VKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554

Query: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482
             ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL +I 
Sbjct: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614

Query: 483 -----GRDSGKKDSFMLGLLVIDEREME 505
                G+ +G    F+LG    D  E E
Sbjct: 615 AYYGRGKRTGMYGGFLLGCYNQDTGEFE 642

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 97/407 (23%), Positives = 166/407 (40%), Gaps = 63/407 (15%)

Query: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310
           G    P LAK      E + R     F+ E K DGER Q+H +  G +++ +SR G + T
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424

Query: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370
             Y        I  +L   +T +  +LD E V +D  +  ILPF ++    +  +   D+
Sbjct: 425 ERY----PEIDIRDFLSDPST-ESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDV 479

Query: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430
                R     FDLL  N   L    L +R+  L  +  P              +++ ++
Sbjct: 480 K---VRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQ 536

Query: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII----- 482
           + L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL   G++LDL ++     
Sbjct: 537 HFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYG 596

Query: 483 -GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCS 541
            G+ +G    F+LG    D  E E                                + C 
Sbjct: 597 RGKRTGTYGGFLLGCYNQDTGEYE--------------------------------TCCK 624

Query: 542 VANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGS-RIPAEWIEPSDSIVLEIKSRSL 600
           +  G S E  +++  R     K T+  +P +   + S + P  W EP  +++ E+ +  L
Sbjct: 625 IGTGFSEELLQQLYDR----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADL 678

Query: 601 DNT---ETSIRRYATSCTLYGGYCRRIRYDK---DWTDCYTLAQLYE 641
             +   +    +Y    +L      RIR DK   + T    +  LYE
Sbjct: 679 SLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYE 725

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 7/90 (7%)

Query: 709 RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
           R  L + IV HGGK +H++  K+       +++    ++ RI     Y +V+P W+ DCI
Sbjct: 182 RLQLHEMIVLHGGKFLHHLSAKKRV---THIVASNLPLKKRIEF-ANYKVVNPDWITDCI 237

Query: 769 AYKQLIFIEPSYCFSVSHKLREVAEKRVDC 798
             ++L+   P   +S++ KL E  +K  +C
Sbjct: 238 KERRLL---PWQNYSLTAKLDEQQKKLDNC 264

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 9/115 (7%)

Query: 686 IFAGLFFYVLSDYVTKDTGVRIT-RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKT 744
           I  GL   +  D +    G  I  R  L ++IV HGGK IH++  K+       +I+   
Sbjct: 171 INEGLPPQIFKDCIIYINGYTIPGRLQLHESIVLHGGKFIHHLSAKKKI---THIIASNL 227

Query: 745 TIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCFSVSHKLREVAEKRVDCL 799
           T++ ++  ++ Y +V P W++  I  K+L+   P   F++   L E  +KR+D L
Sbjct: 228 TLKKKLEFEK-YKVVKPDWIVKSIESKKLL---PWQDFALLTHLDE-QQKRLDFL 277

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 676 QIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKLIHNVILKRHCIG 735
           +    ++   IF GL  Y+ + + T        R  L   IV HGGK +H++  KR    
Sbjct: 74  EFNRHEVYPQIFQGLVLYI-NGFTTP------GRFELHQMIVVHGGKFLHHMSAKRSV-- 124

Query: 736 DVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774
              +I+    ++ RI     Y +V P+W++D I  K+L+
Sbjct: 125 -THIIASNLPLKKRIEF-ANYKVVKPNWIVDSIQQKKLL 161

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 13/123 (10%)

Query: 652 QDENFQLQLAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAG 711
           +D  FQ +   + ++  L+   +  I   K  S++F  L  Y+       +   R +R  
Sbjct: 77  RDTYFQEKALKQSKEDELLKRRYESI--GKATSNLFKDLTVYI-------NGYTRPSRFQ 127

Query: 712 LEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYK 771
           L + IV +GGK +H++  KR       +I+   T++ +I     Y +V P W++D I  K
Sbjct: 128 LHEMIVLNGGKFLHHLSAKRSV---THIIASTLTLKKKIEF-ANYKVVKPEWLVDSIKVK 183

Query: 772 QLI 774
           +L+
Sbjct: 184 KLL 186

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 709 RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
           R  L + IV HGGK +H +  K+       +++    ++ RI     Y +V P W++D +
Sbjct: 181 RLQLHEMIVLHGGKFLHYLSSKKTV---THIVASNLPLKKRIEF-ANYKVVSPDWIVDSV 236

Query: 769 AYKQLIFIEPSYCFSVSHKLREVAEKRVDC 798
              +L+   P   +S++ KL E  +K  +C
Sbjct: 237 KEARLL---PWQNYSLTSKLDEQQKKLDNC 263

>Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346W
           (REAL)
          Length = 986

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 709 RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
           R  L + IV HGGK +H +  K+       +++    ++ RI     Y +V P W+ D I
Sbjct: 181 RLQLHEMIVLHGGKFLHYLSAKKTI---THIVASSLPLKKRIEF-ANYKVVSPDWITDSI 236

Query: 769 AYKQLIFIEPSYCFSVSHKLREVAEKRVDC 798
              +L+   P   +S++ KL E  +K  +C
Sbjct: 237 REGRLM---PWKIYSLTAKLDEQQKKLDNC 263

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 10/91 (10%)

Query: 684 SSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCK 743
             IFAGL  YV       D      R  L   IVKHGG+  H +  KR       +I+  
Sbjct: 39  GGIFAGLVVYVNGYTRPWD------RLKLHAEIVKHGGEFCHYMSGKRQV---THIIASN 89

Query: 744 TTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774
            T++ + +  R Y +V   WV+D I   +L+
Sbjct: 90  LTLK-KFVEFRNYKVVSAQWVVDSIQRGRLL 119

>NCAS0E02370 Chr5 (464339..467032) [2694 bp, 897 aa] {ON} Anc_7.46
           YOR346W
          Length = 897

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 709 RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
           R  L + IV HGGK +H++  K+       +I+    ++ R+   + Y +V P W++  I
Sbjct: 148 RLQLHEMIVLHGGKFLHHLSAKKKV---THIIASNLPLKKRLEF-QNYKVVKPDWIVQSI 203

Query: 769 AYKQLI 774
           A  +L+
Sbjct: 204 AQGKLL 209

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 7/56 (12%)

Query: 729 LKRHCIGDVR-------LISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIE 777
           L  H I D+        +  C T    +   + G  IVHP WVMDC     ++ +E
Sbjct: 142 LTNHFIKDIECSAQSVFITDCATGARAKAAREEGVPIVHPKWVMDCTKRGAVLEME 197

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 22/120 (18%)

Query: 379 YMVFDLLYLNEISLAPLPLHQRKKYLSS-----------------ILTPFKNVVEIVQST 421
           Y++FD L +N   L P P   R  +L                   +  PFK  + +   +
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFK--ISMKHMS 201

Query: 422 RCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLII 481
             YD+  V NSLE    + S+G++     + Y +  ++   +K KPE  EE   +  LI+
Sbjct: 202 FSYDLLKVANSLEKLPHM-SDGLIFTPVKTPYFVGGKDSLLLKWKPE--EENSVDFKLIL 258

>TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.46
           YOR346W
          Length = 923

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 18/118 (15%)

Query: 658 LQLAHKKRKRALISDPFHQIRE-QKLISS------IFAGLFFYVLSDYVTKDTGVRITRA 710
           ++ AH  R +      F Q+++ QKL+        IF     Y+ + Y   D      R 
Sbjct: 90  VKTAHYGRGQYFRDKEFKQLQQDQKLVQENQDKIKIFKNCVIYI-NGYTDPD------RL 142

Query: 711 GLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
            L   IV HGGK +H++  K        +++    ++ R+   + Y ++ P W++D +
Sbjct: 143 VLHKLIVIHGGKFLHHMTSKGRV---THIVATNLPLKKRVEFAK-YKVITPEWILDSV 196

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 8/94 (8%)

Query: 687 FAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKLIHNVILKRHCIGDVR---LISCK 743
           F G  FYV   ++ +  G R++ A L+      G + +      R      R   +  C 
Sbjct: 111 FGG--FYV---FIGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTDCA 165

Query: 744 TTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIE 777
                    ++G  +VHP WV DC+    ++ +E
Sbjct: 166 EGARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 16/105 (15%)

Query: 379 YMVFDLLYLNEISLAPLPLHQRKKYLS-SILTPFKNV--------------VEIVQSTRC 423
           Y++FD L +N  SL   P   R  +L      P+ ++              + +      
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 424 YDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPE 468
           YD+  + ++L+  +   S+G++    N+SYN+  ++ N +K KP+
Sbjct: 204 YDLVKIASTLD-KLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 4/66 (6%)

Query: 746 IECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCFSV---SHKLREVAEKRVDCLGDS 802
           I  +  ++ G  I+HP WV+DC     L+  +P Y          L ++     DC  DS
Sbjct: 163 IRVKAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIEPGTTLDQIGINSCDCW-DS 221

Query: 803 FENNIS 808
               IS
Sbjct: 222 LAEPIS 227

>KNAG0I00410 Chr9 (59772..62369) [2598 bp, 865 aa] {ON} Anc_1.462
           YJR036C
          Length = 865

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 125 LSSLLVEEIAKRRPEPNGKSIT-IDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLES 183
           + S L +E      +P G++I+  + V+ YL E   +  I  R F DL         LES
Sbjct: 116 IQSCLKQESKSNNVDPMGRTISSFEPVSQYLTECFHDADILERSFYDL-------HILES 168

Query: 184 MSFVELKYFFDIVLK 198
           ++  EL  F+D+++K
Sbjct: 169 INLKELHAFYDVIMK 183

>KAFR0E00670 Chr5 (146215..146700) [486 bp, 161 aa] {ON} Anc_8.594
           YPL108W
          Length = 161

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 584 WIEPSDSIVLEIKSRSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDR 643
           W++  D+  L+ +S S+   + +++      T   G+  R+ Y K++ DCY  A + +D+
Sbjct: 72  WMDQYDNDPLKFQSESVLFNDLTVKHNRLVLT---GFIHRLYYQKNYQDCYKFASMVKDK 128

>TDEL0H04050 Chr8 (693662..696229) [2568 bp, 855 aa] {ON} Anc_7.46
           YOR346W
          Length = 855

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 62/148 (41%), Gaps = 21/148 (14%)

Query: 686 IFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTT 745
           IFAG   Y+       +   +  R  L +  V +GG  +H +  KR       +++    
Sbjct: 88  IFAGCTIYI-------NGYTKPGRLQLHEMFVSYGGNFLHYLSGKRKI---THIVATNLP 137

Query: 746 IECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPSYCFSVSHKLREVAEK--------RVD 797
           ++ R+   R Y +V P W+ + I  ++L+  + +Y  S   + + +  K         +D
Sbjct: 138 LKKRLEF-RNYKVVRPEWITESIDQEKLLPWQ-NYALSWDQEQKNLQFKAASPPPSDTID 195

Query: 798 CLGDSFENNISER-KLSLLFKSRQDLSS 824
           C   +F  N  E  +L  L   + DL S
Sbjct: 196 CKDPNFIQNFFENSRLHHLSNWKADLRS 223

>Ecym_8257 Chr8 (522575..524983) [2409 bp, 802 aa] {ON} similar to
           Ashbya gossypii ACR044C
          Length = 802

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 408 LTPFKNVVEIVQST-----RCYD-VQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYN 461
           LT F NV+ I   +      CYD +   +N +  A+ L  +G       + +++A     
Sbjct: 651 LTDFINVLAIQADSPAVYQECYDSIIKTRNHVVWALILMLKG-------TPWDLAMWKSY 703

Query: 462 WIKVKPEYLEEFGENLD--LIIIGRDSGKKDSFMLGLLVI 499
           WI+ K E  +   ++ D    I GRD G   SF+LGLL I
Sbjct: 704 WIEFKKEEPQATEKDRDTGFFIFGRDEGIIRSFVLGLLRI 743

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 709 RAGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCI 768
           R  L + IV HGGK +H +  K        +++ K  ++ ++     Y +V+P W+M+ I
Sbjct: 110 RLKLHELIVIHGGKFLHFLSAKGSA---THIVASKLPLKKKLEY-ANYKVVNPDWIMNSI 165

Query: 769 AYKQLI 774
              +L+
Sbjct: 166 NAGKLL 171

>CAGL0A00913g Chr1 (92985..97265) [4281 bp, 1426 aa] {ON} weakly
            similar to uniprot|Q06164 Saccharomyces cerevisiae
            YLR320w
          Length = 1426

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 144  SITIDGVNDYLDELSKERSISGRGFKD-------LVNSKPFLSCLESMSFVELKYFFDIV 196
            S  +D +  YLD ++    I    F+D       L+ + P   CLE   F ++  F D++
Sbjct: 1295 SFMMDVLKGYLDSIN--WIIDSDSFQDYYLIALKLIMAYPASLCLEGKCFFKILTFVDVL 1352

Query: 197  LKNRVIGGQEHRFL 210
            L N  +G +E+ FL
Sbjct: 1353 LNNYCLGLEEYSFL 1366

>Smik_4.410 Chr4 complement(744262..747228) [2967 bp, 988 aa] {ON}
           YDR166C (REAL)
          Length = 988

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 817 KSRQDLSSIGEIGIDSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQ 876
           K   D ++  EIG++S   ++  F++ N+I     +K  L +E L  +K  L G E++ +
Sbjct: 32  KLNNDETTTNEIGVESSFDILKDFIYGNQISIDKESKAYLNDESLSYIKDPLNGQEMSKE 91

Query: 877 -QSLCNLIIIPYVDSSRRKDCIEKVNEQIKEQMKASH 912
            Q+L N       DS+R K  +      +K  ++  H
Sbjct: 92  LQNLPN-------DSTRLKYLVNSKQFNVKAFLRDMH 121

>TBLA0A02070 Chr1 complement(499281..500642) [1362 bp, 453 aa] {ON}
           Anc_6.228 YGL130W
          Length = 453

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 18/118 (15%)

Query: 379 YMVFDLLYLNEISLAPLPLHQRKKYLS-SILTPFKNV--------------VEIVQSTRC 423
           Y++FD L +N   L P P   R  +L      P+ ++              + +      
Sbjct: 144 YLMFDCLAINGRCLVPSPTSSRLAHLGKEFFKPYYDLRTYYPDHCGTFPFKLSMKHMNFS 203

Query: 424 YDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLII 481
           YD+  V+N+L+  +   S+G++     +SY +  ++   +K KPE  EE   +  LI+
Sbjct: 204 YDLVKVENTLD-KLPHKSDGLIFTPVKTSYYVGGKDSYLLKWKPE--EENSVDFKLIL 258

>Suva_2.467 Chr2 (828049..832119) [4071 bp, 1356 aa] {ON} YDR301W
            (REAL)
          Length = 1356

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 464  KVKPEYLEEFGENLDLIIIGRD--SGKKDSFMLGLLVIDEREMEERDQ-ELSSSEVVNDS 520
            +V  E L E GE     +IG D  +   + F  G+L+I+ +  +  DQ + S + VVN+ 
Sbjct: 962  RVPYEALGEDGEK----VIGYDEEAPHAEGFQSGILLINPKSWKVIDQIDFSKNSVVNEM 1017

Query: 521  KIEQDVINSKKKVKKVLSFCSVANGISHE 549
            +     INSK K K+      VAN  + +
Sbjct: 1018 RSSMIQINSKTKRKREYIIAGVANATTED 1046

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 20/107 (18%)

Query: 379 YMVFDLLYLNEISLAPLPLHQRKKYLSS-----------------ILTPFKNVVEIVQST 421
           Y++FD L +N   + P P   R  +L                   +  PFK  + +    
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLFAEQCVTFPFK--LSMKHMN 201

Query: 422 RCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPE 468
             YD+  V NSL  ++   S+G++       Y++ S++   +K KPE
Sbjct: 202 FSYDLLKVANSLS-SLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,442,309
Number of extensions: 4700975
Number of successful extensions: 15434
Number of sequences better than 10.0: 81
Number of HSP's gapped: 15715
Number of HSP's successfully gapped: 81
Length of query: 947
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 828
Effective length of database: 39,836,145
Effective search space: 32984328060
Effective search space used: 32984328060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)