Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1656.15ON25725712181e-171
Suva_15.1796.15ON25925910361e-143
Smik_15.1736.15ON25122510051e-138
YOR004W (UTP23)6.15ON2542259901e-136
NCAS0D026606.15ON2612267891e-105
NDAI0I022506.15ON2712377741e-103
KAFR0A050606.15ON2692317691e-102
Kpol_1045.746.15ON2572267561e-101
KLLA0D01023g6.15ON2682197521e-100
KNAG0F028806.15ON2692257465e-99
TDEL0G045406.15ON2452257367e-98
CAGL0E02673g6.15ON2632287361e-97
ZYRO0C07920g6.15ON2932277331e-96
SAKL0E01056g6.15ON2692217231e-95
KLTH0C11352g6.15ON2682287204e-95
ACR011C6.15ON2532236994e-92
Kwal_56.223996.15ON2742276928e-91
Ecym_30196.15ON2662206883e-90
TPHA0J002806.15ON2712156841e-89
TBLA0A072906.15ON2592276352e-82
KLTH0E02860g5.392ON1891451338e-09
Kwal_55.200895.392ON1891451321e-08
AEL102W5.392ON1891411293e-08
Kpol_1055.185.392ON1891411293e-08
CAGL0M01056g5.392ON1891451293e-08
ZYRO0A06754g5.392ON1891481284e-08
KNAG0C052705.392ON1891411275e-08
KAFR0D042805.392ON1891411275e-08
SAKL0G07766g5.392ON1891411267e-08
KLLA0A07018g5.392ON1891411267e-08
NDAI0C045505.392ON1891411267e-08
TBLA0H017505.392ON1891451259e-08
Kwal_56.22400singletonOFF51501161e-07
TDEL0E023305.392ON1891481241e-07
Ecym_74695.392ON1891451232e-07
TPHA0D023105.392ON1891411232e-07
NCAS0F030905.392ON1891451222e-07
Suva_2.5095.392ON1891411196e-07
Skud_4.6065.392ON1891411196e-07
Smik_4.5995.392ON1891411196e-07
YDR339C (FCF1)5.392ON1891411196e-07
KNAG0C005501.88ON106481880.016
KNAG0B066704.341aON124469810.12
CAGL0L09933g5.638ON40874800.13
KNAG0I013101.397ON48067800.13
Smik_9.432.235ON1359197790.21
ZYRO0D03476g1.232ON49070770.31
ZYRO0F17226g1.59ON299120760.35
Suva_2.337.413ON98281760.47
NDAI0J028304.342ON42865750.53
NDAI0B046201.348ON72167740.80
Smik_15.1646.32ON76981740.80
ZYRO0E07920g6.264ON28637730.81
YOR322C (LDB19)7.75ON818154740.81
Suva_2.5285.414ON944141740.83
Smik_12.2361.397ON48786730.98
TDEL0D010904.309ON64268731.0
ZYRO0D03916g8.543ON79860731.1
Ecym_41125.577ON83166731.1
KAFR0J010005.203ON41177721.2
ZYRO0F10494g8.329ON44167721.3
Suva_8.383singletonON23882711.3
Kpol_543.344.194ON64991721.4
Ecym_43058.265ON311146711.5
NCAS0C008608.764ON22766701.7
NCAS0C049001.397ON47554711.7
CAGL0H06985g8.872ON878204711.9
KLLA0A04730g4.56ON102180711.9
TPHA0I020008.527ON47884702.3
AAL007C1.397ON48565702.3
CAGL0L11418g4.339ON56469702.4
SAKL0C10758g3.196ON70676702.5
Skud_15.93.5ON108372702.6
Kpol_1023.625.587ON150792702.6
TDEL0A023402.458ON35685692.8
Smik_10.851.201ON23557683.1
Kpol_1028.1058.764ON26177683.2
KLTH0H02464g7.296ON80769693.3
CAGL0M12144g7.50ON97165693.4
Skud_4.7831.52ON113597693.4
TBLA0A054401.82ON217058693.6
Skud_4.4078.329ON45775684.0
YHR146W (CRP1)2.81ON46567684.0
TPHA0B038201.397ON47878684.0
NDAI0G043201.397ON48378684.0
SAKL0D09108g1.397ON48575684.0
Skud_1.507.102ON65481684.3
TDEL0A068006.267ON70789684.3
TPHA0C045407.197ON93896684.5
ZYRO0B03740g7.409ON113740684.5
TBLA0I02620singletonON316664684.8
TDEL0B021105.709ON38976675.0
SAKL0G19734g2.666ON43960675.2
Smik_7.1536.133ON50174675.4
TPHA0B013201.276ON753114675.8
Suva_8.3747.75ON808148675.8
YGL108C6.149ON14066646.2
KLTH0A04620g7.253ON38769666.7
Smik_8.2302.81ON46079667.0
KLTH0H12078g1.397ON48446667.1
KNAG0E013901.423ON573130667.3
CAGL0M13035g2.586ON59279667.4
KLTH0F09108g8.370ON71997667.6
NDAI0K013308.681ON750114667.6
NDAI0C026906.32ON78064667.7
Ecym_55175.417ON95258667.8
ZYRO0D04554g7.50ON100976667.9
NCAS0A090902.308ON13847638.3
TDEL0C045102.234ON20879649.0
NDAI0D028404.61ON42662659.1
ZYRO0F03740g8.64ON683676510.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_15.165
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   473   e-171
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   403   e-143
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   391   e-138
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   385   e-136
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   308   e-105
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   302   e-103
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   300   e-102
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   295   e-101
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   294   e-100
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   291   5e-99
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   288   7e-98
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   288   1e-97
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   286   1e-96
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   283   1e-95
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   281   4e-95
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   273   4e-92
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   271   8e-91
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   269   3e-90
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   268   1e-89
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   249   2e-82
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    56   8e-09
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    55   1e-08
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    54   3e-08
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    54   3e-08
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    54   3e-08
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    54   4e-08
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    54   5e-08
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    54   5e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    53   7e-08
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    53   7e-08
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    53   7e-08
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    53   9e-08
Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OF...    49   1e-07
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    52   1e-07
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    52   2e-07
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    52   2e-07
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    52   2e-07
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    50   6e-07
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    50   6e-07
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    50   6e-07
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    50   6e-07
KNAG0C00550 Chr3 (92890..96084) [3195 bp, 1064 aa] {ON} Anc_1.88...    39   0.016
KNAG0B06670 Chr2 (1314289..1318023) [3735 bp, 1244 aa] {ON}            36   0.12 
CAGL0L09933g Chr12 (1069785..1071011) [1227 bp, 408 aa] {ON} sim...    35   0.13 
KNAG0I01310 Chr9 complement(253551..254993) [1443 bp, 480 aa] {O...    35   0.13 
Smik_9.43 Chr9 (95836..99915) [4080 bp, 1359 aa] {ON} YIL126W (R...    35   0.21 
ZYRO0D03476g Chr4 complement(286629..288101) [1473 bp, 490 aa] {...    34   0.31 
ZYRO0F17226g Chr6 (1434400..1435299) [900 bp, 299 aa] {ON} weakl...    34   0.35 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    34   0.47 
NDAI0J02830 Chr10 (703072..704358) [1287 bp, 428 aa] {ON} Anc_4....    33   0.53 
NDAI0B04620 Chr2 (1147583..1149748) [2166 bp, 721 aa] {ON} Anc_1...    33   0.80 
Smik_15.164 Chr15 complement(280356..282665) [2310 bp, 769 aa] {...    33   0.80 
ZYRO0E07920g Chr5 complement(618222..619082) [861 bp, 286 aa] {O...    33   0.81 
YOR322C Chr15 complement(918606..921062) [2457 bp, 818 aa] {ON} ...    33   0.81 
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    33   0.83 
Smik_12.236 Chr12 (453255..454718) [1464 bp, 487 aa] {ON} YLR175...    33   0.98 
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    33   1.0  
ZYRO0D03916g Chr4 (317703..320099) [2397 bp, 798 aa] {ON} simila...    33   1.1  
Ecym_4112 Chr4 complement(232757..235252) [2496 bp, 831 aa] {ON}...    33   1.1  
KAFR0J01000 Chr10 (181394..182629) [1236 bp, 411 aa] {ON} Anc_5....    32   1.2  
ZYRO0F10494g Chr6 complement(852619..853944) [1326 bp, 441 aa] {...    32   1.3  
Suva_8.383 Chr8 complement(685690..686406) [717 bp, 238 aa] {ON}...    32   1.3  
Kpol_543.34 s543 (75894..77843) [1950 bp, 649 aa] {ON} (75894..7...    32   1.4  
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    32   1.5  
NCAS0C00860 Chr3 complement(150659..151342) [684 bp, 227 aa] {ON...    32   1.7  
NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {...    32   1.7  
CAGL0H06985g Chr8 (691854..694490) [2637 bp, 878 aa] {ON} simila...    32   1.9  
KLLA0A04730g Chr1 complement(421863..424928) [3066 bp, 1021 aa] ...    32   1.9  
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    32   2.3  
AAL007C Chr1 complement(328643..330100) [1458 bp, 485 aa] {ON} S...    32   2.3  
CAGL0L11418g Chr12 (1213420..1215114) [1695 bp, 564 aa] {ON} sim...    32   2.4  
SAKL0C10758g Chr3 (976369..978489) [2121 bp, 706 aa] {ON} some s...    32   2.5  
Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}...    32   2.6  
Kpol_1023.62 s1023 complement(138899..143422) [4524 bp, 1507 aa]...    32   2.6  
TDEL0A02340 Chr1 complement(421990..423060) [1071 bp, 356 aa] {O...    31   2.8  
Smik_10.85 Chr10 (138253..138960) [708 bp, 235 aa] {ON} YJL148W ...    31   3.1  
Kpol_1028.105 s1028 complement(231216..232001) [786 bp, 261 aa] ...    31   3.2  
KLTH0H02464g Chr8 (220805..223228) [2424 bp, 807 aa] {ON} simila...    31   3.3  
CAGL0M12144g Chr13 (1212803..1215718) [2916 bp, 971 aa] {ON} hig...    31   3.4  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    31   3.4  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...    31   3.6  
Skud_4.407 Chr4 complement(725275..726648) [1374 bp, 457 aa] {ON...    31   4.0  
YHR146W Chr8 (390300..391697) [1398 bp, 465 aa] {ON}  CRP1Protei...    31   4.0  
TPHA0B03820 Chr2 (902102..903538) [1437 bp, 478 aa] {ON} Anc_1.3...    31   4.0  
NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON} Anc_1...    31   4.0  
SAKL0D09108g Chr4 (750336..751793) [1458 bp, 485 aa] {ON} simila...    31   4.0  
Skud_1.50 Chr1 (107387..109351) [1965 bp, 654 aa] {ON} YAL011W (...    31   4.3  
TDEL0A06800 Chr1 (1186658..1188781) [2124 bp, 707 aa] {ON} Anc_6...    31   4.3  
TPHA0C04540 Chr3 (977635..980451) [2817 bp, 938 aa] {ON}               31   4.5  
ZYRO0B03740g Chr2 complement(310042..313455) [3414 bp, 1137 aa] ...    31   4.5  
TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {...    31   4.8  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...    30   5.0  
SAKL0G19734g Chr7 complement(1700288..1701607) [1320 bp, 439 aa]...    30   5.2  
Smik_7.153 Chr7 (278458..279963) [1506 bp, 501 aa] {ON} YGL119W ...    30   5.4  
TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {O...    30   5.8  
Suva_8.374 Chr8 complement(659267..661693) [2427 bp, 808 aa] {ON...    30   5.8  
YGL108C Chr7 complement(303649..304071) [423 bp, 140 aa] {ON} Pr...    29   6.2  
KLTH0A04620g Chr1 (384810..385973) [1164 bp, 387 aa] {ON} some s...    30   6.7  
Smik_8.230 Chr8 (367278..368660) [1383 bp, 460 aa] {ON} YHR146W ...    30   7.0  
KLTH0H12078g Chr8 (1030928..1032382) [1455 bp, 484 aa] {ON} high...    30   7.1  
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    30   7.3  
CAGL0M13035g Chr13 complement(1284308..1286086) [1779 bp, 592 aa...    30   7.4  
KLTH0F09108g Chr6 complement(782647..784806) [2160 bp, 719 aa] {...    30   7.6  
NDAI0K01330 Chr11 complement(303660..305912) [2253 bp, 750 aa] {...    30   7.6  
NDAI0C02690 Chr3 (625861..628203) [2343 bp, 780 aa] {ON} Anc_6.3...    30   7.7  
Ecym_5517 Chr5 complement(1048887..1051745) [2859 bp, 952 aa] {O...    30   7.8  
ZYRO0D04554g Chr4 complement(379454..382483) [3030 bp, 1009 aa] ...    30   7.9  
NCAS0A09090 Chr1 (1798908..1799324) [417 bp, 138 aa] {ON} Anc_2....    29   8.3  
TDEL0C04510 Chr3 complement(813706..814332) [627 bp, 208 aa] {ON...    29   9.0  
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    30   9.1  
ZYRO0F03740g Chr6 complement(311378..313429) [2052 bp, 683 aa] {...    30   10.0 

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  473 bits (1218), Expect = e-171
 Identities = 241/257 (93%), Positives = 241/257 (93%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 541 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFXXXXXXXXXXXXXX 720
           KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAF              
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSSTN 240

Query: 721 XXAINGTTVLQVQPSSD 771
             AINGTTVLQVQPSSD
Sbjct: 241 KSAINGTTVLQVQPSSD 257

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  403 bits (1036), Expect = e-143
 Identities = 210/259 (81%), Positives = 223/259 (86%), Gaps = 2/259 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVV+VNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDI LRRKLRTVPGVPLIHLTRSVMIMEPLSTASAK S+ TEEQKL+KGLNDPN+EK E
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 541 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS-NETKGEDDAFXXXXXXXXXXXXX 717
            +S  S KES PKKRK GPKAPNPLS+KKKK + PS +E K +DDA              
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDASKDKKRRRRRHKSN 240

Query: 718 XXXAI-NGTTVLQVQPSSD 771
              +I +GT+V Q Q SSD
Sbjct: 241 ADDSIASGTSVAQGQASSD 259

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  391 bits (1005), Expect = e-138
 Identities = 194/225 (86%), Positives = 209/225 (92%), Gaps = 1/225 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVVD+NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAK SK TEE+KL+KGLNDPNV+K +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 541 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTS-QPSNETKGEDD 672
           ++S  SGKES  KKRK GPKAPNPLSVKKKK +   S+E +G++D
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKED 225

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  385 bits (990), Expect = e-136
 Identities = 192/225 (85%), Positives = 208/225 (92%), Gaps = 1/225 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVV+++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDI LRRKLRTVPGVPLIHLTRSVM+MEPLSTASAK SK TEEQKL+KGLNDPN+EK +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 541 KVSSESGKESAPKKRKIGPKAPNPLSV-KKKKTSQPSNETKGEDD 672
           +    SGKES  KKRK+GPKAPNPLSV KKKK + PS+E K ++D
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKED 225

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  308 bits (789), Expect = e-105
 Identities = 149/226 (65%), Positives = 183/226 (80%), Gaps = 2/226 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVE--K 534
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK SK+ E +KL+KGLNDP     K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 535 TEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDD 672
           T     +   +  PKK K GPK+PNPLS+KKKK     N     +D
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNREDSTED 226

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  302 bits (774), Expect = e-103
 Identities = 155/237 (65%), Positives = 188/237 (79%), Gaps = 12/237 (5%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPN----- 525
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ S++ E +KL+KGLNDP      
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 526 --VEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS-NET----KGEDDA 675
             V+K E V  +   +   KKRKIGPK PNPLS+KKKKT+  S NE     +G +DA
Sbjct: 181 SAVDK-ETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDA 236

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  300 bits (769), Expect = e-102
 Identities = 155/231 (67%), Positives = 184/231 (79%), Gaps = 7/231 (3%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 528
           SQDI +RR+LR VPGVPL+H++RSVMIMEPLS  SAK S + E++KL+KGLNDP      
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 529 --EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKK-KTSQPSNETKGEDD 672
             E+    +  SG+++A KKR  GPK PNPLSV+KK KT     +T   DD
Sbjct: 181 LDEEEATETQGSGEKTAKKKR--GPKGPNPLSVRKKVKTLNEPKQTDKNDD 229

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  295 bits (756), Expect = e-101
 Identities = 140/226 (61%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+VD+ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLND-PNVEKT 537
           SQD+ +RRKLR +PGVP++H++R+VMI+EPLS AS K S++ E+ KL+KGLND  +    
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 538 EKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
           ++  SE  ++++  K+  GPK PNPLS+KK+K+   SNE + E ++
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRKSKPASNEVEAETES 226

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  294 bits (752), Expect = e-100
 Identities = 144/219 (65%), Positives = 181/219 (82%), Gaps = 5/219 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVVDVNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 528
           +QD+ +RR+LR +PGVPL+++ RSVM+MEPLS AS K S++ EEQKL+KGLNDP      
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 529 -EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQ 642
            ++ ++  +E+ +E+ PKKRK GPK PNPLS+KKKKT++
Sbjct: 181 RDENDEAGAEN-QENKPKKRK-GPKEPNPLSMKKKKTTE 217

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  291 bits (746), Expect = 5e-99
 Identities = 146/225 (64%), Positives = 179/225 (79%), Gaps = 7/225 (3%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++V + + S F+L   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALY T N  AID+AK++ERRRCNH  KDPKSP ECIESVVD+ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP-----N 525
            Q+I LRRKLR VPGVPLIH++R+VMIMEPLS ASA+ SK+ E+QKLF GLND       
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 526 VEKTEKV--SSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNE 654
             +TEKV    +   E+ PKKRK+GPK PNPLS+KKKK    S +
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQ 225

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  288 bits (736), Expect = 7e-98
 Identities = 149/225 (66%), Positives = 174/225 (77%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDI  RR LR  PGVPL+H  RSVM+MEPLS ASAK S   E +KL KGLNDP   +  
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDP---RNA 177

Query: 541 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
            + +E+ + S  K+     K PNPLSVKK+KT     E+KGE  A
Sbjct: 178 GIKTENPQTSIKKR----TKQPNPLSVKKRKT-----ESKGEPKA 213

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  288 bits (736), Expect = 1e-97
 Identities = 149/228 (65%), Positives = 173/228 (75%), Gaps = 3/228 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VVDV G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVE--K 534
            QD+ +RR LR VPGVPL+H++RSVMIMEPLS ASAK S+  EE KLF+GLNDP     K
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 535 TEKVSSESGKE-SAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
            E    E  KE +  KKRKIGPK PNPLS+KKKK      E + E  A
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSA 228

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  286 bits (733), Expect = 1e-96
 Identities = 145/227 (63%), Positives = 184/227 (81%), Gaps = 5/227 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVV+VNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 531
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ ++ +E +KL KGLNDP    ++
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 532 KTEKVSSESGKESAP--KKRKIGPKAPNPLSVKKKKTSQPSNETKGE 666
            T  V +E   ES P  KKRK GPK PNPLSV+KK+  +P  + +G+
Sbjct: 181 TTPSVENELESESQPPAKKRK-GPKGPNPLSVRKKQ-KKPEQQGQGQ 225

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  283 bits (723), Expect = 1e-95
 Identities = 144/221 (65%), Positives = 175/221 (79%), Gaps = 4/221 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVV+ NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 531
           +QDI +RRKLR VPGVPLI++ RSVM+MEPLS AS + SK  EE+KLFKGLNDP    + 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 532 KTEKVS-SESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSN 651
             E V   +S K+  P K+K GPK PNPLSVK+K+  +  N
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREEN 221

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  281 bits (720), Expect = 4e-95
 Identities = 143/228 (62%), Positives = 175/228 (76%), Gaps = 4/228 (1%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 528
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   S+  E++KLFKGLNDP      
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 529 EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDD 672
            + E   +++G E +  KRK GPK PNPLS+KKKKT   S +     D
Sbjct: 181 AEEEGGKTDNGTEVSKNKRK-GPKGPNPLSIKKKKTVPDSKDESPPSD 227

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  273 bits (699), Expect = 4e-92
 Identities = 136/223 (60%), Positives = 177/223 (79%), Gaps = 5/223 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 540
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + S++ E+QKLFKGLNDP      
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 541 KVSSESG---KESAPKKRKIGPKAPNPLSVKKKKT--SQPSNE 654
           + S+ +G    E AP  ++ GPKAPNPLS+KK+K    QP+++
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSD 222

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  271 bits (692), Expect = 8e-91
 Identities = 140/227 (61%), Positives = 173/227 (76%), Gaps = 9/227 (3%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 531
           +Q+  +R  LR VPGVPL+ + RSVM+MEPLS AS   S+  E +KLFKGLNDP    + 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 532 KTEKVSSESG----KE--SAPKKRKIGPKAPNPLSVKKKKTSQPSNE 654
            TE+ ++ +     KE   AP K++ GPK PNPLS+KKKKTS+   E
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKE 227

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  269 bits (688), Expect = 3e-90
 Identities = 138/220 (62%), Positives = 173/220 (78%), Gaps = 6/220 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 180
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 360
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVVD+NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 361 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 528
           +QDI +RR LR VPGVPLI++ RSVM+MEPLS+ S + S++ E +KL KGLNDP      
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 529 EKTEKVSSESGKESAPK-KRKI-GPKAPNPLSVKKKKTSQ 642
             TE  S +     A + KRKI GPK PNPLS+KK + ++
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNK 219

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  268 bits (684), Expect = 1e-89
 Identities = 131/215 (60%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD-VKV 177
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 178 MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVV 357
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+V+++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 358 ASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKT 537
           A+Q++ LRRKLR VPGVP++HL+RSVMIMEP+S +S + ++K E+ KL+KGLNDP     
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 538 ----EKVSSESGKESAPKKRKIGPKAPNPLSVKKK 630
               E      G + A  K++ G K PNPLS KKK
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK 215

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  249 bits (635), Expect = 2e-82
 Identities = 124/227 (54%), Positives = 165/227 (72%), Gaps = 2/227 (0%)
 Frame = +1

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD--VK 174
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 175 VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYV 354
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+VDVNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 355 VASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEK 534
           VA+QD+ LRRKLR +PGVPLIH  RSVM+MEPLS AS + +++ E +KL  GLN      
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN------ 174

Query: 535 TEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
           + K S E G+E+  KK+K+  K  NPLS+KKK  S  ++ +    ++
Sbjct: 175 STKASVEGGQENGIKKKKV--KGVNPLSMKKKSNSNSNSNSNSNSNS 219

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 55.8 bits (133), Expect = 8e-09
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 55.5 bits (132), Expect = 1e-08
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       +L  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R N S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 38/141 (26%), Positives = 71/141 (50%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D+ L++++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDVGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 53.9 bits (128), Expect = 4e-08
 Identities = 39/148 (26%), Positives = 73/148 (49%), Gaps = 7/148 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    R PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           ++++R +PG+PL+ +     ++E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 53.5 bits (127), Expect = 5e-08
 Identities = 37/141 (26%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 53.5 bits (127), Expect = 5e-08
 Identities = 38/141 (26%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDAGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08
 Identities = 38/141 (26%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R N S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAALKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08
 Identities = 37/141 (26%), Positives = 71/141 (50%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCI-----VHRVLQHKCYIVATNDAGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08
 Identities = 38/141 (26%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDAGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.8 bits (125), Expect = 9e-08
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OFF}
           [contig 185] FULL
          Length = 51

 Score = 49.3 bits (116), Expect = 1e-07
 Identities = 26/50 (52%), Positives = 29/50 (58%)
 Frame = -2

Query: 203 ACIQHCVIITFTSACNVLFNPLGRLKLEPLHSDTS*LSTRTWYGSRNLKV 54
           A +QHCVI+  TSAC V   P  R       S T   STRTWYGS NLK+
Sbjct: 2   AWMQHCVIMGLTSACRVRLRPFTRSNAALCVSHTIWSSTRTWYGSLNLKL 51

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 52.4 bits (124), Expect = 1e-07
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 7/148 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 52.0 bits (123), Expect = 2e-07
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 52.0 bits (123), Expect = 2e-07
 Identities = 38/141 (26%), Positives = 69/141 (48%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L +      R PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +CI     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-DCI-----VNRVLQHKCYIVATNDQGLKQRV 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 51.6 bits (122), Expect = 2e-07
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 7/145 (4%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYE-- 213
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 214 TRNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 378
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ ++VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 379 RRKLRTVPGVPLIHLTRSVMIMEPL 453
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 50.4 bits (119), Expect = 6e-07
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = +1

Query: 40  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 216
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 217 -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 390
            +   A+ LA+    +R + S K   +  +C+     V+   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-DCL-----VHRVLQHKCYIVATNDAGLKQRI 164

Query: 391 RTVPGVPLIHLTRSVMIMEPL 453
           R +PG+PL+ +     ++E L
Sbjct: 165 RKIPGIPLMSVGGHAYVIEKL 185

>KNAG0C00550 Chr3 (92890..96084) [3195 bp, 1064 aa] {ON} Anc_1.88
           YGR047C
          Length = 1064

 Score = 38.5 bits (88), Expect = 0.016
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 15/81 (18%)
 Frame = +1

Query: 469 KESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPK----KRKIGPK--APNPL----- 615
           KE++K +E++L+K L +P  ++TE+  +  GKE  P+    +   GPK  +  PL     
Sbjct: 577 KEARKKQEEELYKKLENPLADRTEEKETRKGKEMEPEEEFDEENTGPKDISTKPLLEDSM 636

Query: 616 ----SVKKKKTSQPSNETKGE 666
                 K+KKT Q     K E
Sbjct: 637 FRQFHGKRKKTPQDIEREKVE 657

>KNAG0B06670 Chr2 (1314289..1318023) [3735 bp, 1244 aa] {ON} 
          Length = 1244

 Score = 35.8 bits (81), Expect = 0.12
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +1

Query: 448 PLSTASAKESKKTE----EQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPL 615
           P S    K+SKK +     +K  K   D +   TEK S +    S+ +K+K   K  +P 
Sbjct: 73  PGSAEKKKKSKKEDGAEGTEKKKKSKKDDSFSSTEKKSKKDDSPSSTEKKKKSKKDDSPS 132

Query: 616 SVKKKKTSQ 642
           S +KKK S+
Sbjct: 133 STEKKKKSK 141

 Score = 33.5 bits (75), Expect = 0.64
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 5/68 (7%)
 Frame = +1

Query: 481 KTEEQKLFKGLNDPNVEKTEKVSSESGKESAP-----KKRKIGPKAPNPLSVKKKKTSQP 645
           K E++K  K   +   E  EK  S+  K+ +P     KK+   PK  +P S +KKK S+ 
Sbjct: 25  KGEKKKKSKKPKEDGAEGAEKKKSKKPKDDSPGSAEKKKKSKKPKDDSPGSAEKKKKSKK 84

Query: 646 SNETKGED 669
            +  +G +
Sbjct: 85  EDGAEGTE 92

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +1

Query: 457 TASAKESKKTEE----QKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVK 624
           T   K+SKK +     +K  K  + P+  + +K S +    S+ +K+K   K  +P S +
Sbjct: 91  TEKKKKSKKDDSFSSTEKKSKKDDSPSSTEKKKKSKKDDSPSSTEKKKKSKKDDSPSSTE 150

Query: 625 KKKTSQPSNETKGE 666
           KKK S+  +++KG+
Sbjct: 151 KKKKSK--SKSKGD 162

>CAGL0L09933g Chr12 (1069785..1071011) [1227 bp, 408 aa] {ON}
           similar to uniprot|Q08412 Saccharomyces cerevisiae
           YOR042w
          Length = 408

 Score = 35.4 bits (80), Expect = 0.13
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +1

Query: 454 STASAKESKK-TEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKK 630
           S A + +SKK +EE K  +G  D  V +T  + +   KE    KRK  P  P PL+    
Sbjct: 326 SRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTPENKEKT--KRKWQPLPPEPLNATPT 383

Query: 631 KTSQPSNETKGEDD 672
           K +  + + K E +
Sbjct: 384 KVNASTKKNKNESE 397

>KNAG0I01310 Chr9 complement(253551..254993) [1443 bp, 480 aa] {ON}
           Anc_1.397 YLR175W
          Length = 480

 Score = 35.4 bits (80), Expect = 0.13
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = +1

Query: 472 ESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSN 651
           ESKK EE+K+ K        K +K   E  ++ A KK K   K  +    KK+K  +   
Sbjct: 411 ESKKPEEEKVEK--------KEKKEKKEKKEDKAEKKEKKEKKDKDEKKEKKEKKEKKEK 462

Query: 652 ETKGEDD 672
           + K EDD
Sbjct: 463 KRKAEDD 469

>Smik_9.43 Chr9 (95836..99915) [4080 bp, 1359 aa] {ON} YIL126W (REAL)
          Length = 1359

 Score = 35.0 bits (79), Expect = 0.21
 Identities = 50/197 (25%), Positives = 78/197 (39%), Gaps = 8/197 (4%)
 Frame = +1

Query: 85   LVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCC-----IQALYETRNEGAIDLAKQ 249
            L + Q +      N +L   +K+  QA  K  + Q       I+ L  T +     LA  
Sbjct: 1063 LTEEQFLEAVEDENMSLEDAIKKRRQAREKRRLRQNGTKENEIETLENTPDASETSLAD- 1121

Query: 250  FERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTR 429
                  N SF+          ++ D  GAN+   V  S+    RRK             R
Sbjct: 1122 ------NDSFRT---------NIDDEAGANQESTVSPSKRRSSRRK-------------R 1153

Query: 430  SVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSE---SGKESAPKKRKIGPK 600
            ++ I+      +A++ +  EE+ + K   D  VE+ +K SS    +G ES  KK K+  K
Sbjct: 1154 TIAIV------AAEDKENVEEESVPKENGDAKVEEEQKSSSVEIINGSESKKKKTKLTVK 1207

Query: 601  APNPLSVKKKKTSQPSN 651
                  +K KKT+   N
Sbjct: 1208 ------IKLKKTAVSDN 1218

>ZYRO0D03476g Chr4 complement(286629..288101) [1473 bp, 490 aa] {ON}
           similar to gnl|GLV|CAGL0L05522g Candida glabrata
           CAGL0L05522g and weakly similar to YJL123C
           uniprot|P47018 Saccharomyces cerevisiae YJL123C
           Hypothetical ORF
          Length = 490

 Score = 34.3 bits (77), Expect = 0.31
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)
 Frame = +1

Query: 466 AKESKKTEEQKLFKGLNDPNVE---KTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKT 636
           A+E KK E  K+     +P+ E   K E    E+ K+  PK+  +  +AP     KK++ 
Sbjct: 68  AQEKKKEEISKMKPSKEEPSKEEPPKEEPPKEEAPKQELPKQEPLKEEAPKQEPPKKEQP 127

Query: 637 SQ-PSNETKG 663
            + P  E+KG
Sbjct: 128 KEVPPKESKG 137

>ZYRO0F17226g Chr6 (1434400..1435299) [900 bp, 299 aa] {ON} weakly
           similar to uniprot|Q07057 Saccharomyces cerevisiae
           YLR181C VTA1 Protein involved in endosomal protein
           sorting binds to Vps20 and Vps4 and may regulate
           Vps4function has coiled-coil domains mutants show class
           E vacuolar-protein sorting defects
          Length = 299

 Score = 33.9 bits (76), Expect = 0.35
 Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 2/120 (1%)
 Frame = +1

Query: 301 ECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESK 480
           +C+  V  +    K R       I+LR+  R  P VP +       ++E L+T S +E+ 
Sbjct: 125 QCMSKVWGMQNELKDRIKYCK--IYLRKIAREKPPVPQVDDKELDEMLEKLNTESKEENS 182

Query: 481 KTE--EQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNE 654
                ++   +G   P VE +E    E     AP      PK P P   + +K ++PS++
Sbjct: 183 PPAFIDESEERGSEGPTVEDSEP---EPNPAPAPAPE---PKIPEPNMPEPEKATEPSHK 236

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 33.9 bits (76), Expect = 0.47
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +1

Query: 439 IMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLS 618
           +++PL +    + K   + K     N P+ EK  K    S KES+   ++   ++P+ LS
Sbjct: 683 VVQPLESKHKHKYKHRSKHKHNDSKNSPSEEKGRKKLFSSSKESSAGSKE-SKRSPSELS 741

Query: 619 VKKKKTSQP-SNETKGEDDAF 678
            K  K+  P SN  K +  AF
Sbjct: 742 QKPTKSILPRSNAKKQQTSAF 762

>NDAI0J02830 Chr10 (703072..704358) [1287 bp, 428 aa] {ON} Anc_4.342
          Length = 428

 Score = 33.5 bits (75), Expect = 0.53
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +1

Query: 463 SAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQ 642
           S  ++KK ++ K+     +P  +K +KV  +   E  P K+K  PK     S  KK+  Q
Sbjct: 261 SQNKNKKAKKDKV----EEPVSKKVKKVEFKKDLEEGPTKKKQEPKQKKQESKPKKEEPQ 316

Query: 643 PSNET 657
           P   T
Sbjct: 317 PKKRT 321

>NDAI0B04620 Chr2 (1147583..1149748) [2166 bp, 721 aa] {ON}
           Anc_1.348 YFR029W
          Length = 721

 Score = 33.1 bits (74), Expect = 0.80
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +1

Query: 358 ASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKT 537
           + Q+  L++    +P +  + +T++V I +   +++   + KT EQKL K  N  N    
Sbjct: 211 SQQERKLQKGGNDLPVLDTVSVTKTVPISQDNKSSTISITTKTVEQKLNKNNNGNNNHTI 270

Query: 538 EKVSSES 558
           EKVSS +
Sbjct: 271 EKVSSNT 277

>Smik_15.164 Chr15 complement(280356..282665) [2310 bp, 769 aa] {ON}
           YOL006C (REAL)
          Length = 769

 Score = 33.1 bits (74), Expect = 0.80
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 3/81 (3%)
 Frame = +1

Query: 445 EPLSTASAKESKKTEEQKLFKGLNDPNVE---KTEKVSSESGKESAPKKRKIGPKAPNPL 615
           E +ST S K++KK + ++L    + P+ +   +T     +  KE    K K   K     
Sbjct: 51  EAISTISKKKTKKIKTERLPSSSSPPSPQVKKRTTPKPKKIKKEDGDVKLKTTKKEDQEK 110

Query: 616 SVKKKKTSQPSNETKGEDDAF 678
             +KKK  +   + K E+D +
Sbjct: 111 KKRKKKEDEEDQKVKDEEDEY 131

>ZYRO0E07920g Chr5 complement(618222..619082) [861 bp, 286 aa] {ON}
           similar to uniprot|P09064 Saccharomyces cerevisiae
           YPL237W SUI3 Beta subunit of the translation initiation
           factor eIF2 involved in the identification of the start
           codon
          Length = 286

 Score = 32.7 bits (73), Expect = 0.81
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 568 SAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAF 678
           S  KK+K    AP  L V+ K+T + S+ + GEDD F
Sbjct: 14  SLKKKKKSKKVAPENLEVEDKETEKSSSNSTGEDDLF 50

>YOR322C Chr15 complement(918606..921062) [2457 bp, 818 aa] {ON}
           LDB19Protein involved in regulating the endocytosis of
           plasma membrane proteins by recruiting the ubiquitin
           ligase Rsp5p to its target; inhibited by Npr1p-mediated
           phosphorylation, which affects translocation between the
           cytosol and the plasma membrane; null mutant has reduced
           affinity for alcian blue dye
          Length = 818

 Score = 33.1 bits (74), Expect = 0.81
 Identities = 29/154 (18%), Positives = 66/154 (42%), Gaps = 2/154 (1%)
 Frame = +1

Query: 220 NEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTV 399
           N G I+L  + +    N    +P   A  +++    N           QD +L   +  +
Sbjct: 491 NNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHI 550

Query: 400 PGVPLIHLTRSVMIM--EPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESA 573
             V ++    ++     +P+   ++K  K+T    +   +++P+ ++  ++S      + 
Sbjct: 551 LAVEIVVAEETLQYANGQPIRKPNSKNKKETNNNTM--NVHNPD-QRLAELSPIFANRNT 607

Query: 574 PKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
           PK R++GP+   P  V   K++  +N+ K  + A
Sbjct: 608 PKVRRMGPEDITP--VNSNKSNHSTNKEKASNGA 639

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 33.1 bits (74), Expect = 0.83
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 2/141 (1%)
 Frame = +1

Query: 253 ERRRCNHSFKDPKSPAECIESVVDV--NGANKHRYVVASQDIHLRRKLRTVPGVPLIHLT 426
           ER R      D +S  + ++  V    N AN+   ++ S++  LR+          +   
Sbjct: 228 ERERIERKLNDSESKLKTMKGQVHELENSANRKSSLLESKENELRK----------VKDQ 277

Query: 427 RSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAP 606
              +  +  +T S  +SKK E +KL   LN+   +  EK S    KES  K      K  
Sbjct: 278 LKELENKADATCSQLDSKKNELRKLTDQLNELENQANEKDSQLKSKESELK------KLT 331

Query: 607 NPLSVKKKKTSQPSNETKGED 669
           N L+  + K +Q  +++  ++
Sbjct: 332 NQLNELENKVNQNGSQSSAKE 352

>Smik_12.236 Chr12 (453255..454718) [1464 bp, 487 aa] {ON} YLR175W
           (REAL)
          Length = 487

 Score = 32.7 bits (73), Expect = 0.98
 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 17/86 (19%)
 Frame = +1

Query: 454 STASAKESKKTEEQ---------KLFKGL--------NDPNVEKTEKVSSESGKESAPKK 582
           ST+   E+KKTEE+          L K +         D   EK EK   +  KE   KK
Sbjct: 395 STSGTHETKKTEEEPKKTKEEADSLIKEVETEKEEAKEDDKKEKKEKKDKKEKKEKKDKK 454

Query: 583 RKIGPKAPNPLSVKKKKTSQPSNETK 660
            K   K       KK+K+    +E K
Sbjct: 455 EKKDKKEKKDKKEKKRKSEDAESEEK 480

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 32.7 bits (73), Expect = 1.0
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +1

Query: 445 EPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVK 624
           +P+S+   KE KK +EQ   +   + +VEK ++ S+ + KE+  ++R +   +  P S+ 
Sbjct: 419 KPVSSTPLKEEKKAQEQ--IEKPVERSVEKPDEKSTVTEKEATNEQRNVSTASQKPSSIN 476

Query: 625 KKKTSQPS 648
               S  S
Sbjct: 477 TSLKSDDS 484

>ZYRO0D03916g Chr4 (317703..320099) [2397 bp, 798 aa] {ON} similar
           to uniprot|P07261 Saccharomyces cerevisiae YPL075W GCR1
           Transcriptional activator of genes involved in
           glycolysis functions and interacts with Gcr2p
          Length = 798

 Score = 32.7 bits (73), Expect = 1.1
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
 Frame = +1

Query: 508 GLNDPNVEKTEKVSSESGKESAPKKRK-IGPKA----PNPLSVKKKKTSQPSNETKGEDD 672
           G ++PN E  E  S E G++      K + PK+    P P+S ++  +S P N + G ++
Sbjct: 574 GADEPNEEAEEDASEEDGRDDENDDSKALSPKSSEARPRPVSSQQVPSSNPDNTSSGPNN 633

>Ecym_4112 Chr4 complement(232757..235252) [2496 bp, 831 aa] {ON}
           similar to Ashbya gossypii AER303W
          Length = 831

 Score = 32.7 bits (73), Expect = 1.1
 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 8/66 (12%)
 Frame = +1

Query: 469 KESKKT-EEQKLFKGLNDPNVEKTE---KVSSESGKESAPKKRKIGP----KAPNPLSVK 624
           K SKK  E+Q L K   +P V +T+    V  +S   S PKK+  G     KA    + K
Sbjct: 329 KASKKVSEQQSLRKVATNPTVRRTKTAANVGKQSATTSTPKKQLNGKDHNGKAEKQTAKK 388

Query: 625 KKKTSQ 642
           KKKT +
Sbjct: 389 KKKTEE 394

>KAFR0J01000 Chr10 (181394..182629) [1236 bp, 411 aa] {ON} Anc_5.203
           YLR018C
          Length = 411

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 11/77 (14%)
 Frame = +1

Query: 367 DIHLRRKLRTVPGVPLIHLTR---SVMIMEP--LSTASAKESKKTEEQK------LFKGL 513
           DI+L  K RT+ G+    +T+   +  IM+P  + T  +K SK    Q       +FK L
Sbjct: 268 DINLNEKQRTLLGLNAASITQQNHATPIMKPHIVKTVPSKSSKVQPSQSVPSTPLIFKSL 327

Query: 514 NDPNVEKTEKVSSESGK 564
             P   + EK+  ES K
Sbjct: 328 KTPMKSRQEKIKLESTK 344

>ZYRO0F10494g Chr6 complement(852619..853944) [1326 bp, 441 aa] {ON}
           similar to uniprot|P19262 Saccharomyces cerevisiae
           YDR148C KGD2 Dihydrolipoyl transsuccinylase a component
           of the mitochondrial alpha-ketoglutarate dehydrogenase
           complex which catalyzes a step in the tricarboxylic acid
           (TCA) cycle the oxidative decarboxylation of alpha-
           ketoglutarate to succinyl-CoA
          Length = 441

 Score = 32.3 bits (72), Expect = 1.3
 Identities = 23/67 (34%), Positives = 28/67 (41%)
 Frame = +1

Query: 460 ASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTS 639
           A  +E K  E +K       P   K E    E+ K +APKK    PK P P     K TS
Sbjct: 151 APKEEPKPEEPKKEEPAAAAPPPPKPEAPKKEAPKPAAPKKE--APKKPEPAPQAPKTTS 208

Query: 640 QPSNETK 660
              NE +
Sbjct: 209 FSRNEER 215

>Suva_8.383 Chr8 complement(685690..686406) [717 bp, 238 aa] {ON} 
           (NOVEL)
          Length = 238

 Score = 32.0 bits (71), Expect = 1.3
 Identities = 21/82 (25%), Positives = 36/82 (43%)
 Frame = +1

Query: 415 IHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIG 594
           + L+  V++M P      K+ KK +++K  K       +K +K   +  K+   KK+K  
Sbjct: 32  VTLSPIVLLMLPKKKNLKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 91

Query: 595 PKAPNPLSVKKKKTSQPSNETK 660
            K       KKKK  +   + K
Sbjct: 92  KKKKKKKKKKKKKKKKKKKKKK 113

 Score = 29.6 bits (65), Expect = 7.3
 Identities = 20/89 (22%), Positives = 37/89 (41%)
 Frame = +1

Query: 394 TVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESA 573
           T+  + L+ L +   + +       K+ KK +++K  K       +K +K   +  K+  
Sbjct: 33  TLSPIVLLMLPKKKNLKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 92

Query: 574 PKKRKIGPKAPNPLSVKKKKTSQPSNETK 660
            KK+K   K       KKKK  +   + K
Sbjct: 93  KKKKKKKKKKKKKKKKKKKKKKKKKKKKK 121

>Kpol_543.34 s543 (75894..77843) [1950 bp, 649 aa] {ON}
           (75894..77843) [1950 nt, 650 aa]
          Length = 649

 Score = 32.3 bits (72), Expect = 1.4
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 5/91 (5%)
 Frame = +1

Query: 334 ANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESK-----KTEEQK 498
           AN  R V     ++ ++K  TVPG+P        M  +   TA+    K     K E+ +
Sbjct: 521 ANGTRKVPGMTIVNAKQKTNTVPGIP-------GMAPKESKTAAKNRKKRNNKTKQEDSE 573

Query: 499 LFKGLNDPNVEKTEKVSSESGKESAPKKRKI 591
           + +   +P  E  E V++   KE++P+++KI
Sbjct: 574 IKETSAEPGTENKEPVAN---KETSPEEKKI 601

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 32.0 bits (71), Expect = 1.5
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 17/146 (11%)
 Frame = +1

Query: 286 PKSPAECIE-SVVDVNGANKHRYVVASQDIHLRR-----KLRTVPGVPLIHLTRSVMIME 447
           P++P   ++ S  +V+  N  R  +AS+D +  +     K + V G    H+   VM+ +
Sbjct: 22  PRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNLKQQLVQG----HVGGGVMVGQ 77

Query: 448 PLSTASAKES--KKTEEQKLFK-----GLNDPNVEKTE----KVSSESGKESAPKKRKIG 594
             S   A  S  K   + KL K     G+N P++ KT+    K +S+  +++  +     
Sbjct: 78  NKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDASDGSQDNGEESDDYD 137

Query: 595 PKAPNPLSVKKKKTSQPSNETKGEDD 672
            +  NPL+ K +       E + EDD
Sbjct: 138 DEEGNPLAAKLRSRLTSGVEDENEDD 163

>NCAS0C00860 Chr3 complement(150659..151342) [684 bp, 227 aa] {ON}
           Anc_8.764 YMR233W
          Length = 227

 Score = 31.6 bits (70), Expect = 1.7
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +1

Query: 478 KKTEEQKLFK-GLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNE 654
           K+ +E +L K   +  + +K+    +E GKE   K+++   +  N +S KK   S+P  +
Sbjct: 96  KEADESRLRKKSRSTTSKKKSSPKVTEDGKEKKKKRKRKDAEGSNSISAKKYVLSEPLQQ 155

Query: 655 TKGEDD 672
             GE +
Sbjct: 156 LIGEKE 161

>NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {ON}
           Anc_1.397 YLR175W
          Length = 475

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +1

Query: 469 KESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKK 630
           +E+KK +E+K  K       EK EK   +  KE   KKRK   +       KKK
Sbjct: 419 EETKKEDEEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKRKADDEGETEEKKKKK 472

>CAGL0H06985g Chr8 (691854..694490) [2637 bp, 878 aa] {ON} similar to
            uniprot|Q04500 Saccharomyces cerevisiae YML093w YMJ3
          Length = 878

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 42/204 (20%), Positives = 78/204 (38%), Gaps = 11/204 (5%)
 Frame = +1

Query: 94   NQLVSECSGSNFNLPSGLKRTLQADVKV----------MITQCCIQALYETRNEGAIDLA 243
            ++++   SG + N  S +++  + D+ V          M      +A  +  N+  I+  
Sbjct: 477  DKIIDRQSGDSDNNISDIEQDSEQDIDVEKVGKTGVMNMAFMKNAEAREKAENKQFIEKL 536

Query: 244  KQFERRRCNHSFK-DPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIH 420
            ++FE+   +  F+ D + P   IE    V   NK R   A  D+ +R +           
Sbjct: 537  REFEKTGDDDLFESDDEKPV--IEGKDTVTSINKGRRTYAPGDLEMRHE----------- 583

Query: 421  LTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPK 600
                   M+ +     KE +  E + L   L   N    E++     +   PK+ K  PK
Sbjct: 584  -------MKKIKEEVRKEKEIDESRTLVNRLKRRNENNEEEIIDVVEEVVPPKEEKTAPK 636

Query: 601  APNPLSVKKKKTSQPSNETKGEDD 672
                 S  K ++S P  +   ++D
Sbjct: 637  -----SKTKSESSNPWLDGSDDED 655

>KLLA0A04730g Chr1 complement(421863..424928) [3066 bp, 1021 aa]
           {ON} some similarities with uniprot|P39935 Saccharomyces
           cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4)
           gamma mRNA cap-binding protein (eIF-4F) 150K subunit
           highly homologous to Tif4632p homologs of mammalian p220
          Length = 1021

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 4/80 (5%)
 Frame = +1

Query: 445 EPLSTASAK-ESKKTEEQKLFKGLNDPNVE---KTEKVSSESGKESAPKKRKIGPKAPNP 612
           E L T  +K E  KTEE K  +   +       KTE+  SE  K   PK  +   + P P
Sbjct: 327 EELKTEESKPEETKTEELKTEESKPEETKTEELKTEETKSEELKTEEPKAEESKAEEPKP 386

Query: 613 LSVKKKKTSQPSNETKGEDD 672
              ++ KT +P+ E    D+
Sbjct: 387 ---EEPKTEEPTTEQPKSDE 403

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 31.6 bits (70), Expect = 2.3
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +1

Query: 424 TRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKT--EKVSSESGKESAPKKRKIGP 597
           TRS+M    L  A  K+SK  + + +   L D  + K   +  + ++GKES  +    G 
Sbjct: 31  TRSLMYSHRL-LAEEKDSKSKDAKSI---LTDDMLFKAGVDLDAKDAGKESKEETTSAGE 86

Query: 598 KAPN-PLSVKKKKTSQPSNETKGE 666
            A + P+S KKKK  Q S + K E
Sbjct: 87  TASSDPVSPKKKKKRQSSTDIKRE 110

>AAL007C Chr1 complement(328643..330100) [1458 bp, 485 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR175W
           (CBF5)
          Length = 485

 Score = 31.6 bits (70), Expect = 2.3
 Identities = 22/65 (33%), Positives = 27/65 (41%)
 Frame = +1

Query: 448 PLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKK 627
           P       E KK +++K  K       EK EK      KE   KKRK   +  N    KK
Sbjct: 422 PAEKKQDDEEKKEKKEKKEKSEKKEKKEKKEKSEKSEKKEKKEKKRKADDE--NASEEKK 479

Query: 628 KKTSQ 642
           KK S+
Sbjct: 480 KKKSK 484

>CAGL0L11418g Chr12 (1213420..1215114) [1695 bp, 564 aa] {ON}
           similar to uniprot|Q04632 Saccharomyces cerevisiae
           YML071c
          Length = 564

 Score = 31.6 bits (70), Expect = 2.4
 Identities = 21/69 (30%), Positives = 32/69 (46%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 633
           ST + +ESK+T EQ            +  K SSE  KES+ + ++           + K 
Sbjct: 394 STEAEEESKETSEQSKESSEQSKESSEQSKESSEQSKESSEQSKE---------GKQDKN 444

Query: 634 TSQPSNETK 660
           +S+ SNE K
Sbjct: 445 SSEQSNEDK 453

>SAKL0C10758g Chr3 (976369..978489) [2121 bp, 706 aa] {ON} some
           similarities with uniprot|P38213 Saccharomyces
           cerevisiae YBR007C DSF2
          Length = 706

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +1

Query: 424 TRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKA 603
           T S+ I E  S ASA  S      K     +  N+ K+ KV+SE+GK  +PKK  + P  
Sbjct: 302 TTSLSIPESQSPASASSSSFAMGHKKKSSFSLKNLFKSPKVTSEAGK--SPKKYHV-PSV 358

Query: 604 PN--PLSVKKKKTSQP 645
            N  P+SV     + P
Sbjct: 359 ENTPPVSVGSSTFAYP 374

>Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}
            YOL145C (REAL)
          Length = 1083

 Score = 31.6 bits (70), Expect = 2.6
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 5/72 (6%)
 Frame = +1

Query: 472  ESKKTEEQKLFKGLNDPNVEKTEKVS---SESGKESAPKKRKIGPKAPNPLSVKKKKTSQ 642
            E++K  +++    ++D NV+    +S   +E  +E + +KRK   KA N    K++KT++
Sbjct: 953  EAQKLIQEREAMAISDHNVKDDSDLSDNDNEYDEEKSKQKRKRSTKAKNDGGPKRRKTTK 1012

Query: 643  P--SNETKGEDD 672
               S+  + EDD
Sbjct: 1013 KVVSDSDEDEDD 1024

>Kpol_1023.62 s1023 complement(138899..143422) [4524 bp, 1507 aa]
           {ON} complement(138899..143422) [4524 nt, 1508 aa]
          Length = 1507

 Score = 31.6 bits (70), Expect = 2.6
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 8/92 (8%)
 Frame = +1

Query: 382 RKLRTVPGVPLIHLTR-SVMIMEPLSTASAKESKKT-------EEQKLFKGLNDPNVEKT 537
           +K R  P  P I L   S+    P  + +  +SKK         + K  K   +P + KT
Sbjct: 461 KKKRIQPSKPSIELKEPSIKPSVPSKSTTKTKSKKVITKEPKPRKLKEHKESKEPKIPKT 520

Query: 538 EKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 633
            K +  +     PK  K+   +  P SVKK K
Sbjct: 521 PKTTKATKIPKVPKSPKLVKVSKVPKSVKKTK 552

>TDEL0A02340 Chr1 complement(421990..423060) [1071 bp, 356 aa] {ON}
           Anc_2.458 YKL114C
          Length = 356

 Score = 31.2 bits (69), Expect = 2.8
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 6/85 (7%)
 Frame = +1

Query: 418 HLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPN------VEKTEKVSSESGKESAPK 579
           HL    +I+E   T   KE    EE KL + L D +      +EK +K+ ++  K     
Sbjct: 262 HLVNIPIILE---TPQPKEEGYGEEIKLLEWLEDKSEDDKEVIEKNDKLQAKGAKSRKEH 318

Query: 580 KRKIGPKAPNPLSVKKKKTSQPSNE 654
           + K   K     + K+K   +P ++
Sbjct: 319 EEKFATKQKKATAKKRKAEVKPEDD 343

>Smik_10.85 Chr10 (138253..138960) [708 bp, 235 aa] {ON} YJL148W
           (REAL)
          Length = 235

 Score = 30.8 bits (68), Expect = 3.1
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +1

Query: 418 HLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRK 588
           H+T++VM  E       KESKK   Q   +G ++   +K EK   +  K+   KK+K
Sbjct: 181 HVTKNVMTKE-----DKKESKKRSHQHEDEGESNEKKKKKEKKEKKVKKDKKDKKKK 232

>Kpol_1028.105 s1028 complement(231216..232001) [786 bp, 261 aa]
           {ON} complement(231216..232001) [786 nt, 262 aa]
          Length = 261

 Score = 30.8 bits (68), Expect = 3.2
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 3/77 (3%)
 Frame = +1

Query: 451 LSTASAKESKKTEEQKLFKGLNDPNV---EKTEKVSSESGKESAPKKRKIGPKAPNPLSV 621
           +S    ++  +T  + L KG N       ++T K SS+   E+  KKR+     PN ++V
Sbjct: 66  ISKDELRKKDETIAKNLQKGANGTTTVSKKRTIKKSSKGKDETKKKKRRQTEANPNSINV 125

Query: 622 KKKKTSQPSNETKGEDD 672
           +K   S    E  GE +
Sbjct: 126 RKVLLSPKLQEFLGETE 142

>KLTH0H02464g Chr8 (220805..223228) [2424 bp, 807 aa] {ON} similar
           to uniprot|Q12018 Saccharomyces cerevisiae YDL132W CDC53
           Cullin structural protein of SCF complexes (which also
           contain Skp1p Cdc34p and an F-box protein) involved in
           ubiquitination SCF promotes the G1-S transition by
           targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for
           degradation
          Length = 807

 Score = 31.2 bits (69), Expect = 3.3
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +1

Query: 421 LTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPK 600
           + R ++++  L+ A  +  KKT EQ++ + L     E   K+S  + + +  KK   GP 
Sbjct: 319 MQRDILLLPKLAQAYEEYVKKTGEQEISRLL----AEHRAKLSENAEENAGSKKSAAGPA 374

Query: 601 APNPLSVKK 627
            P    VKK
Sbjct: 375 VPPNEYVKK 383

>CAGL0M12144g Chr13 (1212803..1215718) [2916 bp, 971 aa] {ON} highly
           similar to uniprot|P39730 Saccharomyces cerevisiae
           YAL035w FUN12
          Length = 971

 Score = 31.2 bits (69), Expect = 3.4
 Identities = 16/65 (24%), Positives = 34/65 (52%)
 Frame = +1

Query: 460 ASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTS 639
           A+ K+SKK +E+++ K  + P ++  ++   E  ++   KK++   K       +K+K  
Sbjct: 56  ATLKKSKKKQEEEVKKDADKPVLKSKKEKEKEKKEKEKQKKKEQAAKKKAQQQAQKEKNK 115

Query: 640 QPSNE 654
           Q + E
Sbjct: 116 QLNKE 120

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 31.2 bits (69), Expect = 3.4
 Identities = 24/97 (24%), Positives = 43/97 (44%)
 Frame = +1

Query: 211 ETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKL 390
           E + +  ID++   E     H  + P      I + ++    N +   V   +I LRR+ 
Sbjct: 607 ELKKQIEIDIS-DLEHELSKHKEEKPDGNIRSISAPMESEEKNINHLEVDIDNI-LRRRN 664

Query: 391 RTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKL 501
            ++   P+  L   +M   P+   SA E K+TE ++L
Sbjct: 665 FSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERL 701

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score = 31.2 bits (69), Expect = 3.6
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +1

Query: 487  EEQKLFKGLNDPNVEKTEKVSSESGKESAP-KKRKIGPKAPNPLSVKKKKTSQPSNET 657
            EE++ +    D   EKT+KV++   KES P K     P  P  LS     T   S +T
Sbjct: 1299 EEEEEYTDTEDMKNEKTKKVTATKSKESTPVKTSPAAPPMPEFLSGDTVSTEPESEKT 1356

>Skud_4.407 Chr4 complement(725275..726648) [1374 bp, 457 aa] {ON}
           YDR148C (REAL)
          Length = 457

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 19/75 (25%), Positives = 37/75 (49%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 633
           ++A      KTE ++  + + +   ++T K  +   KE+APKK    PK     + ++KK
Sbjct: 152 ASAEGSAVPKTESKEQTEPVQEAAPKETPKQETAPKKEAAPKKEASEPKK----TPEQKK 207

Query: 634 TSQPSNETKGEDDAF 678
           T+  +N      ++F
Sbjct: 208 TTPKANVASAASNSF 222

>YHR146W Chr8 (390300..391697) [1398 bp, 465 aa] {ON}  CRP1Protein
           that binds to cruciform DNA structures
          Length = 465

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 6/67 (8%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKE------SAPKKRKIGPKAPNPL 615
           + +  KE KK +E    KG  +    +T K    S KE       APKK+   P + +  
Sbjct: 392 AVSEEKEKKKKQE----KGSKEVKRSETSKEKKPSAKEVKKQTVKAPKKQTASPLSSSTE 447

Query: 616 SVKKKKT 636
             KKKKT
Sbjct: 448 EPKKKKT 454

>TPHA0B03820 Chr2 (902102..903538) [1437 bp, 478 aa] {ON} Anc_1.397
           YLR175W
          Length = 478

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 25/78 (32%), Positives = 33/78 (42%)
 Frame = +1

Query: 409 PLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRK 588
           PLI       + +       KE KK +++K  K       EK EK   +  KE   KKRK
Sbjct: 406 PLIKEVEKKEVKKEEKKEEKKEDKKEKKEKKEK---KEKKEKKEKKEKKEKKEKKEKKRK 462

Query: 589 IGPKAPNPLSVKKKKTSQ 642
               + N    KKKK S+
Sbjct: 463 AEDNSEN--DDKKKKKSE 478

>NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON}
           Anc_1.397 YLR175W
          Length = 483

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 23/78 (29%), Positives = 29/78 (37%), Gaps = 14/78 (17%)
 Frame = +1

Query: 451 LSTASAKESKKTEEQKLFKGLNDPNV--------------EKTEKVSSESGKESAPKKRK 588
           +    +KE KK EE+   K  ND                 +K EK   +  KE   KKRK
Sbjct: 405 IKEVESKEEKKQEEESKEKESNDEETKVEKKEKKDKKEKKDKKEKKEKKDKKEKKEKKRK 464

Query: 589 IGPKAPNPLSVKKKKTSQ 642
                      KKKK S+
Sbjct: 465 ADEDGEGEGEEKKKKKSK 482

>SAKL0D09108g Chr4 (750336..751793) [1458 bp, 485 aa] {ON} similar
           to uniprot|P33322 Saccharomyces cerevisiae YLR175W CBF5
           Component of box H/ACA small nucleolar ribonucleoprotein
           particles (snoRNPs) probable rRNA pseudouridine synthase
           binds to snoRNP Nop10p and also interacts with ribosomal
           biogenesis protein Nop53p
          Length = 485

 Score = 30.8 bits (68), Expect = 4.0
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +1

Query: 448 PLSTASAKESK-KTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVK 624
           P++    KE + KT+E+K  K   D   E+ E+   E  KE   KK K   K       K
Sbjct: 399 PVTAPLIKEVETKTDEKKEEKVEKDE--EEEEEEEEEDRKEKKEKKEKKEKKEKKEKKEK 456

Query: 625 KKKTSQPSNETKGED 669
           K+K  +   + K ED
Sbjct: 457 KEKKEKKEKKRKAED 471

>Skud_1.50 Chr1 (107387..109351) [1965 bp, 654 aa] {ON} YAL011W
           (REAL)
          Length = 654

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 9/81 (11%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEK---VSSESGKESAPKKRKIGPKA------P 606
           +TA  + S K+++      LN   + K+ K     SE  K+   K  K  PK       P
Sbjct: 368 ATARPRASSKSKDAPGANRLNSITLVKSSKPPATDSEQEKDDGAKTEKKQPKEEKTTADP 427

Query: 607 NPLSVKKKKTSQPSNETKGED 669
             +S+K ++  +P N  K ED
Sbjct: 428 AEISIKVEEDVKPENSQKKED 448

>TDEL0A06800 Chr1 (1186658..1188781) [2124 bp, 707 aa] {ON}
           Anc_6.267 YMR186W
          Length = 707

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 3/89 (3%)
 Frame = +1

Query: 421 LTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPK 600
           +T+ V    PL+    K+ +K EE+       D    K E+V  E  K+   K +K+  +
Sbjct: 209 VTKEVEKDVPLTEEEKKDDEKKEEE-------DDKKPKLEEVDEEEEKKEGEKTKKVKEE 261

Query: 601 APNPLSVKKKK---TSQPSNETKGEDDAF 678
                 + K K   T  PS  ++ E +AF
Sbjct: 262 VQELEELNKTKPLWTRNPSEISQDEYNAF 290

>TPHA0C04540 Chr3 (977635..980451) [2817 bp, 938 aa] {ON} 
          Length = 938

 Score = 30.8 bits (68), Expect = 4.5
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +1

Query: 283 DPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           DP     C E + D  G NKHR        + R   R +    L+HL R+ +  + L  A
Sbjct: 602 DPGEYKNCPEKINDFFGFNKHR--------NERENYRAI----LLHLQRNQVKRKLLEDA 649

Query: 463 -SAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKE 567
              KES+ TE+ + F+ +++ +++     S    +E
Sbjct: 650 FQEKESQNTEDDEDFEIVSNCDIKHKNSNSLSQDEE 685

>ZYRO0B03740g Chr2 complement(310042..313455) [3414 bp, 1137 aa]
           {ON} similar to uniprot|P25302 Saccharomyces cerevisiae
           YER111C SWI4 Involved in cell cycle dependent gene
           expression transcription factor
          Length = 1137

 Score = 30.8 bits (68), Expect = 4.5
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +2

Query: 479 RRPKNRNCLKGSTTQMLKKQKKLVVNQGRNPRPRKGRLAQ 598
           + PK RN + GST +  KK   L+  QG NP P +  + Q
Sbjct: 175 KTPKKRNAIGGSTARKSKKNSMLL--QGANPSPLQNLVFQ 212

>TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {ON}
           
          Length = 3166

 Score = 30.8 bits (68), Expect = 4.8
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +1

Query: 310 ESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTE 489
           E+ +D +  N  R    ++ +++ R+    PG+P+I+   +     P    S K+SK   
Sbjct: 353 ENNIDESNFNNQRKATTTKSLYMERRKSMDPGLPIINTEPAY----PSEKKSLKQSKYAS 408

Query: 490 EQKL 501
           +QK+
Sbjct: 409 KQKI 412

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score = 30.4 bits (67), Expect = 5.0
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +1

Query: 289 KSPAECIESVVDVNGANKHRYVVASQDI--HLRRKLRTVPGVPLIHLTRSVMIMEPLSTA 462
           +SP +CI    D  GA+  +  VA   +  HL +  R + G P++H    + ++  + + 
Sbjct: 15  ESPVKCI---FDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEVVNRVVSL 71

Query: 463 SAKESKKTEEQKLFKG 510
            ++ S+  +E   F G
Sbjct: 72  LSRLSELVDETPPFSG 87

>SAKL0G19734g Chr7 complement(1700288..1701607) [1320 bp, 439 aa]
           {ON} no similarity
          Length = 439

 Score = 30.4 bits (67), Expect = 5.2
 Identities = 15/60 (25%), Positives = 28/60 (46%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 633
           ST   K+  +TE+Q   K   +   E+     S+  K+   +K +    AP+ + + K+K
Sbjct: 247 STLECKQENETEQQSSKKSKQEKEAEQHSSKKSKGKKKLQKEKNEAHTSAPSKVPISKQK 306

>Smik_7.153 Chr7 (278458..279963) [1506 bp, 501 aa] {ON} YGL119W
           (REAL)
          Length = 501

 Score = 30.4 bits (67), Expect = 5.4
 Identities = 23/74 (31%), Positives = 38/74 (51%)
 Frame = +1

Query: 325 VNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLF 504
           VN +N  R  ++S+ + + + LR +P VP      S+ + +  +T SAKESK   ++K  
Sbjct: 6   VNLSNFRRLCLSSRTLRITQNLRVLP-VP------SISVSKKYTTKSAKESKDNLDEK-- 56

Query: 505 KGLNDPNVEKTEKV 546
            G    N  K+  V
Sbjct: 57  HGQEKKNALKSSSV 70

>TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {ON}
           Anc_1.276 YJL090C
          Length = 753

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 5/114 (4%)
 Frame = +1

Query: 166 DVKVMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFK-----DPKSPAECIESVVDVN 330
           D  V I   C +++ E       +L  +F   RC H  K     D  S    +    ++ 
Sbjct: 373 DETVFIIIPCDRSIEELGVSSNSNLVTEFFVERCLHYKKLLLPLDSWSKPFLLTKEFEIK 432

Query: 331 GANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEE 492
              K   ++ S+++HL   +    GV L+HLT+   I++P+     K   +T +
Sbjct: 433 PNKK---LLHSENLHLNVSITGFHGVELLHLTKIFDILKPMGINYMKYLNRTTD 483

>Suva_8.374 Chr8 complement(659267..661693) [2427 bp, 808 aa] {ON}
           YOR322C (REAL)
          Length = 808

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 24/148 (16%), Positives = 54/148 (36%)
 Frame = +1

Query: 220 NEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTV 399
           N G I+L  + +    N    +P   A  ++     N  +        QD +L   +  +
Sbjct: 483 NNGKIELVTEIDCMGLNSGVSNPVMHASTLKIPTTTNKKSNINVACDIQDPNLGLYVNHI 542

Query: 400 PGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPK 579
             V ++    ++               K ++      +++P+ ++  ++S      + PK
Sbjct: 543 LAVEIVVAEEALQYANGQPIRKPNSKNKKDDNSSTMSVHNPD-QRLAELSPMFANRNTPK 601

Query: 580 KRKIGPKAPNPLSVKKKKTSQPSNETKG 663
            R + P+   P+S  K   S   ++  G
Sbjct: 602 VRSVDPEGITPVSSNKSNHSILKDKATG 629

>YGL108C Chr7 complement(303649..304071) [423 bp, 140 aa] {ON}
           Protein of unknown function, predicted to be
           palmitoylated; green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery
          Length = 140

 Score = 29.3 bits (64), Expect = 6.2
 Identities = 19/66 (28%), Positives = 29/66 (43%)
 Frame = +1

Query: 469 KESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS 648
           KE K  +++   K    P V++ E   S+    S P K K+ PK    L+ +K+      
Sbjct: 41  KEKKDKKKKTQLKSTTVPVVQRKE--GSKLTDTSDPSKNKVSPKEAARLAAEKRFQETNE 98

Query: 649 NETKGE 666
              KGE
Sbjct: 99  KYNKGE 104

>KLTH0A04620g Chr1 (384810..385973) [1164 bp, 387 aa] {ON} some
           similarities with uniprot|P40517 Saccharomyces
           cerevisiae YIL063C YRB2 Ran-GTPase-binding protein
           involved in nuclear export nuclear protein interacts
           with Gsp1p and Crm1p
          Length = 387

 Score = 30.0 bits (66), Expect = 6.7
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = +1

Query: 466 AKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQP 645
           AK  K  E ++  + LN    E T +   + GK S P   + GP   +  + K+ K+ + 
Sbjct: 44  AKRLKSEESEESKENLN----EHTAQEKKDDGKRSEPATSEKGPANESGSNNKEAKSDEG 99

Query: 646 SNETKGEDD 672
             ++  +DD
Sbjct: 100 HKQSSSDDD 108

>Smik_8.230 Chr8 (367278..368660) [1383 bp, 460 aa] {ON} YHR146W
           (REAL)
          Length = 460

 Score = 30.0 bits (66), Expect = 7.0
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 3/79 (3%)
 Frame = +1

Query: 409 PLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESA---PK 579
           P +   R V   +    +  KE KK +E    K +      + +K S++ G++ +   PK
Sbjct: 371 PTLAGKREVEGKKSSQVSEGKEKKKKQEGNEIKEVKRSESSREKKSSTKVGRKHSIKVPK 430

Query: 580 KRKIGPKAPNPLSVKKKKT 636
           K+   P +      KKKKT
Sbjct: 431 KQTTSPLSSTSEEPKKKKT 449

>KLTH0H12078g Chr8 (1030928..1032382) [1455 bp, 484 aa] {ON} highly
           similar to uniprot|P33322 Saccharomyces cerevisiae
           YLR175W CBF5 Component of box H/ACA small nucleolar
           ribonucleoprotein particles (snoRNPs) probable rRNA
           pseudouridine synthase binds to snoRNP Nop10p and also
           interacts with ribosomal biogenesis protein Nop53p
          Length = 484

 Score = 30.0 bits (66), Expect = 7.1
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +1

Query: 463 SAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPK 600
           S K+ KK ++ K  K       EK +K     G+ESA KK+K   K
Sbjct: 439 SGKKEKKDKKDKKEKKEKKEKKEKKDKKRKAEGEESADKKKKKSKK 484

>KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.423
           YCR008W
          Length = 573

 Score = 30.0 bits (66), Expect = 7.3
 Identities = 27/130 (20%), Positives = 48/130 (36%), Gaps = 9/130 (6%)
 Frame = +1

Query: 274 SFKDPKSPAECIESVVDVNGANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPL 453
           S  + K+  +C   +V  NG ++H    A +   L   L+ + G   +       + + +
Sbjct: 151 SVPNAKASPQCKRFIVFENGRHEHHLKNAKRQEKLTSMLKNMVGAQKLRNEARSAVPDII 210

Query: 454 STASAKESKKTEEQKLFKGL-------NDPNVEKTEKVSSES--GKESAPKKRKIGPKAP 606
               A          L  GL       +D N      +S  S  G+E   K+ K+   AP
Sbjct: 211 QGGKAASRTANYPPTLISGLVKQLEQNSDRNARGDHPISGASNVGEEKPLKRSKVPGAAP 270

Query: 607 NPLSVKKKKT 636
            P+  K  ++
Sbjct: 271 APVEQKDSRS 280

>CAGL0M13035g Chr13 complement(1284308..1286086) [1779 bp, 592 aa]
           {ON} some similarities with uniprot|P35732 Saccharomyces
           cerevisiae YKL054c VID31
          Length = 592

 Score = 30.0 bits (66), Expect = 7.4
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 6/79 (7%)
 Frame = +1

Query: 457 TASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRK------IGPKAPNPLS 618
           +AS+ ++     Q   K    P   K EK++         ++RK      I    P P  
Sbjct: 129 SASSGKNATAAAQAAVKKTGVPAGTKEEKIAQRLNSTHTQEERKKMSWAAIATPKPKPKP 188

Query: 619 VKKKKTSQPSNETKGEDDA 675
           V+KKK  +P+ E++ +  A
Sbjct: 189 VQKKKEEEPAQESQEDTKA 207

>KLTH0F09108g Chr6 complement(782647..784806) [2160 bp, 719 aa] {ON}
           some similarities with uniprot|P05453 Saccharomyces
           cerevisiae YDR172W SUP35 Translation termination factor
           eRF3 altered protein conformation creates the [PSI( )]
           prion a dominant cytoplasmically inherited protein
           aggregate that alters translational fidelity and creates
           a nonsense suppressor phenotype
          Length = 719

 Score = 30.0 bits (66), Expect = 7.6
 Identities = 22/97 (22%), Positives = 41/97 (42%)
 Frame = +1

Query: 385 KLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGK 564
           KL +  G+ L+  T+   +++       +E KK E +K  +   D   E T   +  +G+
Sbjct: 175 KLASSSGIKLVGATKKPEVVKK------EEPKKEEPKKEEQSAEDNTQESTGPAADNAGE 228

Query: 565 ESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 675
           E+        PK    L + ++K ++   ET     A
Sbjct: 229 EATKDSETALPKV-EQLKISEEKPAKKEEETANASTA 264

>NDAI0K01330 Chr11 complement(303660..305912) [2253 bp, 750 aa] {ON}
           Anc_8.681 YPL158C
          Length = 750

 Score = 30.0 bits (66), Expect = 7.6
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 6/114 (5%)
 Frame = +1

Query: 328 NGANKHRYVVASQDIHLRRKLRT-VPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQ--- 495
           + A+ +    +S   H   K +T +  VP I    S+     LS+ + K SKK   Q   
Sbjct: 207 SSASSNTSTFSSTSYHSLSKEQTNLRRVPTIKQVPSISSNGTLSSPTKKSSKKKISQIQS 266

Query: 496 --KLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSN 651
             K+ + L+ P         S S K++ PK      K  NP S   K + + SN
Sbjct: 267 PKKVKQKLSSPTT-----AISPSQKKTLPKSHHTTTKTRNPTSKSSKSSLKRSN 315

>NDAI0C02690 Chr3 (625861..628203) [2343 bp, 780 aa] {ON} Anc_6.32
           YOL006C
          Length = 780

 Score = 30.0 bits (66), Expect = 7.7
 Identities = 23/64 (35%), Positives = 29/64 (45%)
 Frame = +1

Query: 481 KTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETK 660
           K ++QK+ K      ++  E   S S +E   KK K   K      V KK  S P NETK
Sbjct: 68  KNKKQKISK------IKVEEFDGSSSSQEKKVKKSKKKSK-----KVSKKMISDPKNETK 116

Query: 661 GEDD 672
            E D
Sbjct: 117 QESD 120

>Ecym_5517 Chr5 complement(1048887..1051745) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AER244C
          Length = 952

 Score = 30.0 bits (66), Expect = 7.8
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEK----VSSESGKESAPKKRKIGPKAPNPL 615
           +  S ++  +T+   +   L D N+E T+K    VSSE        K +  PK PNP+
Sbjct: 142 ANGSDEQLMQTDNNTVSDQLADGNMESTKKEPCSVSSEKEASLTTAKSQDNPKVPNPM 199

>ZYRO0D04554g Chr4 complement(379454..382483) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P39730 Saccharomyces cerevisiae
           YAL035W FUN12 GTPase required for general translation
           initiation by promoting Met-tRNAiMet binding to
           ribosomes and ribosomal subunit joining homolog of
           bacterial IF2
          Length = 1009

 Score = 30.0 bits (66), Expect = 7.9
 Identities = 20/76 (26%), Positives = 34/76 (44%)
 Frame = +1

Query: 442 MEPLSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSV 621
           M  L+ +  K+ KKT ++K     N   V K++K   +  KE   +K+K           
Sbjct: 57  MSTLAKSKKKQDKKTTDEKAENNNNAKPVLKSKKEKEKEKKEKEKQKKK--------EEN 108

Query: 622 KKKKTSQPSNETKGED 669
            KKK  Q + + K ++
Sbjct: 109 NKKKAQQQAQKEKNKE 124

>NCAS0A09090 Chr1 (1798908..1799324) [417 bp, 138 aa] {ON} Anc_2.308
           YDL121C
          Length = 138

 Score = 28.9 bits (63), Expect = 8.3
 Identities = 14/47 (29%), Positives = 26/47 (55%)
 Frame = +1

Query: 460 ASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPK 600
           +S KE  K++ Q+L   +NDPN+ K +    ++   S+  K ++  K
Sbjct: 35  SSGKEKVKSKRQRLKNAINDPNLLKFKLKDEDTKGASSANKFQLDSK 81

>TDEL0C04510 Chr3 complement(813706..814332) [627 bp, 208 aa] {ON}
           Anc_2.234 YIL127C
          Length = 208

 Score = 29.3 bits (64), Expect = 9.0
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +2

Query: 479 RRPKNRNCLKGSTTQMLKKQ-KKLVVNQGRNPRPRKGRLAQRLLIHXXXXXXXXXXXXXX 655
           RRPK+   ++GS  Q++ +  KK+V  Q R+    K R  QR +                
Sbjct: 37  RRPKSSTKVRGSKAQLIDRNLKKIVELQERDVESLKKR--QRKMKKRAVRANKVENDKIQ 94

Query: 656 XXARMTLLKRRKEEGNIKV 712
             A++++L+R K+ G + V
Sbjct: 95  QLAKLSVLERHKKVGTLTV 113

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 29.6 bits (65), Expect = 9.1
 Identities = 22/62 (35%), Positives = 29/62 (46%)
 Frame = +1

Query: 454 STASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKK 633
           S+ S  ES K E+++  K       +     SSES  ES+ KKRK           KK+K
Sbjct: 111 SSDSESESDKEEKKESSKS------DSESSSSSESDSESSDKKRKSEDVEEEESESKKQK 164

Query: 634 TS 639
           TS
Sbjct: 165 TS 166

>ZYRO0F03740g Chr6 complement(311378..313429) [2052 bp, 683 aa] {ON}
           similar to uniprot|P43579 Saccharomyces cerevisiae
           YFL013C IES1 Subunit of the INO80 chromatin remodeling
           complex
          Length = 683

 Score = 29.6 bits (65), Expect = 10.0
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = +1

Query: 451 LSTASAKESKKTEEQKLFKGLNDPNVEKTEKVSSESGKESAPKKRKIGP-KAPNPLSVKK 627
           L   +A    +  + +L +   DP+ E T   ++   K+   K+RK  P K PN  S  K
Sbjct: 484 LPETAASTEVQDAQGELQEPTQDPSDENTAPNNTSDTKQDTTKRRKPRPRKRPNSASNVK 543

Query: 628 KKTSQPS 648
           K++  P+
Sbjct: 544 KESKAPA 550

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,134,171
Number of extensions: 1336424
Number of successful extensions: 5659
Number of sequences better than 10.0: 111
Number of HSP's gapped: 5512
Number of HSP's successfully gapped: 114
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 33 (17.3 bits)