Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1656.15ON25725712701e-179
Suva_15.1796.15ON25921810571e-146
Smik_15.1736.15ON25122510411e-144
YOR004W (UTP23)6.15ON2542259981e-137
NDAI0I022506.15ON2712377991e-107
KAFR0A050606.15ON2692327911e-106
KNAG0F028806.15ON2692197711e-103
KLLA0D01023g6.15ON2682197701e-103
Kpol_1045.746.15ON2572267681e-102
NCAS0D026606.15ON2612267671e-102
SAKL0E01056g6.15ON2692217448e-99
ZYRO0C07920g6.15ON2932167451e-98
CAGL0E02673g6.15ON2632107324e-97
KLTH0C11352g6.15ON2682167334e-97
TDEL0G045406.15ON2452257281e-96
ACR011C6.15ON2532247253e-96
Kwal_56.223996.15ON2742277083e-93
TPHA0J002806.15ON2712157022e-92
Ecym_30196.15ON2662206882e-90
TBLA0A072906.15ON2592096056e-78
KLTH0E02860g5.392ON1891451424e-10
Kwal_55.200895.392ON1891451416e-10
Kpol_1055.185.392ON1891451391e-09
CAGL0M01056g5.392ON1891451382e-09
ZYRO0A06754g5.392ON1891481372e-09
KAFR0D042805.392ON1891451363e-09
KLLA0A07018g5.392ON1891451363e-09
NDAI0C045505.392ON1891451354e-09
KNAG0C052705.392ON1891451345e-09
TDEL0E023305.392ON1891481336e-09
AEL102W5.392ON1891411338e-09
TBLA0H017505.392ON1891451321e-08
TPHA0D023105.392ON1891451321e-08
SAKL0G07766g5.392ON1891451302e-08
NCAS0F030905.392ON1891451302e-08
Ecym_74695.392ON1891451302e-08
Suva_2.5095.392ON1891451266e-08
Skud_4.6065.392ON1891451266e-08
YDR339C (FCF1)5.392ON1891451267e-08
Smik_4.5995.392ON1891451267e-08
TPHA0B013201.276ON753114702.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.165
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   493   e-179
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   411   e-146
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   405   e-144
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   389   e-137
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   312   e-107
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   309   e-106
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   301   e-103
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   301   e-103
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   300   e-102
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   300   e-102
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   291   8e-99
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   291   1e-98
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   286   4e-97
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   286   4e-97
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   285   1e-96
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   283   3e-96
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   277   3e-93
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   275   2e-92
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   269   2e-90
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   237   6e-78
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    59   4e-10
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    59   6e-10
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    58   1e-09
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    58   2e-09
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    57   2e-09
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    57   3e-09
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    57   3e-09
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    57   4e-09
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    56   5e-09
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    56   6e-09
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    56   8e-09
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    55   1e-08
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    55   1e-08
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    55   2e-08
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    55   2e-08
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    55   2e-08
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    53   6e-08
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    53   6e-08
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    53   7e-08
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    53   7e-08
TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {O...    32   2.4  

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  493 bits (1270), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/257 (93%), Positives = 241/257 (93%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFXXXXXXXXXXXXXX 240
           KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAF              
Sbjct: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSSTN 240

Query: 241 XXAINGTTVLQVQPSSD 257
             AINGTTVLQVQPSSD
Sbjct: 241 KSAINGTTVLQVQPSSD 257

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  411 bits (1057), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/218 (89%), Positives = 206/218 (94%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNF+LPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVV+VNGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDI LRRKLRTVPGVPLIHLTRSVMIMEPLSTASAK S+ TEEQKL+KGLNDPN+EK E
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNE 218
            +S  S KES PKKRK GPKAPNPLS+KKKK + PS++
Sbjct: 181 AISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDD 218

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  405 bits (1041), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/225 (86%), Positives = 209/225 (92%), Gaps = 1/225 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+GSNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPA+CIESVVD+NGANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDI LRRKLR VPGVPLIHLTRSVM+MEPLSTASAK SK TEE+KL+KGLNDPNV+K +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTS-QPSNETKGEDD 224
           ++S  SGKES  KKRK GPKAPNPLSVKKKK +   S+E +G++D
Sbjct: 181 EISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKED 225

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  389 bits (998), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/225 (84%), Positives = 207/225 (92%), Gaps = 1/225 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLV EC+ SNFNLPSGLKRTLQADVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQALYETRN+GAI+LAKQFERRRCNHSFKDPKSPAECIESVV+++GANKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDI LRRKLRTVPGVPLIHLTRSVM+MEPLSTASAK SK TEEQKL+KGLNDPN+EK +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 KVSSESGKESAPKKRKIGPKAPNPLS-VKKKKTSQPSNETKGEDD 224
           +    SGKES  KKRK+GPKAPNPLS  KKKK + PS+E K ++D
Sbjct: 181 ESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKED 225

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  312 bits (799), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 188/237 (79%), Gaps = 13/237 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPN----- 175
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ S++ E +KL+KGLNDP      
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 176 --VEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS-NET----KGEDDA 225
             V+K E V  +   +   KKRKIGPK PNPLS+KKKKT+  S NE     +G +DA
Sbjct: 181 SAVDK-ETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDA 236

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  309 bits (791), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 188/232 (81%), Gaps = 9/232 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177
           SQDI +RR+LR VPGVPL+H++RSVMIMEPLS  SAK S + E++KL+KGLNDP    ++
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 178 KTEKVSSE---SGKESAPKKRKIGPKAPNPLSVKKK-KTSQPSNETKGEDDA 225
             E+ ++E   SG+++A KKR  GPK PNPLSV+KK KT     +T   DD 
Sbjct: 181 LDEEEATETQGSGEKTAKKKR--GPKGPNPLSVRKKVKTLNEPKQTDKNDDV 230

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 179/219 (81%), Gaps = 9/219 (4%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+++V + + S F+L   L+RT+QA+VK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALY T N  AID+AK++ERRRCNH  KDPKSP ECIESVVD+ G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP-----N 175
            Q+I LRRKLR VPGVPLIH++R+VMIMEPLS ASA+ SK+ E+QKLF GLND       
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 176 VEKTEKVSSESGK---ESAPKKRKIGPKAPNPLSVKKKK 211
             +TEKV  + GK   E+ PKKRK+GPK PNPLS+KKKK
Sbjct: 181 AAETEKV-EDKGKEAPEAKPKKRKLGPKQPNPLSMKKKK 218

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  301 bits (770), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/219 (65%), Positives = 181/219 (82%), Gaps = 7/219 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+QLV E   S+F+   GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+Q+LY+T N+GAID  KQFERRRCNH  K+PKS  EC+ SVVDVNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 176
           +QD+ +RR+LR +PGVPL+++ RSVM+MEPLS AS K S++ EEQKL+KGLNDP      
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 177 -EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQ 214
            ++ ++  +E+ +E+ PKKRK GPK PNPLS+KKKKT++
Sbjct: 181 RDENDEAGAEN-QENKPKKRK-GPKEPNPLSMKKKKTTE 217

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/226 (61%), Positives = 184/226 (81%), Gaps = 1/226 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+VD+ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP-NVEKT 179
           SQD+ +RRKLR +PGVP++H++R+VMI+EPLS AS K S++ E+ KL+KGLND  +    
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 EKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 225
           ++  SE  ++++  K+  GPK PNPLS+KK+K+   SNE + E ++
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRKSKPASNEVEAETES 226

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/226 (65%), Positives = 183/226 (80%), Gaps = 2/226 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVE--K 178
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK SK+ E +KL+KGLNDP     K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 179 TEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDD 224
           T     +   +  PKK K GPK+PNPLS+KKKK     N     +D
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNREDSTED 226

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  291 bits (744), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 175/221 (79%), Gaps = 4/221 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVV+ NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177
           +QDI +RRKLR VPGVPLI++ RSVM+MEPLS AS + SK  EE+KLFKGLNDP    + 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 178 KTEKVS-SESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSN 217
             E V   +S K+  P K+K GPK PNPLSVK+K+  +  N
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREEN 221

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  291 bits (745), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 6/216 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+QLVS+C  S+++L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALY T+N+ AI+L K FERRRCNH  K+ K P ECI+SVV+VNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177
           SQD+ LRRKLR VPGVPLIH++RSVM+MEPLS AS++ ++ +E +KL KGLNDP    ++
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 178 KTEKVSSESGKESAP--KKRKIGPKAPNPLSVKKKK 211
            T  V +E   ES P  KKRK GPK PNPLSV+KK+
Sbjct: 181 TTPSVENELESESQPPAKKRK-GPKGPNPLSVRKKQ 215

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  286 bits (732), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 138/210 (65%), Positives = 167/210 (79%), Gaps = 3/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VVDV G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177
            QD+ +RR LR VPGVPL+H++RSVMIMEPLS ASAK S+  EE KLF+GLNDP    ++
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 178 KTEKVSSESGKESAPKKRKIGPKAPNPLSV 207
              +   +S +++  KKRKIGPK PNPLS+
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSM 210

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  286 bits (733), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 172/216 (79%), Gaps = 5/216 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 176
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   S+  E++KLFKGLNDP      
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 177 EKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKT 212
            + E   +++G E +  KRK GPK PNPLS+KKKKT
Sbjct: 181 AEEEGGKTDNGTEVSKNKRK-GPKGPNPLSIKKKKT 215

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  285 bits (728), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 174/225 (77%), Gaps = 12/225 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDNQ+V +C GSNF+L  GL+RTLQA+VKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+QALYET  +GAI+LAK FERRRCNH  K+PK P EC+ES+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDI  RR LR  PGVPL+H  RSVM+MEPLS ASAK S   E +KL KGLNDP   +  
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDP---RNA 177

Query: 181 KVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDA 225
            + +E+ + S  K+     K PNPLSVKK+KT     E+KGE  A
Sbjct: 178 GIKTENPQTSIKKR----TKQPNPLSVKKRKT-----ESKGEPKA 213

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  283 bits (725), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 136/224 (60%), Positives = 177/224 (79%), Gaps = 6/224 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + S++ E+QKLFKGLNDP      
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 KVSSESG---KESAPKKRKIGPKAPNPLSVKKKKT--SQPSNET 219
           + S+ +G    E AP  ++ GPKAPNPLS+KK+K    QP+++ 
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDA 223

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  277 bits (708), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 140/227 (61%), Positives = 173/227 (76%), Gaps = 9/227 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   + F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCCIQA+YET ++ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177
           +Q+  +R  LR VPGVPL+ + RSVM+MEPLS AS   S+  E +KLFKGLNDP    + 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 178 KTEKVSSESG----KE--SAPKKRKIGPKAPNPLSVKKKKTSQPSNE 218
            TE+ ++ +     KE   AP K++ GPK PNPLS+KKKKTS+   E
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKE 227

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  275 bits (702), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 131/215 (60%), Positives = 166/215 (77%), Gaps = 5/215 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD-VKV 59
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD Q+V +   SN+NL   L++TLQA+ +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVV 119
           MITQCC+Q LY T N+  ID AK+FERRRCNHS KDPK P ECIES+V+++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKT 179
           A+Q++ LRRKLR VPGVP++HL+RSVMIMEP+S +S + ++K E+ KL+KGLNDP     
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 ----EKVSSESGKESAPKKRKIGPKAPNPLSVKKK 210
               E      G + A  K++ G K PNPLS KKK
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK 215

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  269 bits (688), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 138/220 (62%), Positives = 173/220 (78%), Gaps = 7/220 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVVD+NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 176
           +QDI +RR LR VPGVPLI++ RSVM+MEPLS+ S + S++ E +KL KGLNDP      
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 177 EKTEKVSSESGKESAPK-KRKI-GPKAPNPLSVKKKKTSQ 214
             TE  S +     A + KRKI GPK PNPLS+KK + ++
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNK 219

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  237 bits (605), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 155/209 (74%), Gaps = 10/209 (4%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD--VK 58
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYV 118
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+VDVNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEK 178
           VA+QD+ LRRKLR +PGVPLIH  RSVM+MEPLS AS + +++ E +KL  GLN      
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN------ 174

Query: 179 TEKVSSESGKESAPKKRKIGPKAPNPLSV 207
           + K S E G+E+  KK+K   K  NPLS+
Sbjct: 175 STKASVEGGQENGIKKKK--VKGVNPLSM 201

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+  TL A    MIT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       +L  G+  TL A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D+ L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDVGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    R PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD-----DCL-----VNRVMQHKCYIVATNDAPL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 154
           ++++R +PG+PL+ +     ++E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A   ++IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRVRKVPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C I  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 55.8 bits (133), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPLSTA 154
           ++++R +PG+PL+ +      +E L  A
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYAIEKLPDA 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 9/141 (6%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHLRRKL 130
            +   A+ LA+    +R N S K   +  +C+     VN   +H+ Y+VA+ D  L++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-DCL-----VNRVLQHKCYIVATNDAGLKQRI 164

Query: 131 RTVPGVPLIHLTRSVMIMEPL 151
           R VPG+PL+ +     ++E L
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD-----DCI-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVVEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L +      R PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCYIVATNDQGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHAYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-----DCL-----VNRVLQHKCYIVATNDAAL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLMSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       +L  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +CI     VN   +H+ ++VA+ D  L
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD-----DCI-----VNRVLQHKCFIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     VN   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD-----DCL-----VNRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R VPG+PL+ +     ++E L
Sbjct: 161 KQRIRKVPGIPLLSVGGHSYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 14  LVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVMITQCCIQALYET- 72
           L + +    + PYQVL+D   ++       ++  G+   L A    +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RNEGAIDLAK--QFERRRCNH--SFKDPKSPAECIESVVDVNGANKHR-YVVASQDIHL 126
            +   A+ LA+  + +R  C+H  ++ D     +C+     V+   +H+ Y+VA+ D  L
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD-----DCL-----VHRVLQHKCYIVATNDAGL 160

Query: 127 RRKLRTVPGVPLIHLTRSVMIMEPL 151
           ++++R +PG+PL+ +     ++E L
Sbjct: 161 KQRIRKIPGIPLMSVGGHAYVIEKL 185

>TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {ON}
           Anc_1.276 YJL090C
          Length = 753

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 8/114 (7%)

Query: 56  DVKVMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFK-----DPKSPAECIESVVDVN 110
           D  V I   C +++ E       +L  +F   RC H  K     D  S    +    ++ 
Sbjct: 373 DETVFIIIPCDRSIEELGVSSNSNLVTEFFVERCLHYKKLLLPLDSWSKPFLLTKEFEIK 432

Query: 111 GANKHRYVVASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEE 164
              K   ++ S+++HL   +    GV L+HLT+   I++P+     K   +T +
Sbjct: 433 PNKK---LLHSENLHLNVSITGFHGVELLHLTKIFDILKPMGINYMKYLNRTTD 483

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,055,578
Number of extensions: 1008288
Number of successful extensions: 4782
Number of sequences better than 10.0: 168
Number of HSP's gapped: 4766
Number of HSP's successfully gapped: 180
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)