Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1646.14ON48248224190.0
Suva_15.1786.14ON47647819040.0
YOR003W (YSP3)6.14ON47847818580.0
Smik_15.1726.14ON47847818160.0
YEL060C (PRB1)6.14ON63541812801e-171
Skud_5.296.14ON60841712771e-171
Smik_5.276.14ON60841812751e-170
Suva_5.76.14ON66441812721e-169
Kwal_56.223876.14ON54341812561e-169
KLTH0C11396g6.14ON55042812481e-167
SAKL0E01012g6.14ON54441812441e-167
TBLA0A073006.14ON57344112341e-165
NCAS0F002206.14ON69541612291e-162
TDEL0G045506.14ON56441612041e-160
KLLA0D00979g6.14ON56142211971e-159
ZYRO0C07942g6.14ON54841311551e-153
CAGL0B03619g6.14ON46841811291e-150
NDAI0K028806.14ON70441711501e-150
KAFR0L003606.14ON50248511231e-149
ACR012C6.14ON54142411211e-148
KNAG0E009206.14ON53141911191e-148
Ecym_30186.14ON57542011211e-148
Kpol_1032.56.14ON68041611221e-146
Kpol_1045.756.14ON47742010961e-145
CAGL0E02651g6.14ON48541410291e-135
TPHA0M002306.14ON58541710191e-132
KAFR0B065506.14ON4564819991e-131
NCAS0D026306.14ON4514189651e-126
NDAI0I022806.14ON4824239351e-121
KNAG0F02970singletonON4203618641e-111
CAGL0L13266gsingletonON5794867068e-86
SAKL0A02002g6.313ON4793695323e-61
NDAI0I005606.313ON4833865183e-59
Suva_3.846.313ON5273925118e-58
Kpol_1018.56.313ON4653385033e-57
NCAS0D043906.313ON4923865036e-57
YCR045C (RRT12)6.313ON4913315028e-57
Smik_3.1496.313ON4913315011e-56
Kwal_23.61836.313ON4933195002e-56
KLTH0A06094g6.313ON4963664974e-56
ZYRO0D08822g6.313ON4903864958e-56
TDEL0A072806.313ON4363504882e-55
KLLA0F06028g6.313ON5083214898e-55
KNAG0I024706.313ON4754104824e-54
Skud_3.1246.313ON5403314856e-54
Kpol_1028.616.313ON5183164837e-54
AAR069W6.313ON7683184894e-53
Ecym_21056.313ON6102914669e-51
TBLA0F039706.313ON7343274682e-50
KAFR0J024506.313ON4783804529e-50
CAGL0L10802g6.313ON5173444504e-49
TPHA0D037606.313ON6073414361e-46
Kwal_33.133721.78ON3773053854e-41
TBLA0A067006.313ON4973293881e-40
KLTH0F02288g1.78ON3803083662e-38
Kpol_2000.691.78ON3863553364e-34
TPHA0B045201.78ON3883143092e-30
ZYRO0F16764g1.78ON3863052916e-28
TDEL0C062301.78ON3642982456e-22
TBLA0A054101.78ON3823532441e-21
Kwal_56.22390singletonOFF1011012057e-19
Kwal_23.6185singletonOFF85681253e-08
Smik_14.972.6ON8142531171e-05
Suva_14.1062.6ON8092511143e-05
YCR045W-AsingletonOFF116891044e-05
NDAI0F038902.6ON8332501134e-05
YNL238W (KEX2)2.6ON8142521118e-05
Kwal_56.248002.6ON8032471101e-04
Skud_14.1012.6ON8192591101e-04
SAKL0G00440g2.6ON8362471072e-04
NCAS0A008802.6ON8332481010.001
KLTH0H00418g2.6ON8112471000.002
TBLA0B001302.6ON8422421000.002
KLLA0D19811g2.6ON756243980.003
Ecym_64862.6ON781114920.014
KNAG0F007702.6ON826250900.025
ZYRO0F15598g2.6ON790103860.075
CAGL0J07546g2.6ON789253761.2
YBL008W (HIR1)4.106ON84087714.7
CAGL0I00770g2.385ON31887688.4
KNAG0D008906.257ON1890160698.7
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_15.164
         (1449 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   936   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   738   0.0  
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   720   0.0  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   704   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   497   e-171
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   496   e-171
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   495   e-170
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   494   e-169
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   488   e-169
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   485   e-167
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   483   e-167
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   479   e-165
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   478   e-162
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   468   e-160
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   465   e-159
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   449   e-153
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   439   e-150
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   447   e-150
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   437   e-149
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   436   e-148
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   435   e-148
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   436   e-148
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   436   e-146
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   426   e-145
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   400   e-135
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   397   e-132
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   389   e-131
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     376   e-126
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   364   e-121
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              337   e-111
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   276   8e-86
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   209   3e-61
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    204   3e-59
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   201   8e-58
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   198   3e-57
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   198   6e-57
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   197   8e-57
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   197   1e-56
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   197   2e-56
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   196   4e-56
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   195   8e-56
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   192   2e-55
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   192   8e-55
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   190   4e-54
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   191   6e-54
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   190   7e-54
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   192   4e-53
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   184   9e-51
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   184   2e-50
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   178   9e-50
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   177   4e-49
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   172   1e-46
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   152   4e-41
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   154   1e-40
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   145   2e-38
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   134   4e-34
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   123   2e-30
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   116   6e-28
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    99   6e-22
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    99   1e-21
Kwal_56.22390 s56 complement(108145..108450) [306 bp, 101 aa] {O...    84   7e-19
Kwal_23.6185 s23 (1485516..1485773) [258 bp, 85 aa] {OFF} [conti...    53   3e-08
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    50   1e-05
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    49   3e-05
YCR045W-A Chr3 (208751..209101) [351 bp, 116 aa] {OFF} Dubious O...    45   4e-05
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    48   4e-05
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    47   8e-05
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    47   1e-04
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    47   1e-04
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    46   2e-04
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    44   0.001
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    43   0.002
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    43   0.002
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    42   0.003
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    40   0.014
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    39   0.025
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    38   0.075
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    34   1.2  
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    32   4.7  
CAGL0I00770g Chr9 complement(56013..56969) [957 bp, 318 aa] {ON}...    31   8.4  
KNAG0D00890 Chr4 (137292..142964) [5673 bp, 1890 aa] {ON} Anc_6....    31   8.7  

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
            (REAL)
          Length = 482

 Score =  936 bits (2419), Expect = 0.0
 Identities = 470/482 (97%), Positives = 470/482 (97%)
 Frame = +1

Query: 1    MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 180
            MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ
Sbjct: 1    MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 60

Query: 181  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 360
            KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP
Sbjct: 61   KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 120

Query: 361  NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 540
            NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW
Sbjct: 121  NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 180

Query: 541  GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 720
            GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE
Sbjct: 181  GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 240

Query: 721  ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 900
            ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA  
Sbjct: 241  ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASS 300

Query: 901  XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 1080
                      TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS
Sbjct: 301  KKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 360

Query: 1081 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS
Sbjct: 361  ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 420

Query: 1261 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW
Sbjct: 421  YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

Query: 1441 RF 1446
            RF
Sbjct: 481  RF 482

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
            (REAL)
          Length = 476

 Score =  738 bits (1904), Expect = 0.0
 Identities = 367/478 (76%), Positives = 410/478 (85%)
 Frame = +1

Query: 7    MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 186
            MKL  +LL LCAG  +CMIIP L+EI Y +E+ E+FRNAK Q+GLGQQ   N HL   KV
Sbjct: 1    MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 187  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 366
            +  ++SLPYRYII F+ED + R IESH +MIQ+ Q  SVSK+ +DD+F   VS SA  + 
Sbjct: 61   VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118

Query: 367  QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 546
            QFGGID  FDINGLFRGYTGYFT+EVI+ V QDP++KFIE ESTV+++NS+ QE+APWGL
Sbjct: 119  QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178

Query: 547  HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 726
            HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGID  HEDFEGRA WGAVIP+NDEAS
Sbjct: 179  HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238

Query: 727  DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            DLNGHGTHCAGIIGSRHFGV KNTN++AVKVLRSNGEGTVSDVIKGIEYV K+HI     
Sbjct: 239  DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKK 298

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 1086
                    TANLSLGSSKSPAMEMAVNAAV+ GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 299  GGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358

Query: 1087 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 1266
            VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMAAPHVAGILSY 
Sbjct: 359  VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418

Query: 1267 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LSLQP+ DSEFF  TVSPQQLKEKI+ FST+GVLGDV E+TPNRL+YNGGG+KLD FW
Sbjct: 419  LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
            precursor to the subtilisin-like protease III
          Length = 478

 Score =  720 bits (1858), Expect = 0.0
 Identities = 356/478 (74%), Positives = 400/478 (83%)
 Frame = +1

Query: 7    MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 186
            MK   IL IL A   LCMIIP+ + I  + E  +  R+ +A +GLGQ +  N H   Q V
Sbjct: 1    MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60

Query: 187  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 366
               ++ LPYRY+IVFNEDI+ + I+SH Q++QK    SV K+TE+D+F R +S+S S   
Sbjct: 61   AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 367  QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 546
            QFGGID  FDINGLFRGYTGYFTDE+I+I+ QDP++KF+E E+TV+ISNSS QE+APWGL
Sbjct: 121  QFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGL 180

Query: 547  HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 726
            HR+SHRE+ KYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA+WGAVIP NDEAS
Sbjct: 181  HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240

Query: 727  DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            DLNGHGTHCAGIIGS+HFGVAKNT I+AVKVLRSNGEGTVSDVIKGIEYV K HI     
Sbjct: 241  DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 1086
                    TANLSLGSSKS AMEMAVNAAVD GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 301  KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360

Query: 1087 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 1266
            VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA+PHVAGILSY 
Sbjct: 361  VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420

Query: 1267 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LSLQPA DSEFF D  SPQ+LKEK+LKFST+GVLGD+ ++TPN+L+YNGGGKKLD FW
Sbjct: 421  LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
            (REAL)
          Length = 478

 Score =  704 bits (1816), Expect = 0.0
 Identities = 351/478 (73%), Positives = 398/478 (83%)
 Frame = +1

Query: 7    MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 186
            MK   IL IL A   LCMIIPE +EI  +++  ++ RN K+   L QQ      +G    
Sbjct: 1    MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60

Query: 187  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 366
               ++ +PYRYI+VFNEDI+ + IESH +M+Q+A  VSVSK+ EDD FL  VS+S +P+ 
Sbjct: 61   THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120

Query: 367  QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 546
            Q GGID SFDINGLFRGY GYFTDE++ +V QDPL+KFIE ESTVR+SN+S Q+DAPWGL
Sbjct: 121  QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 547  HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 726
            HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA WGAVIP NDEAS
Sbjct: 181  HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 727  DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            DLNGHGTHCAGIIGS+H+GVAKNT ++AVKVLRSNGEGTVSDVIKGIEYVA+ HI     
Sbjct: 241  DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 1086
                    TANLSLGSSKS AMEMAV+AAVD GVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 301  KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 1087 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 1266
            VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG+LSY 
Sbjct: 361  VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 1267 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LSLQPA DSE+F + +SPQ+LKEK+LKFST GVLGD+ + TPNRL+YNGGGK LD+ W
Sbjct: 421  LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
            PRB1Vacuolar proteinase B (yscB), a serine protease of
            the subtilisin family; involved in protein degradation in
            the vacuole and required for full protein degradation
            during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  497 bits (1280), Expect = e-171
 Identities = 239/418 (57%), Positives = 309/418 (73%), Gaps = 3/418 (0%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 375
            SK +P RYIIVF        I+ H + +Q+AQ  SV  ++ +D+F  +   ++    + G
Sbjct: 176  SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235

Query: 376  GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 555
            GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 236  GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295

Query: 556  SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 735
            SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 296  SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355

Query: 736  GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 915
            GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 356  GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK 415

Query: 916  XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                 TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 416  GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
            ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 476  STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535

Query: 1276 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 536  QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
            YEL060C (REAL)
          Length = 608

 Score =  496 bits (1277), Expect = e-171
 Identities = 236/417 (56%), Positives = 308/417 (73%), Gaps = 3/417 (0%)
 Frame = +1

Query: 199  KSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGG 378
            K +P RYIIVF + +     + H + + +AQ  SV  ++ +D+F  +   S+    + GG
Sbjct: 150  KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209

Query: 379  IDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRIS 558
            I  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  ++   Q  APWGL RIS
Sbjct: 210  IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269

Query: 559  HRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNG 738
            HRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D NG
Sbjct: 270  HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329

Query: 739  HGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            HGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY A+ H          
Sbjct: 330  HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389

Query: 919  XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 1098
                TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGAS
Sbjct: 390  FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449

Query: 1099 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQ 1278
            T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQ
Sbjct: 450  TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 1279 PAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            P  DSEFF    D+++PQQLK K++ +ST+ +L DV E+TPN L+YNGGG+ L  FW
Sbjct: 510  PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
            YEL060C (REAL)
          Length = 608

 Score =  495 bits (1275), Expect = e-170
 Identities = 236/418 (56%), Positives = 307/418 (73%), Gaps = 3/418 (0%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 375
            SK +P RYI+VF + +    +  H + + +AQ  SV  ++ +D+F  +   +     + G
Sbjct: 149  SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208

Query: 376  GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 555
            GI  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 209  GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268

Query: 556  SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 735
            SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 269  SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328

Query: 736  GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 915
            GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 329  GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKK 388

Query: 916  XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                 TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 389  GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
            ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 449  STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508

Query: 1276 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 509  QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YEL060C
            (REAL)
          Length = 664

 Score =  494 bits (1272), Expect = e-169
 Identities = 236/418 (56%), Positives = 310/418 (74%), Gaps = 3/418 (0%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 375
            +K +P RYIIVF +D+       H + +Q+AQ  SV  +  +D+F  +   +A  + + G
Sbjct: 204  TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263

Query: 376  GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 555
            GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  ++   Q  APWGL R+
Sbjct: 264  GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323

Query: 556  SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 735
            SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 324  SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383

Query: 736  GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 915
            GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 384  GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKK 443

Query: 916  XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                 TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 444  GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
            ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 504  STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563

Query: 1276 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ ++TPN L+YNGGG+ L  FW
Sbjct: 564  QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
            (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  488 bits (1256), Expect = e-169
 Identities = 229/418 (54%), Positives = 305/418 (72%), Gaps = 5/418 (1%)
 Frame = +1

Query: 202  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTV---SASASPNPQF 372
            ++P+RYI+VF + +    ++ H +++ +A   SV K+  +D+F               + 
Sbjct: 79   AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSRE 138

Query: 373  GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 552
            GGI  SFD+NG+ RGY GYFT E+++ +  +PLV F+E +S V  +    Q  APWGL R
Sbjct: 139  GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSR 198

Query: 553  ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 732
            ISHRE+   G   +YLY+DAAG GVTSYV+DTGI+ +H+DFEGRA WG  +P ND   D 
Sbjct: 199  ISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDG 258

Query: 733  NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXX 912
            NGHGTHCAG I S+H+GVAKN N++AVKVLRSNG G++SDV+KG+E+ AK+H        
Sbjct: 259  NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNK 318

Query: 913  XXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 1092
                  TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSPA AE +ITVG
Sbjct: 319  KGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVG 378

Query: 1093 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 1272
            AST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y LS
Sbjct: 379  ASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLS 438

Query: 1273 LQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LQP  DSE+F+    ++P QLK+K++ +ST+  LGD+ E+T N L+YNGGG+ LD+FW
Sbjct: 439  LQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
            similar to uniprot|P09232 Saccharomyces cerevisiae
            YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
            protease of the subtilisin family involved in protein
            degradation in the vacuole and required for full protein
            degradation during sporulation
          Length = 550

 Score =  485 bits (1248), Expect = e-167
 Identities = 230/428 (53%), Positives = 308/428 (71%), Gaps = 15/428 (3%)
 Frame = +1

Query: 202  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKI-------------TEDDSFLRTV 342
            ++P+RYI+VF ++++   ++ H Q++ +A   SV+K+              ED  F    
Sbjct: 78   AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137

Query: 343  SASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSR 522
              S S   + GGI  SFD++GL  GY GYFTDE+++ +  +PLV F+E +S V       
Sbjct: 138  QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197

Query: 523  QEDAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAV 702
            Q  APWGL RISHRE+   G   +YLY+D AG GVTSYV+DTG++ +H+DFEGRA WG  
Sbjct: 198  QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257

Query: 703  IPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAK 882
            IP ND   D NGHGTHCAG I S+H+GVAKN N++AVKVLRSNG G++SDV+KG+E+ AK
Sbjct: 258  IPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAK 317

Query: 883  NHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSP 1062
            +H              TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSP
Sbjct: 318  SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377

Query: 1063 AGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPH 1242
            A AE ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PH
Sbjct: 378  ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437

Query: 1243 VAGILSYLLSLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGG 1416
            VAG+L+Y LSLQP  DSE+F+    ++P QLK+K++ +ST+ VLGD+ ++T N L++NGG
Sbjct: 438  VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497

Query: 1417 GKKLDEFW 1440
            G+ LD+FW
Sbjct: 498  GEGLDDFW 505

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
            Vacuolar proteinase B (yscB) a serine protease of the
            subtilisin family involved in protein degradation in the
            vacuole and required for full protein degradation during
            sporulation
          Length = 544

 Score =  483 bits (1244), Expect = e-167
 Identities = 234/418 (55%), Positives = 301/418 (72%), Gaps = 6/418 (1%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASA-----SPNPQ 369
            +P+RYIIVF +D T   I  H ++I +A   SV+K+   DSF      SA     +    
Sbjct: 78   IPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSS 137

Query: 370  FGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLH 549
             GGI  SFDI  +  GY GYFTDEV++ +  +  V+FIE +S V  S    Q  APWGL 
Sbjct: 138  EGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLS 197

Query: 550  RISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASD 729
            RISHRER   G   +YLY+D AG GVTSYV+DTGI+  H+DF GRA WG  +P+NDE +D
Sbjct: 198  RISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDAD 257

Query: 730  LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXX 909
             NGHGTHCAG I S H+GVAKN  ++A+KVLRSNG GT+SDV+KG+E+ A++H       
Sbjct: 258  GNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKN 317

Query: 910  XXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITV 1089
                   TAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 318  KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITV 377

Query: 1090 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 1269
            GAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y L
Sbjct: 378  GASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437

Query: 1270 SLQPAQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            SLQP  DSEFF  + ++P QLK+K++ +ST+ VL ++ E+TPN L+YNGGG+ L +FW
Sbjct: 438  SLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] {ON}
            Anc_6.14 YOR003W
          Length = 573

 Score =  479 bits (1234), Expect = e-165
 Identities = 236/441 (53%), Positives = 311/441 (70%), Gaps = 5/441 (1%)
 Frame = +1

Query: 133  DGLGQQNIENLHLGR--QKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVS 306
            DG G  N E+  +     + L     +P+RYII F +D+    I+ H Q I + Q+ S++
Sbjct: 99   DGDGDGNYESPAIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIA 158

Query: 307  KITEDDSFLRTVSASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIE 486
            ++  D  +  +V       P    I  SF+IN L +GY GYFTD+VI+ +  +PLV+F+E
Sbjct: 159  QLPHDHPYFNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVE 214

Query: 487  HESTVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEH 666
             +STV I+    Q  APWGL RISHRER   G   +YL++D AG GVT+YV+DTG++ EH
Sbjct: 215  QDSTVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEH 274

Query: 667  EDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTV 846
             DFEGRA WG  IP NDE  D NGHGTHCAG I S+H+GVAKN N++AVKVLRSNG G++
Sbjct: 275  NDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM 334

Query: 847  SDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAA 1026
            SDV+KG+EY   +H+A            TAN+SLG  KSP++++AVNAAV  G+HFA+AA
Sbjct: 335  SDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAA 394

Query: 1027 GNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNAT 1206
            GNE++DAC +SPA A+ +ITVGAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT
Sbjct: 395  GNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 454

Query: 1207 LSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDT---VSPQQLKEKILKFSTRGVLGDV 1377
             +LSGTSMA+PHVAG+LSY LSLQP QDSEF       ++P QLK++++ + T+ +L D+
Sbjct: 455  ATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDI 514

Query: 1378 NEETPNRLVYNGGGKKLDEFW 1440
             E TPN LV+NG G+ L +FW
Sbjct: 515  PELTPNVLVFNGAGQDLSDFW 535

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
            YEL060C
          Length = 695

 Score =  478 bits (1229), Expect = e-162
 Identities = 230/416 (55%), Positives = 305/416 (73%), Gaps = 1/416 (0%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 375
            S  +P RYI+VF + I    ++ H ++I + Q  S +K+ +DD F  + SA    +   G
Sbjct: 96   SNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF-SASAIEDESINQG 154

Query: 376  GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 555
            GI  +F+I+ L  GY GYFTDEV+E++  +PLV+++E +S V+ +    Q +APWGL RI
Sbjct: 155  GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214

Query: 556  SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 735
            SHRER   G   +YLY+D AG GVT YV+DTGI+TEH DF  RA WG  IP ND+  D N
Sbjct: 215  SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274

Query: 736  GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 915
            GHGTHCAG I S H+GVAKN  ++AVKVLRSNG G++SDVIKG+E+ A++HI        
Sbjct: 275  GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKK 334

Query: 916  XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                 TAN+SLG  KSP +++AVNAAVD G+HFA+AAGNE++DAC +SPA AE++ITVGA
Sbjct: 335  GFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
            ST SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 395  STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSL 454

Query: 1276 QPAQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            QP  DSEFF  T ++P Q+K+K++ +S++ VL D+ E TPN+L++NG G  LD+ W
Sbjct: 455  QPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
            Anc_6.14 YOR003W
          Length = 564

 Score =  468 bits (1204), Expect = e-160
 Identities = 230/416 (55%), Positives = 299/416 (71%), Gaps = 3/416 (0%)
 Frame = +1

Query: 202  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGI 381
            + P+RYI+V         I  H + I ++Q  SV ++ +DD F      SA      GGI
Sbjct: 110  AFPHRYIVVLKHSSPEE-IALHMEAITQSQLQSVGELAQDDPFF-----SAQGVRTTGGI 163

Query: 382  DISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 561
              SFD+ GL  GY GYFTD V+E++ + P+V F+E +S V  S    Q  APWGL RISH
Sbjct: 164  QDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISH 223

Query: 562  RERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGH 741
            RER   G   +YL++D AG GVTSYV+DTGI+ +H+DFEGRA WG  IP NDE  D NGH
Sbjct: 224  RERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGH 283

Query: 742  GTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 921
            GTHCAG I S+H+GVAK  +++AVKVLRSNG G++SDVIKG+E+ A++H           
Sbjct: 284  GTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGF 343

Query: 922  XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 1101
               TAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE+++TVGAST
Sbjct: 344  KGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGAST 403

Query: 1102 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQP 1281
             SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 404  LSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 463

Query: 1282 AQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
              DS+FF      V+P+QLK+K++ +ST+ +L D+ E+TPN L+YNGGG  L  FW
Sbjct: 464  DSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
            Vacuolar proteinase B (yscB) a serine protease of the
            subtilisin family involved in protein degradation in the
            vacuole and required for full protein degradation during
            sporulation
          Length = 561

 Score =  465 bits (1197), Expect = e-159
 Identities = 227/422 (53%), Positives = 299/422 (70%), Gaps = 7/422 (1%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP----- 360
            +  +P RYIIVF +D +   ++ H +++      ++  + ++D F    S   S      
Sbjct: 94   ANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKA 153

Query: 361  NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 540
            +   GGI  SFDI G   GY GYFT EVI+ + + PLV+F+E +S V  ++ + Q  APW
Sbjct: 154  HSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPW 213

Query: 541  GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 720
            GL RISHRE+   G   +YLY+D AG GVT+YV+DTG++  H+DF+GRA WG  IP++D 
Sbjct: 214  GLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDP 273

Query: 721  ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 900
              D NGHGTHCAG IGS H+GVAKN +I+AVKVLRSNG GT+SDV+KG+EYVA+ H    
Sbjct: 274  DVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAV 333

Query: 901  XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 1080
                      TAN+SLG  KSPA+++AVNAAV  GVHFA+AAGNE++DAC +SPA AE +
Sbjct: 334  EEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENA 393

Query: 1081 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            ITVGAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA PHV G+L+
Sbjct: 394  ITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLT 453

Query: 1261 YLLSLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDE 1434
            Y LSLQP  DSE+F+    ++P QLK+K++ FST+ VL D+ E+T N L+YNGGG+ LD+
Sbjct: 454  YFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDD 513

Query: 1435 FW 1440
             W
Sbjct: 514  LW 515

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
            similar to uniprot|P09232 Saccharomyces cerevisiae
            YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
            protease of the subtilisin family involved in protein
            degradation in the vacuole and required for full protein
            degradation during sporulation
          Length = 548

 Score =  449 bits (1155), Expect = e-153
 Identities = 219/413 (53%), Positives = 289/413 (69%), Gaps = 1/413 (0%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            L  RYII+F + +  + I  H ++I++     VS++ E+ SF   +      +   GGID
Sbjct: 89   LENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGID 148

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
             +FDING+  GY+GYF  +V++++   PL++ +E +S V    +  +  APWGL RISHR
Sbjct: 149  HTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHR 208

Query: 565  ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 744
            ER   G   +YLY++  G+GVTSYV+DTG++  H  F GRAKWG  IP  D   D NGHG
Sbjct: 209  ERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHG 268

Query: 745  THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 924
            THCAG IGS  +GVAK  +I+AVKVLRSNG G++SDV+KG+E+ A++H            
Sbjct: 269  THCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFK 328

Query: 925  XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 1104
              TAN+SLG  KSP+++ AVNAAV  G++FA+AAGNED+DAC +SPA A   ITVGAST 
Sbjct: 329  GSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTL 388

Query: 1105 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 1284
            SDDRA+FSN+G CVDVFAPG+NI+STYIGS ++T +LSGTSMA+PHVAG+L+Y LSLQP 
Sbjct: 389  SDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPG 448

Query: 1285 QDSEF-FYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
             DSEF    ++SP QLK+K+L FST+ VL D+   TPN L+YNGGG  L  FW
Sbjct: 449  SDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFW 501

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
            protease B or uniprot|P25036 Saccharomyces cerevisiae
            YOR003w YSP3
          Length = 468

 Score =  439 bits (1129), Expect = e-150
 Identities = 218/418 (52%), Positives = 296/418 (70%), Gaps = 6/418 (1%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            +P++YI+V  + ++   + +    +  A   ++  + ++  F   V+A   P    GGI 
Sbjct: 2    VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGIK 58

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
              F+IN LF+G  GYF + V++++ +  +V+F+E +S V  SN   Q +APWGL RISHR
Sbjct: 59   DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118

Query: 565  ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 744
            +R   G   +YLY++A G GVT+YV+DTGI+ +H +F+GRA+WG  IP ND   D NGHG
Sbjct: 119  DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178

Query: 745  THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 924
            THCAG I S+H+G+AK  N++AVKVL+S+G GT+SDVIKG+EY A+ H+           
Sbjct: 179  THCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHL-KESKNNKKFK 237

Query: 925  XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 1104
              TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC +SPA AEK+ITVGAST 
Sbjct: 238  GSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTL 297

Query: 1105 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSYLLSLQP 1281
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 298  SDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQP 357

Query: 1282 AQDSEFFYDT----VSPQQLKEKILKFSTRGVLGDV-NEETPNRLVYNGGGKKLDEFW 1440
              DSE FYD     V+P QLK+K++ +ST+ VL D+ + ++PN L+YNG G  L  FW
Sbjct: 358  DSDSE-FYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
            Anc_6.14
          Length = 704

 Score =  447 bits (1150), Expect = e-150
 Identities = 220/417 (52%), Positives = 293/417 (70%), Gaps = 5/417 (1%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            LP +YIIVF + I    I  H ++I + Q+ S S++     F  + S     + + GGI 
Sbjct: 239  LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGII 298

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
             SF+IN +  GY+GYFT EVI+++  +PLVK++E +S V+ +  + Q +APWGL RISHR
Sbjct: 299  SSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHR 358

Query: 565  ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 744
            ER   G   +YLY+D AG GVT +V+DTGI+  H DF  RA WG  IP ND+  D NGHG
Sbjct: 359  ERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHG 418

Query: 745  THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 924
            THCAG I S H+GVAKN  ++AVKVLRSNG G++SDVIKG+E+ A+ H+           
Sbjct: 419  THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHL-NNEKNKKDYK 477

Query: 925  XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 1104
              TAN+SLG  KSP +++AVNAAV+ G+HF++AAGNE++DAC SSPA AE +ITVGAST 
Sbjct: 478  GSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTL 537

Query: 1105 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSYLLSLQP 1281
            SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 538  SDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQP 597

Query: 1282 AQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
               S FF       ++P+QLK+K++ +ST  +L D+ + TPN+L+YNG G  + + W
Sbjct: 598  DSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
            YOR003W
          Length = 502

 Score =  437 bits (1123), Expect = e-149
 Identities = 224/485 (46%), Positives = 317/485 (65%), Gaps = 7/485 (1%)
 Frame = +1

Query: 7    MKLFNILLILCAGGTLCMIIPELNE-IAYYSETFENFRNAKAQDGLG---QQNIENLHLG 174
            M+L   LL++C+     ++IP L + I  +S+      ++     L      + EN+   
Sbjct: 1    MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENI--- 57

Query: 175  RQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITED-DSFLRT-VSA 348
                      +P+RYIIVF + ++   I+ H ++I        S  + D   +L+T ++ 
Sbjct: 58   ----------IPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINV 107

Query: 349  SASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQE 528
              S     GGI   FDI+ L  GY  Y +DE++  +  +PL+ FIEH++ V  ++ + Q 
Sbjct: 108  PESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQN 167

Query: 529  DAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIP 708
            +APWGL RISHRE        +YLY+D AG  V +YV+DTG+D  H +F  RA WG  IP
Sbjct: 168  NAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIP 227

Query: 709  ENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNH 888
             ND+  D NGHGTH AG IGS+H+GVAK+ NI+AVKVLRSNG G++SDV+KG+E+   +H
Sbjct: 228  LNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSH 287

Query: 889  IAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAG 1068
            +              AN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE+++AC SSPA 
Sbjct: 288  L-ERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPAS 346

Query: 1069 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHV 1245
            AE+++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMA+PHV
Sbjct: 347  AEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHV 406

Query: 1246 AGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKK 1425
            AG+L+Y LSLQP + SEF    +S  QLK+K+++++T+ VL D+ E TPN L+YNGGG+ 
Sbjct: 407  AGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQD 466

Query: 1426 LDEFW 1440
            L +FW
Sbjct: 467  LSDFW 471

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL060C
            (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  436 bits (1121), Expect = e-148
 Identities = 212/424 (50%), Positives = 294/424 (69%), Gaps = 9/424 (2%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 375
            ++++P++YI+VF E +++     H ++++ A   SV+++ E  +F R+       N +FG
Sbjct: 68   TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGE---NNEFG 124

Query: 376  --------GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQED 531
                    GI+  F +    RGY GYFT++++ ++  +P V F+E +S V  S+ + Q  
Sbjct: 125  IAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNG 184

Query: 532  APWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPE 711
            APWGL R+SHRE+   G   +YLY+D +G GVTSYV+DTGI+ +H DFE RA WG  IP 
Sbjct: 185  APWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPN 244

Query: 712  NDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHI 891
            ND   D NGHGTHCAG I S+ +GVAK  N++AVKVLRSNG G++SDV++G+EY  K H 
Sbjct: 245  NDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHR 304

Query: 892  AXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGA 1071
                         TAN+SLG  +S A+++AV+AAVD G+HFA+AAGNE++DAC +SPA +
Sbjct: 305  KAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAAS 364

Query: 1072 EKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
            +K+ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG
Sbjct: 365  QKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAG 424

Query: 1252 ILSYLLSLQPAQDSEF-FYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKL 1428
            +L+Y LSLQP  DSEF    T+SP+ LK+K++ F T+  L  +   T N L+YNGGG  L
Sbjct: 425  LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484

Query: 1429 DEFW 1440
             +FW
Sbjct: 485  SDFW 488

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
            Anc_6.14 YOR003W
          Length = 531

 Score =  435 bits (1119), Expect = e-148
 Identities = 214/419 (51%), Positives = 290/419 (69%), Gaps = 1/419 (0%)
 Frame = +1

Query: 187  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 366
            L  S S   +YII+F E +T   I +H Q++Q+               L T   SA    
Sbjct: 88   LSASSSRSNKYIILFKEGVTAEQISAHKQLLQQV-------------LLETSDVSAQGI- 133

Query: 367  QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 546
                +  SFD+ G+  GY    +  V+E+V + P V+ +E +S V  +    Q +APWGL
Sbjct: 134  -VADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGL 192

Query: 547  HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 726
             RISHR+    G   +YLY+DAAG GV SY++DTGI+ +H++FEGRA+WG  IP+ND   
Sbjct: 193  ARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDE 252

Query: 727  DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            D NGHGTHCAG I S+H+GVAK  N++AVKVLRSNG G++SDVI G+E+ AK H +    
Sbjct: 253  DGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKS 312

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 1086
                    TAN+SLG  KSP+++  V+AAV  G+HF++AAGNE++DAC +SPA +E++IT
Sbjct: 313  NDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAIT 372

Query: 1087 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 1266
            VGAST SDDRA+FSNWG+CVD+FAPG+NI+STY GS +AT +LSGTSMA+PHVAG+L+Y 
Sbjct: 373  VGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYF 432

Query: 1267 LSLQPAQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LSLQP + S+F     ++P+QLK+K+L +ST+GVL D+ E+TPN L+YNGGG  L +FW
Sbjct: 433  LSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
            Ashbya gossypii ACR012C
          Length = 575

 Score =  436 bits (1121), Expect = e-148
 Identities = 212/420 (50%), Positives = 291/420 (69%), Gaps = 5/420 (1%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA----SASPN 363
            S+++P+RYI++F + +T+  +  H  ++  A   +++++    SF            S  
Sbjct: 106  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 364  PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 543
               GGI+  F+I G  RGY GYFTD +++++ +  LVK IE +S V  S+   Q  APWG
Sbjct: 166  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 544  LHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 723
            L R+SHRER   G   +YLY+D AG GVT+YV+DTGI+ +H +FEGRA+WG  IP ND  
Sbjct: 226  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 724  SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXX 903
             D NGHGTHCAG I S+ +GVAKN  ++AVKVLR+NG GT+SDV++G+EYV   H     
Sbjct: 286  YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKA 343

Query: 904  XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSI 1083
                     TAN+SLG  KS A+E+AV+AAV  G+HFA+AAGNE++DAC +SPA ++K I
Sbjct: 344  SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 1084 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSY 1263
            TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 404  TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 1264 LLSLQPAQDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
             LSLQP   SE++   ++SP+ LK+KI+ + ++ +L +V   T N L++NGGG  LD FW
Sbjct: 464  FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
            [2043 nt, 681 aa]
          Length = 680

 Score =  436 bits (1122), Expect = e-146
 Identities = 214/416 (51%), Positives = 294/416 (70%), Gaps = 3/416 (0%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            +P +YIIVF +D++ + ++ H  +I +AQ    S   E  S +             GGI+
Sbjct: 232  IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSI------------LGGIE 279

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
             +F++  LF GY G+F +++++ +   P+V F+E +S V  +    Q +APWGL RISHR
Sbjct: 280  EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339

Query: 565  ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 744
            +    G   +YLY+D AG GVT+YV+DTGI+ +H++F GRA WG  IPEND+  D NGHG
Sbjct: 340  DGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHG 399

Query: 745  THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 924
            THCAG I S+++GVAKN  ++AVKVLRS+G GT+SDV+KG+EY A +H            
Sbjct: 400  THCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFK 459

Query: 925  XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 1104
              TAN+SLG  KS ++++AV+AAV  G+HFA+AAGNE++DAC SSPA +E +ITVGAST 
Sbjct: 460  GSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTL 519

Query: 1105 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 1284
            SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+LSY LS+QP 
Sbjct: 520  SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPD 579

Query: 1285 QDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFWR 1443
             DSEFF    +++SP QLK+K++ +ST+ +  D+ E+TPN LVYN  G  + +FW+
Sbjct: 580  ADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] {ON}
            complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  426 bits (1096), Expect = e-145
 Identities = 215/420 (51%), Positives = 281/420 (66%), Gaps = 5/420 (1%)
 Frame = +1

Query: 196  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLR-TVSASASPNPQF 372
            S+ +PY YI+VFNE +T   I  H + + + Q  SV+ +  D  F   + S+  + N   
Sbjct: 32   SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91

Query: 373  GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 552
            GG+   F I     GYTG FTDEV+E +   PLVKFIE +S V  + ++ Q +APWGL R
Sbjct: 92   GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151

Query: 553  ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 732
            ISHR R       +YLY+D  G GV +YV+DTGI+  + DF GRA WG  IP  +   D 
Sbjct: 152  ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211

Query: 733  NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXX 912
            NGHGTH AG I S H+GVAK   + AVKVLRSNG G++SDV+KG+EYV   H        
Sbjct: 212  NGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH--QRDVGT 269

Query: 913  XXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 1092
                   AN+SLG  KS ++++AVNAAV  GVHFA+AAGNE++DAC +SPA AE++ITVG
Sbjct: 270  AGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVG 329

Query: 1093 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 1272
            AST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMA+PH+AG+++Y LS
Sbjct: 330  ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389

Query: 1273 LQPAQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LQPA  S+F+       ++P QLK+KI+ F T+  L D+   TPN + YNG GK L++FW
Sbjct: 390  LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar to
            uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3 or
            uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  400 bits (1029), Expect = e-135
 Identities = 204/414 (49%), Positives = 273/414 (65%), Gaps = 2/414 (0%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            +P RYI++F + +T++ I+SH   I++   ++ S I   DS     +     + +  G+ 
Sbjct: 74   IPNRYIVLFKDFVTDKEIQSHLSAIEE---INSSSIFLQDSDFGKATQYNDISTRGIGLQ 130

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
              F I     GY GYFT+   + +   PLV+ +EH+S VRI+N   QE  PWGL RIS R
Sbjct: 131  HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190

Query: 565  ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 744
            E+        Y Y+D  G    ++V+DTGI  +HEDFEGRA WG  I END   DLNGHG
Sbjct: 191  EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250

Query: 745  THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 924
            THCAG I S+H+G+AK   ++AVKVLRS+G G++SDVI+G+EY  + +            
Sbjct: 251  THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNLK 309

Query: 925  XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 1104
                N+SLG+ KS A+  A++AA   G+ FA+AAGNE +DAC SSPA A   ITVG ST 
Sbjct: 310  GAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTL 369

Query: 1105 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 1284
            SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM++PHVAG+L+Y LSLQP 
Sbjct: 370  SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429

Query: 1285 QDSEFFYD--TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
              S+F+++   +SP+ LK+K+L ++T G L  +  ET N LVYNGGGK L +FW
Sbjct: 430  HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
            YOR003W
          Length = 585

 Score =  397 bits (1019), Expect = e-132
 Identities = 210/417 (50%), Positives = 282/417 (67%), Gaps = 8/417 (1%)
 Frame = +1

Query: 214  RYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGIDISF 393
            RYIIVF + +    ++ H +M+    +    +++E+        ASA  +  F  +  +F
Sbjct: 135  RYIIVFKKGVFKEQVDQHLKMMSALFR----RLSEEQRPAAAPGASALRDG-FDRVMDTF 189

Query: 394  DINGLFRGYTGYFTD-EVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRER 570
            ++ G F GY       ++++ +  +PLV ++E +S V  S    Q +APWGL RISHRE 
Sbjct: 190  EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWGLARISHREG 248

Query: 571  AKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGT 747
               G   +YLY  ++AG GVT+YV+DTGI   H +F  RAKWG  IP ND   D NGHGT
Sbjct: 249  LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308

Query: 748  HCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXX 927
            HCAG IGS H+GVAK  N++AVKVLRS+G GT+SDV+KG+E+VA  H             
Sbjct: 309  HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368

Query: 928  X----TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                 TAN+SLG  KSPA++ AVNAAV  GVHFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 369  NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
            ST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMA+PHVAG+L+YLLSL
Sbjct: 429  STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488

Query: 1276 QPAQDSEFFY--DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            QP + SEF+     ++P Q+K+KI+ ++T+  L D+  +TPN+L+YNGG    D FW
Sbjct: 489  QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
            YOR003W
          Length = 456

 Score =  389 bits (999), Expect = e-131
 Identities = 213/481 (44%), Positives = 289/481 (60%)
 Frame = +1

Query: 1    MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 180
            MN  LF     +  GG L +++PE+ +        +  R++        + +E+L   + 
Sbjct: 1    MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSR---TEVLEHLSAKQN 57

Query: 181  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 360
             +++       +YI++F         E H + ++   K    +  E D     ++     
Sbjct: 58   DIIKD------QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNI---- 107

Query: 361  NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 540
                      F I     GY      E ++++ QDP+V+ IE +S V       QED PW
Sbjct: 108  ----------FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPW 157

Query: 541  GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 720
            GL RIS R R + GQD  Y Y+DA    VT+YVLDTGI   HE F GRA+WG  I  ND 
Sbjct: 158  GLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDV 217

Query: 721  ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 900
              D +GHGTH AGII S  FGVAK   ++AVKVLRSNGEG +SDV+KGIE+V  +H    
Sbjct: 218  DEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---- 273

Query: 901  XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 1080
                        NLSLG+SKSPA+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++
Sbjct: 274  SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333

Query: 1081 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            ITVGAS FSD+RAFFSNWG CVDVFAPG+N+MSTYIGS NATLSLSGTS AAP+ AG+++
Sbjct: 334  ITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIA 393

Query: 1261 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            Y LSLQP +DS +F   ++P +LKEKI+ F ++ VL ++ E TPN ++YNG G+ L  FW
Sbjct: 394  YYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

Query: 1441 R 1443
            +
Sbjct: 454  K 454

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  376 bits (965), Expect = e-126
 Identities = 204/418 (48%), Positives = 265/418 (63%), Gaps = 6/418 (1%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            +P +YI++F  D T+   E+H   +                     S   + +PQ+  + 
Sbjct: 53   IPNQYIVLFKSDTTDIQRETHLATLN--------------------SWLLNTDPQYTILH 92

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
             SF +    +GYT    +++I  +  DP+++ IE +S V      +Q D+PWGL RIS R
Sbjct: 93   -SFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151

Query: 565  ERAKYGQDLEYLYEDAAGTGVTS-YVLDTGIDTEHEDFEGRAKWGAVI-PENDEASDLNG 738
            ER K  QD  Y Y+D+  +  T  Y+LDTGI+  H +F+GRAKWGAV  P      D NG
Sbjct: 152  ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211

Query: 739  HGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            HGTHCAG+IGS  +GVAKNT ++AVKVL + G+G +S VI+GIEYV + H          
Sbjct: 212  HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271

Query: 919  XXXXTA-NLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 1095
                +  NLSLG+ KSPA+   + AAV  GVHFA+AAGNED+DAC +SPA +  ++TVGA
Sbjct: 272  GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331

Query: 1096 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMAAPHVAGILSYLLS 1272
            S+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM+AP V G+++Y LS
Sbjct: 332  SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391

Query: 1273 LQPAQDSEFFYDTVS--PQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 1440
            LQP   S+F+    S  P QLK KI+ FST GVL ++ E TPNR+VYNGGG  L +FW
Sbjct: 392  LQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  364 bits (935), Expect = e-121
 Identities = 197/423 (46%), Positives = 269/423 (63%), Gaps = 11/423 (2%)
 Frame = +1

Query: 205  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 384
            +P +YI++F  D T+  I    Q +    +    K   +D++ + +S             
Sbjct: 63   IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSR----------FQ 112

Query: 385  ISFDINGLF-RGYTGYFTDEVIEIVFQ-DPLVKFIEHESTVRISNSSRQEDAPWGLHRIS 558
            IS D  G+  R     F ++V   +F    ++K IE +S V ++  + Q D+ WGL RIS
Sbjct: 113  ISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRIS 172

Query: 559  HRERAKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA-SDL 732
             R   K  QD  Y Y+D  +G GV  Y+LDTGI++ H +FEGRA WG  +P  + +  D 
Sbjct: 173  QRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDS 232

Query: 733  NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNH------IA 894
            NGHGTHCAGIIGS+ +GVAK TN++AVKVL   G+G++SDVI G+E+VA +H      I+
Sbjct: 233  NGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNIS 292

Query: 895  XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 1074
                          NLSLG+ KSP++++A+ +A   G+H  +AAGNEDEDAC++SPA + 
Sbjct: 293  SSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSP 352

Query: 1075 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMAAPHVAG 1251
              ITVGAS+FSDDRAFFSNWG CVDVFAPGINI STYIG + N TLSLSG+SM++P V+G
Sbjct: 353  AVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSG 412

Query: 1252 ILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLD 1431
            + +Y LSLQP   S+F    ++P QLK KI+ FST G+L ++  +T N+LVYNGGGK L 
Sbjct: 413  LTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLS 472

Query: 1432 EFW 1440
             FW
Sbjct: 473  GFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  337 bits (864), Expect = e-111
 Identities = 172/361 (47%), Positives = 236/361 (65%), Gaps = 2/361 (0%)
 Frame = +1

Query: 337  TVSASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNS 516
            +V A   P  QF    I+ ++ G        F    +  + Q P V+ +E  S V   N 
Sbjct: 63   SVLAGRFPLAQFEQFHIADELIGFT---VKNFPFHNVYFLLQIPFVEMVETNSKVYALNV 119

Query: 517  SRQEDAPWGLHRISHRERAKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDFEGRAKW 693
            + QED PWGL R+S R+R + G +  Y Y+   +   V  Y+LDTGI  +HE+FEGRA+W
Sbjct: 120  TVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARW 179

Query: 694  GAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY 873
            G  I  ND   D NGHGTHCAGI+G   +GVAK  N++AVKVL + G+G +SDVI+GIE+
Sbjct: 180  GKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEF 239

Query: 874  VAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACL 1053
                H+               NLSLG+ +SPA++  V AA++ GVHFA+AAGNED++AC 
Sbjct: 240  AVNEHLTRNQDEVRGSII---NLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACY 296

Query: 1054 SSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSM 1230
            SSPA  +  +TVG STFSDDRAFFSNWG C+DVFAPG+N+ S+Y+G ++N TLSLSGTS 
Sbjct: 297  SSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTST 356

Query: 1231 AAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYN 1410
            +APHVAG+++YLLSL+P   S+F     +P QLK+K++  +T G L +V ++T N +++N
Sbjct: 357  SAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKLVSLATEGKLFEVPDDTANLMIFN 416

Query: 1411 G 1413
            G
Sbjct: 417  G 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
            similarities with uniprot|P09232 Saccharomyces cerevisiae
            YEL060c or uniprot|P25036 Saccharomyces cerevisiae
            YOR003w YSP3
          Length = 579

 Score =  276 bits (706), Expect = 8e-86
 Identities = 158/486 (32%), Positives = 258/486 (53%), Gaps = 8/486 (1%)
 Frame = +1

Query: 7    MKLFNILLILCAGGTL--CMIIPELNEIAYYSET--FENFRNAKAQDGLGQQNIENLHLG 174
            M+L NI+ ++    +L   +++P++N +   SE+  ++NF     + G  +  +    LG
Sbjct: 1    MRLSNIITLVIGIISLSNAIVLPDINTLEQTSESQEYDNFFKQSKRPGNVKAPLV-APLG 59

Query: 175  RQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASA 354
                ++ +  +PYRYI++F        I+ H Q + K Q      +  +D F        
Sbjct: 60   ENDEIQNN-IVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKE 118

Query: 355  SPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDA 534
                + GG+  +FDI   F GY GYFTDEV+E + +  +V ++E +S + I +     ++
Sbjct: 119  FSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNS 178

Query: 535  PWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPEN 714
             W L RISHR +       EY ++   G  + +Y+LDTG+   H  +  R   G VI  N
Sbjct: 179  HWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPN 238

Query: 715  DEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA 894
            ++  D+NGHGT  AG++G R  GVA+   ++ VKVL   G GTVS++IKG+ +V  NH  
Sbjct: 239  EDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV--NHHH 296

Query: 895  XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 1074
                            S+  +KS ++  A +  V  G+H  + AG +  +AC SSPA + 
Sbjct: 297  PQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSS 356

Query: 1075 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNA---TLSLSGTSMAAPH 1242
            K ITV   + +D+     NWG+CVD++ PG  + +TY    RN     +S++G+S AA  
Sbjct: 357  KPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQ 416

Query: 1243 VAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGK 1422
            VAG+L+Y  SLQP   +      ++P++LKE+++ F T+G L ++   +PN + +NG G 
Sbjct: 417  VAGLLAYFASLQPGLGTPDVI-PLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGG 475

Query: 1423 KLDEFW 1440
             LD F+
Sbjct: 476  NLDSFF 481

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar to
            uniprot|P25381 Saccharomyces cerevisiae YCR045C
            Hypothetical ORF
          Length = 479

 Score =  209 bits (532), Expect = 3e-61
 Identities = 138/369 (37%), Positives = 193/369 (52%), Gaps = 24/369 (6%)
 Frame = +1

Query: 403  GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQ------------EDAPWGL 546
            G F G+T  F  + +E + ++PLV  +   S   + +   Q            EDAP  L
Sbjct: 59   GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 547  HRISHRERAKYG------QDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVI 705
             R+S R    Y       Q+  Y Y+    G  V +Y++DTGI  +H+D  GRA +GA +
Sbjct: 119  ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 706  PENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKN 885
               +   D NGHGTH AGI+GSR FGVAK  N++ VK L + G+G ++ VI  IE+ + N
Sbjct: 179  V-GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEF-SVN 236

Query: 886  HIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPA 1065
            H               ANLSLGS ++  +  AV AAV+ G+   +AAGN + +AC +SPA
Sbjct: 237  H------CKKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 1066 GAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPH 1242
             A  +ITVGA    +D  A FSNWG CVDVFA G+ +MS         ++ SGTSMA+P 
Sbjct: 291  SAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPS 350

Query: 1243 VAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRLVYN 1410
            VAG+ + LL              + P  +K+KI+  +T  V           TPNR+ +N
Sbjct: 351  VAGLAAVLLD-----------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFN 399

Query: 1411 GGGKKLDEF 1437
            G  K+ D F
Sbjct: 400  GVRKEDDIF 408

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  204 bits (518), Expect = 3e-59
 Identities = 137/386 (35%), Positives = 194/386 (50%), Gaps = 41/386 (10%)
 Frame = +1

Query: 403  GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVR------ISNSSRQED----------- 531
            G FRG T   T +V+  + ++PLV  +     +         N+   +D           
Sbjct: 63   GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKN 122

Query: 532  ---------APWGLHRISHR--------ERAKYGQDLEYLYED-AAGTGVTSYVLDTGID 657
                     AP  L R+S R        ++  Y   L Y Y     GT V +Y++D+GID
Sbjct: 123  SYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGID 182

Query: 658  TEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGE 837
               E+FEGRA  G  +   +   D NGHGTH AG++GS+ +GVAKN  ++ VK L   G 
Sbjct: 183  INQEEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGS 241

Query: 838  GTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFA 1017
            G++  VI  +E+V  NH               ANLSLG+   P +  A+ A VD GV   
Sbjct: 242  GSLITVISALEFVV-NHCGKSKSKKC-----VANLSLGAFMMPLLNEAIKATVDSGVVVV 295

Query: 1018 IAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTY 1185
            +AAGN + DAC  SPA  + +ITVGA    DDR    A FSNWG+CVD+FAPG+ I S  
Sbjct: 296  VAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLS 352

Query: 1186 IGSRNATLSLSGTSMAAPHVAGILSYLL--SLQPAQDSEFFYDTVSPQQLKEKILKFSTR 1359
            I     ++  SGTSMA+P VAGI+S LL   ++     ++ ++  +    +++ L F  R
Sbjct: 353  IKDNQKSVEFSGTSMASPQVAGIVSILLDQGVENEDIRDYLFELATDDVFQKRTLLFKPR 412

Query: 1360 GVLGDVNEETPNRLVYNGGGKKLDEF 1437
                     TPNR+ +NG  KK ++F
Sbjct: 413  ---------TPNRITFNGISKKDEDF 429

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
            YCR045C (REAL)
          Length = 527

 Score =  201 bits (511), Expect = 8e-58
 Identities = 141/392 (35%), Positives = 199/392 (50%), Gaps = 39/392 (9%)
 Frame = +1

Query: 379  IDISFDINGLFRGYTGYFTDEVIEIVFQDPLV-------KFIEHESTVRIS--------- 510
            I+  F I G FRG T   +  ++  + + PL+       KF   ++   +S         
Sbjct: 89   IEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKY 147

Query: 511  ---------NSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYEDA-AGTGVTSY 636
                     N + Q DAP  L RIS          ++ +Y     Y YED   G GV +Y
Sbjct: 148  AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAY 207

Query: 637  VLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVK 816
            ++DTGI  EH +FE R   G  + + +   D NGHGTH AG++GSR FG AK  +++ VK
Sbjct: 208  IMDTGIHAEHPEFEDRVIQGVDLTK-EGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVK 266

Query: 817  VLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAV 996
            VL  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A+
Sbjct: 267  VLGKDGSGEASNVLSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAI 323

Query: 997  DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINI 1173
            + G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I
Sbjct: 324  EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 383

Query: 1174 MSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFS 1353
             S    + N +L LSGTSM+ P V G+ + LLS             + P+ + ++I   S
Sbjct: 384  ESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPELIAQEIEYLS 432

Query: 1354 TRGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
            TR V           TPN+++YNG  K  D +
Sbjct: 433  TRNVFHRRTLFFKPSTPNQILYNGVDKLDDPY 464

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
            (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  198 bits (503), Expect = 3e-57
 Identities = 124/338 (36%), Positives = 188/338 (55%), Gaps = 9/338 (2%)
 Frame = +1

Query: 451  IVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERA-KYGQDLEYLYEDAAGTGV 627
            + + D ++  I+ E+   +S  SR+   P+ ++ I   + A  Y  D +Y      G+ V
Sbjct: 106  LTYSDKII--IQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKY-----QGSSV 158

Query: 628  TSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNIL 807
             +Y++DTGI  EH +FEGR K+ A+    +   D NGHGTH AGI+GS+ FGVAK  NI+
Sbjct: 159  NAYIIDTGIYKEHPEFEGRVKF-AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNII 217

Query: 808  AVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVN 987
             VK L   G+G +S ++K +E+  ++                ANLS G+ ++  ++ A+ 
Sbjct: 218  DVKALDKKGQGQLSTILKALEFTIRH------CKESVDKKCVANLSFGAIRTAIIDEAIK 271

Query: 988  AAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVF 1155
             A + G+   +AAGN + DAC +SPA ++  ITVGA    DDR    A FSNWG+CVDVF
Sbjct: 272  EAHNAGIVLVVAAGNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVF 328

Query: 1156 APGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKE 1335
            APG+ + S    + +  L LSGTSMA+P V+GI + LL              ++P+ +K 
Sbjct: 329  APGVKVKSLSHINGSDVLLLSGTSMASPSVSGIAAILLD-----------KGLNPKFVKS 377

Query: 1336 KILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
            KI++ ST+ +       +   TPN +V+NG  K  D F
Sbjct: 378  KIIESSTKNIFHQGTIMIKPNTPNLIVFNGIEKMDDSF 415

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
            Anc_6.313
          Length = 492

 Score =  198 bits (503), Expect = 6e-57
 Identities = 131/386 (33%), Positives = 199/386 (51%), Gaps = 41/386 (10%)
 Frame = +1

Query: 403  GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQED----------------- 531
            G F+G+T   TD+++E + ++PLV  +     V      + E+                 
Sbjct: 65   GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 532  -------APWGLHRISHRERAKYG--------QDLEYLYEDAA-GTGVTSYVLDTGIDTE 663
                   AP  L R+S R++  Y           L+Y Y+  + G  V +Y++D+GI  E
Sbjct: 125  SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLE 184

Query: 664  HEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGT 843
            HE+F GRA  G  +   + + D NGHGTH AGI+GS+ +GVAK   ++ +KVL   G+G+
Sbjct: 185  HEEFNGRAIPGIDLT-GEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGS 243

Query: 844  VSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIA 1023
            ++ V+ GIE+  K+                ANLSLGS ++  +  A+ AA+D G+   +A
Sbjct: 244  LAMVLGGIEFAVKH-----CQETSKKGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVA 298

Query: 1024 AGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIG 1191
            AGN + +AC  SPA A ++ITVGA    DDR    A FSNWG C+D+FAPG+ I S  I 
Sbjct: 299  AGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIF 355

Query: 1192 SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLG 1371
                 ++ SGTSMA+P VAG+ +  L              VS +++K+ IL+  T  V  
Sbjct: 356  KDKEDVTYSGTSMASPTVAGLAALTLD-----------QGVSAEEVKDYILEMGTDNVFH 404

Query: 1372 D----VNEETPNRLVYNGGGKKLDEF 1437
                     TPN++ +NG  +  +E+
Sbjct: 405  RRSLLFKPGTPNKICFNGVKRNEEEY 430

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
            RRT12Probable subtilisin-family protease with a role in
            formation of the dityrosine layer of spore walls;
            localizes to the spore wall and also the nuclear envelope
            and ER region in mature spores
          Length = 491

 Score =  197 bits (502), Expect = 8e-57
 Identities = 127/331 (38%), Positives = 177/331 (53%), Gaps = 14/331 (4%)
 Frame = +1

Query: 487  HESTVRISNSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYE-DAAGTGVTSYV 639
            +E      N + Q DAP  L RIS          ++ +Y     Y YE D  G  V +Y+
Sbjct: 113  YEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYI 172

Query: 640  LDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKV 819
            +DTGI  +H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKV
Sbjct: 173  MDTGIFADHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKV 231

Query: 820  LRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVD 999
            L  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++
Sbjct: 232  LGKDGSGEASNVLSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIE 288

Query: 1000 CGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIM 1176
             G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 289  EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 348

Query: 1177 STYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFST 1356
            S    + N TL LSGTSM+ P V G+ + LLS             + P+ + ++I   ST
Sbjct: 349  SLSHLNYNDTLILSGTSMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLST 397

Query: 1357 RGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
            R V           TPN+++YNG  K  D +
Sbjct: 398  RNVFHRRTLFFKPSTPNQILYNGVDKLDDPY 428

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
            YCR045C (REAL)
          Length = 491

 Score =  197 bits (501), Expect = 1e-56
 Identities = 126/331 (38%), Positives = 178/331 (53%), Gaps = 14/331 (4%)
 Frame = +1

Query: 487  HESTVRISNSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYEDA-AGTGVTSYV 639
            +E+     N + Q DAP  L RIS          ++ +Y     Y YED   G  V +Y+
Sbjct: 113  YENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYI 172

Query: 640  LDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKV 819
            +DTGI  +H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKV
Sbjct: 173  MDTGIFADHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKV 231

Query: 820  LRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVD 999
            L  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++
Sbjct: 232  LGKDGSGEASNVLSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIE 288

Query: 1000 CGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIM 1176
             G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 289  EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 348

Query: 1177 STYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFST 1356
            S    + N TL LSGTSM+ P V G+ + LLS             + P+ + +++   ST
Sbjct: 349  SLSHLNFNDTLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLST 397

Query: 1357 RGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
            R V           TPN+++YNG  K  D +
Sbjct: 398  RNVFHRRTLFFKPSTPNQILYNGVDKLDDRY 428

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] {ON}
            YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  197 bits (500), Expect = 2e-56
 Identities = 125/319 (39%), Positives = 178/319 (55%), Gaps = 14/319 (4%)
 Frame = +1

Query: 523  QEDAPWGLHRISHRERAKYGQD--------LEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 675
            Q++AP  L RIS R    Y  +          Y Y+D+  GT V +YV+DTGI  EH  F
Sbjct: 133  QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 676  EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 855
            +GRAK+GA +   +   DLNGHGTH AG+IGS+ +GVAK+ +++ VK L + G+G ++ V
Sbjct: 193  QGRAKFGADLV-GEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 856  IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 1035
            I  IE+   NH               ANLSLGS ++  +  AV AA++ GV   +AAGN 
Sbjct: 252  ISAIEFTV-NH------CRKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 1036 DEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLS 1212
            + +AC SSPA +  +I+VGA    +D  A FSNWG CVD+FAPG+ I S        +++
Sbjct: 305  NANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVA 364

Query: 1213 LSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----VN 1380
             SGTSMA+P V G+++ LL              + P  +KE+++  +T  V         
Sbjct: 365  YSGTSMASPLVTGMVAVLLD-----------SGIHPFDIKEELINTATDSVFHKRALLFK 413

Query: 1381 EETPNRLVYNGGGKKLDEF 1437
              TPNR+ + G  K+ D F
Sbjct: 414  PGTPNRVAFTGVEKEDDIF 432

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
            similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045C Hypothetical ORF
          Length = 496

 Score =  196 bits (497), Expect = 4e-56
 Identities = 133/366 (36%), Positives = 191/366 (52%), Gaps = 14/366 (3%)
 Frame = +1

Query: 382  DISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 561
            ++ F++     G  G+  DE  +  + D   +  E E    + +   Q+ AP  L RIS 
Sbjct: 89   NVEFNVFDAVEGLEGWGDDEDEDGDYDDDNEEG-EDEGDDDVLSIVAQKKAPRHLARISR 147

Query: 562  RERAKYGQD--------LEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPEN 714
            R    Y  +          Y Y+D  +GT V +YV+DTGI  EH   EGRAK+GA +   
Sbjct: 148  RTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQLEGRAKFGADLV-G 206

Query: 715  DEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA 894
            +   D NGHGTH AG+IGSR FGVAK+ +++ VK L + G+G ++ VI  IE+   NH  
Sbjct: 207  EGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTV-NH-- 263

Query: 895  XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 1074
                         ANLSLGS ++  +  AV AA++ GV   +AAGN + +AC SSPA + 
Sbjct: 264  ----CRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNANACWSSPASSL 319

Query: 1075 KSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
             +ITVGA    +D  A FSNWG CVD+FAPG+ I S         ++ SGTSMA+P V+G
Sbjct: 320  SAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFSGTSMASPIVSG 379

Query: 1252 ILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRLVYNGGG 1419
            +++ LL              + P  +K +++  +T  V           TPNR+ + G  
Sbjct: 380  MVANLLD-----------SGIHPFDIKTELIDLATDSVFHKRTLLFKPGTPNRVAFTGID 428

Query: 1420 KKLDEF 1437
            K  D +
Sbjct: 429  KTDDVY 434

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar to
            uniprot|P25381 Saccharomyces cerevisiae YCR045C
            Hypothetical ORF
          Length = 490

 Score =  195 bits (495), Expect = 8e-56
 Identities = 130/386 (33%), Positives = 197/386 (51%), Gaps = 41/386 (10%)
 Frame = +1

Query: 403  GLFRGYTGYFTDEVIEIVFQDPLV-------KFIEHESTVRISNSSR------------- 522
            G FRG T   + +V+E +  +PLV       +F   +  + +    +             
Sbjct: 59   GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGF 118

Query: 523  -------QEDAPWGLHRISHRERAKYGQDLEYLYEDA---------AGTGVTSYVLDTGI 654
                   Q +AP  L R+S R    Y  D E  YE++          G  + +Y++DTGI
Sbjct: 119  NPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGI 178

Query: 655  DTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNG 834
              EH+DF GRA +G      +   D NGHGTH AGI+GS +FGVAK  N++ VK L + G
Sbjct: 179  YKEHKDFCGRAIFGRDFT-GEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRG 237

Query: 835  EGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHF 1014
            +G ++ VI  +E+ A NH               ANLSLG+ ++  +  A+ AA + G+  
Sbjct: 238  QGNLTTVISAVEF-AVNH-----CKSSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLII 291

Query: 1015 AIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIG 1191
             +AAGN + +AC +SPA A ++ITVGA    +D  A FSNWG CVD+FA G+ + S    
Sbjct: 292  VVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAF 351

Query: 1192 SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLG 1371
              +  ++ SGTSMA+P V G+++ LL              V P+ +K K+++ +T  +L 
Sbjct: 352  PPHKPIAFSGTSMASPSVTGLVAILLD-----------KGVEPENIKAKLVELATHDLLQ 400

Query: 1372 D----VNEETPNRLVYNGGGKKLDEF 1437
                     TPNR+ +NG  ++ DE+
Sbjct: 401  RRTLFFKPGTPNRIAFNGMEREDDEY 426

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] {ON}
            Anc_6.313 YCR045C
          Length = 436

 Score =  192 bits (488), Expect = 2e-55
 Identities = 130/350 (37%), Positives = 186/350 (53%), Gaps = 18/350 (5%)
 Frame = +1

Query: 442  VIEIVFQDPLVKFIEHESTVRISNSS---RQEDAPWGLHRISHRERAKYGQDLE------ 594
            V E+V     V + EH+      NS    RQ  AP  L R+S R +  Y  + E      
Sbjct: 84   VAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEG 143

Query: 595  ---YLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGI 762
               Y Y++   G G+ +Y++DTGI  EH +F GRA +G  +   +   D NGHGTH AGI
Sbjct: 144  SFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLT-GEGPGDGNGHGTHVAGI 202

Query: 763  IGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANL 942
            +GS  +GVAK+  ++ VK L + G+G ++ VI  +E+ A NH                NL
Sbjct: 203  VGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEF-AVNH-----CRSSEGKGCVINL 256

Query: 943  SLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRA 1119
            SLG+ ++  +  AV AA + G+   +AAGN + +ACL+SPA A ++ITVGA    +D  A
Sbjct: 257  SLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTDSIA 316

Query: 1120 FFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEF 1299
             FSNWG+CVD+FAPG+ + S         +  SGTSMA+P + G+ + LL      D   
Sbjct: 317  KFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL------DEGV 370

Query: 1300 FYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
             YD     ++K+ ILK +T  V           TPNR+ +NG  K  D+F
Sbjct: 371  PYD-----KIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKNDDKF 415

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
            similarities with uniprot|P25036 Saccharomyces cerevisiae
            YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  192 bits (489), Expect = 8e-55
 Identities = 129/321 (40%), Positives = 179/321 (55%), Gaps = 16/321 (4%)
 Frame = +1

Query: 523  QEDAPWGLHRISHR------ERAKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEG 681
            Q  AP  L RIS R      E+      L+Y Y E+  G GV  YVLD+G++ +H DFEG
Sbjct: 154  QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 682  RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 861
            RA  G +    + + DL GHGTH AG+IGS+ +GVAK  NI+ VKVL S G+GTV+++I+
Sbjct: 214  RAMKG-IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNIIE 272

Query: 862  GIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPA-MEMAVNAAVDCGVHFAIAAGNED 1038
            G+EYV    I               N+SLG+  + + ++ AV+A ++ GV   +A GN  
Sbjct: 273  GLEYVVNQCIG-------KKRKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNSG 325

Query: 1039 EDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNAT 1206
             +AC  SPA   K+ITV A    DDR    A FSNWG C+D++APG+N+ S     R  T
Sbjct: 326  LNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGR-GT 381

Query: 1207 LSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD---- 1374
              LSGTSMA+P VAG  +  L                P ++++ + K +TRGV       
Sbjct: 382  FVLSGTSMASPIVAGAAAIYLD-----------QGADPAEVRKILSKTATRGVFKKRAIA 430

Query: 1375 VNEETPNRLVYNGGGKKLDEF 1437
            V   TPN+++Y G  ++ DEF
Sbjct: 431  VRPRTPNKVLYTGNNQEDDEF 451

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
            Anc_6.313 YCR045C
          Length = 475

 Score =  190 bits (482), Expect = 4e-54
 Identities = 132/410 (32%), Positives = 205/410 (50%), Gaps = 29/410 (7%)
 Frame = +1

Query: 295  VSVSKITEDDSFLRTVSASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLV 474
            V+++  +  + F+ +V +        G I+  F I G  +G T   + +V++ + + P V
Sbjct: 24   VTLNDDSRSERFMNSVLSKDLKWFMGGKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFV 82

Query: 475  KFIEHESTVR------------ISNSSRQEDAPWGLHRISHRERAKYGQDLEYLYED--- 609
            K +     V+            +    RQ  AP  L RIS R +  Y  + +  Y D   
Sbjct: 83   KEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFN 142

Query: 610  ------AAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGS 771
                  A G    +Y+LDTG+  +H++FE R ++G       E  DLNGHGTH AG++GS
Sbjct: 143  YYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGS 201

Query: 772  RHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLG 951
            + FGVAK+  ++ VK L + G GT+  ++  +E+  ++                 N+SLG
Sbjct: 202  KTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQD------CQEHEDSQCVLNMSLG 255

Query: 952  SSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----A 1119
            S KS  +  A+N     G+   +AAGN + +AC +SP+ A  +ITVGA    DDR    A
Sbjct: 256  SVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIA 312

Query: 1120 FFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEF 1299
             FSNWG CVD+FAPG+N+ S       + +  SGTSMA+P V G+++ LL          
Sbjct: 313  KFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD--------- 363

Query: 1300 FYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
              D V P+ +++ + + +T GV           TPN ++YNG  K  DE+
Sbjct: 364  --DGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNGNKKHDDEY 411

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
            YCR045C (REAL)
          Length = 540

 Score =  191 bits (485), Expect = 6e-54
 Identities = 125/331 (37%), Positives = 175/331 (52%), Gaps = 14/331 (4%)
 Frame = +1

Query: 487  HESTVRISNSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYEDA-AGTGVTSYV 639
            +E      N + Q DAP  L RIS          ++ +Y     Y YED   G  V +Y+
Sbjct: 162  YEDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYI 221

Query: 640  LDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKV 819
            +DTGI ++H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKV
Sbjct: 222  MDTGIFSDHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKV 280

Query: 820  LRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVD 999
            L  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++
Sbjct: 281  LGKDGSGEASNVLSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIE 337

Query: 1000 CGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIM 1176
             G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 338  EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 397

Query: 1177 STYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFST 1356
            S    +   TL LSGTSM+ P V G+ + LLS             + P  + ++I   ST
Sbjct: 398  SLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS-----------KGIEPALIAQEIEYLST 446

Query: 1357 RGVLGD----VNEETPNRLVYNGGGKKLDEF 1437
            R V           T N+++YNG  K  D +
Sbjct: 447  RNVFHRRTLFFKPSTANQILYNGVDKLDDPY 477

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
            (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  190 bits (483), Expect = 7e-54
 Identities = 122/316 (38%), Positives = 173/316 (54%), Gaps = 19/316 (6%)
 Frame = +1

Query: 523  QEDAPWGLHRISHRERA--------KYGQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 675
            Q  AP  L RIS R +         ++ + + Y YED   G+ + +Y+LDTGI  EH DF
Sbjct: 154  QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 676  EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 855
            E R   GA +   +   D NGHGTH AGI+GS+ FGVAKN  ++ VKVL   G G ++ V
Sbjct: 214  ENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 856  IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 1035
            + GI++   +                AN+SLG+ ++  +  A++ A   G+   +AAGN 
Sbjct: 273  LSGIQFAVDH---CRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 1036 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINI--MSTYIGSR 1197
            +  AC +SPA A+ +ITVGA    DDR    A+FSNWG CVD+FAPG+ I  +S    S 
Sbjct: 330  NVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESH 386

Query: 1198 NATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDV 1377
            +  ++ SGTSMA+P VAG+ + LL              V P  +K+K+L  ST+ V   +
Sbjct: 387  HKHVTHSGTSMASPVVAGLAAILLD-----------KGVEPFDVKDKLLHLSTKDVFNKL 435

Query: 1378 ----NEETPNRLVYNG 1413
                   TPN++ YNG
Sbjct: 436  TLFFKYGTPNKIAYNG 451

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  192 bits (489), Expect = 4e-53
 Identities = 122/318 (38%), Positives = 174/318 (54%), Gaps = 13/318 (4%)
 Frame = +1

Query: 523  QEDAPWGLHRISHRERAKYGQ--DLEYLY-----EDAAGTGVTSYVLDTGIDTEHEDFEG 681
            Q DAP  L R   R    +    D EY +     E+  G GV  YVLD+GI   H +F+G
Sbjct: 428  QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDG 487

Query: 682  RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 861
            RA +G +    +   DLNGHGTH AG++GSR FG+AK  NI  +KV+  +G G+ S++I 
Sbjct: 488  RAHFG-IDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNIIA 546

Query: 862  GIEYVAKNHIAXXXXXXXXXXXXTANLSLG--SSKSPAMEMAVNAAVDCGVHFAIAAGNE 1035
            G+E+  K+                AN+SLG  S    A++ AV AA++ G+ F +AAGN 
Sbjct: 547  GVEFAVKH-------CQQSGKRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNS 599

Query: 1036 DEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLS 1212
             E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N    
Sbjct: 600  KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTMRV 659

Query: 1213 LSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD---VNE 1383
            L+GTSM+AP  AG+++ LL              + P ++K+ +L  ST+G+      V+ 
Sbjct: 660  LNGTSMSAPITAGVVAVLLD-----------QGIEPHEVKDHLLSISTKGLFHKRRLVSS 708

Query: 1384 ETPNRLVYNGGGKKLDEF 1437
             TP+R ++ G  ++ D F
Sbjct: 709  RTPDRALFTGVKREDDSF 726

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
            Ashbya gossypii AAR069W
          Length = 610

 Score =  184 bits (466), Expect = 9e-51
 Identities = 113/291 (38%), Positives = 164/291 (56%), Gaps = 7/291 (2%)
 Frame = +1

Query: 586  DLEYLYE-DAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGI 762
            +  Y Y+ +  G  V  Y+LD+GI   H +FEGRA +G +   N+   DLNGHGTH AG+
Sbjct: 297  EFNYYYDAEHLGETVNVYILDSGIHKSHPEFEGRAVFG-IDTTNEGPGDLNGHGTHVAGL 355

Query: 763  IGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANL 942
            +GS+ +G AK   I  VKV+  +G G+ S++I G+E+  K+                AN+
Sbjct: 356  VGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIAGVEFAVKH-------CQQSGKKCVANM 408

Query: 943  SLG--SSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDD 1113
            SLG  S    A++ AV AA++ G+ F +AAGN  E AC  SPA  + +ITVGA    SD 
Sbjct: 409  SLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDI 468

Query: 1114 RAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDS 1293
             A FSN+G CVD+FAPG+ + S      N    L+GTSM+AP  AG+++ LL        
Sbjct: 469  IASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVLNGTSMSAPITAGVVAVLLD------- 521

Query: 1294 EFFYDTVSPQQLKEKILKFSTRGVLGD---VNEETPNRLVYNGGGKKLDEF 1437
                  V  + +KE+++  ST+GV      V+  TP+R ++NG  ++ D F
Sbjct: 522  ----QGVKHEDVKERLIDLSTKGVFHRRRLVSSRTPDRTLFNGVPQEDDVF 568

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
            Anc_6.313 YCR045C
          Length = 734

 Score =  184 bits (468), Expect = 2e-50
 Identities = 125/327 (38%), Positives = 171/327 (52%), Gaps = 17/327 (5%)
 Frame = +1

Query: 484  EHESTVRISNSSRQEDAPWGLHRISHRERAKYG--------QDLEYLYEDA-AGTGVTSY 636
            EH   V+ S    Q  AP  L RIS R++  +         + L Y Y+D   G GV +Y
Sbjct: 275  EHHKHVK-SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAY 333

Query: 637  VLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVK 816
            V+DTGI  EH+DFE R ++G  +   + A DLNGHGTH AG+IGS+ +GV K   I+ VK
Sbjct: 334  VIDTGILKEHKDFEDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVK 392

Query: 817  VLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAV 996
             +   G   +S +I+ IEY   +                 N+SLGS     +  AV +A+
Sbjct: 393  AVSLTGSTQLSHIIEAIEYTVND-----CNSRVDKKACVVNMSLGSFYVKVINEAVESAI 447

Query: 997  DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPG 1164
              GV F +AAGN + DAC SSP  ++ +ITVGA    DDR    A FSNWG CVD+FA G
Sbjct: 448  AEGVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASG 504

Query: 1165 INIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKIL 1344
            + + S         +  SGTSMA+P V G +S LLS             V P  ++E+++
Sbjct: 505  VEVKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLS-----------QGVKPNDVQEEMV 553

Query: 1345 KFSTRGVLGD----VNEETPNRLVYNG 1413
            K ST+G            T NR+++NG
Sbjct: 554  KLSTKGDFTRRSLIFKPFTSNRILFNG 580

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
            Anc_6.313 YCR045C
          Length = 478

 Score =  178 bits (452), Expect = 9e-50
 Identities = 130/380 (34%), Positives = 190/380 (50%), Gaps = 35/380 (9%)
 Frame = +1

Query: 403  GLFRGYTGYFT----DEVIEIVFQDPLVKFI--------------EHESTVRISNSSRQE 528
            G F+G T         +++E + Q+PLV  I               +E T    +   Q 
Sbjct: 61   GKFKGITMNIAHNKKQKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQS 120

Query: 529  DAPWGLHRISHRER--------AKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEG 681
            +AP  L RIS R++        + Y +   Y Y ++  G  V +Y+LD+G+     DFEG
Sbjct: 121  EAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEG 180

Query: 682  RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 861
            R ++G     + E  D NGHGTH AG++GS+ +GVAK   ++ VK L   G GT+  V+ 
Sbjct: 181  RVEFGFDFTGDGEG-DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLS 239

Query: 862  GIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE 1041
             IE+   +                ANLSLGS K+  +  A+ AA + GV   +AAGN + 
Sbjct: 240  AIEFAVND------CHEHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNI 293

Query: 1042 DACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATL 1209
            +AC +SPA AE++ITVGA    DDR    A FSNWG CVD++APG+ + S         +
Sbjct: 294  NACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNI 350

Query: 1210 SLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----V 1377
            S SGTSMA+P V G ++ LL      D            +K  ++K +T  V        
Sbjct: 351  SYSGTSMASPIVCGQVAILLDKGIPND-----------DIKSTLIKMATDDVFQKRTLLF 399

Query: 1378 NEETPNRLVYNGGGKKLDEF 1437
               TPNR+++NG  K+ D++
Sbjct: 400  KPNTPNRVLFNGIEKEDDQY 419

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
            {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045c
          Length = 517

 Score =  177 bits (450), Expect = 4e-49
 Identities = 118/344 (34%), Positives = 171/344 (49%), Gaps = 36/344 (10%)
 Frame = +1

Query: 523  QEDAPWGLHRISHRER--------AKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDF 675
            Q +AP  L R+S R +         +Y  D  Y Y     G  V +YVLD+G+  +H DF
Sbjct: 160  QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 676  EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 855
            EGRA +GA    +  + D NGHGTH AG+IGS+ +GV+K  NI+ VKVL S G GT+  V
Sbjct: 220  EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 856  IKGIEYVAKNHI-------------------AXXXXXXXXXXXXTANLSLGSSKSPAMEM 978
            + G+E+V+ NH                                   NLSLG+ +S  +  
Sbjct: 280  MSGLEFVS-NHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 979  AVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCV 1146
            A+   +  G+   +AAGN + +AC +SPA     ITVGA    DDR    A FSNWG CV
Sbjct: 339  AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 1147 DVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQ 1326
            D+FAPG+ + S         +  +GTSMA P V G+++ LL              + P Q
Sbjct: 396  DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD-----------SGIKPTQ 444

Query: 1327 LKEKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEFWRF 1446
            +K+++ + +T  +           TPNR+ +NG  +  D++  +
Sbjct: 445  IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHY 488

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
            Anc_6.313 YCR045C
          Length = 607

 Score =  172 bits (436), Expect = 1e-46
 Identities = 117/341 (34%), Positives = 172/341 (50%), Gaps = 14/341 (4%)
 Frame = +1

Query: 433  TDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYG--------QD 588
            TD V E V+QD      E +          Q  AP  L ++S R +  Y         + 
Sbjct: 122  TDMVEETVWQDD--DDSEDQDDDEYKGVDIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEF 179

Query: 589  LEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGII 765
            + Y Y+    GT    Y++DTG+  EH++F  R  +G      +   D NGHGTH AG+I
Sbjct: 180  IHYYYDRYYQGTNSVVYIIDTGVYKEHKEFGNRVHFGGDFI-GEGKGDYNGHGTHVAGLI 238

Query: 766  GSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLS 945
            GS+ FGVAKN  +  VKVL   G G ++ V++GIE+   N                 N+S
Sbjct: 239  GSKTFGVAKNVTLFDVKVLDQKGFGNLTSVLEGIEFAVNN---CKLKQQPMGKNCVINMS 295

Query: 946  LGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAF 1122
            LG+ ++P +  A+  A   G+   +AAGN +  AC +SPA +  +ITVGA    +D  A 
Sbjct: 296  LGTIRNPIINEAIKEAFLSGITPVVAAGNNNFSACWTSPASSNFAITVGAMDDRTDTIAV 355

Query: 1123 FSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFF 1302
            FSNWG CVD+FAPG+ I S         +  SGTSMA+P VAG+++ L+      D    
Sbjct: 356  FSNWGQCVDIFAPGVRIKSLSNRMLENGVIHSGTSMASPIVAGLVAILMEKGYKCD---- 411

Query: 1303 YDTVSPQQLKEKILKFSTRGVLGDV----NEETPNRLVYNG 1413
                   ++K+K++  S++ +   +       TPNR++YNG
Sbjct: 412  -------EIKQKLIDDSSKSIFSKLTLFFKYGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
            Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  152 bits (385), Expect = 4e-41
 Identities = 99/305 (32%), Positives = 155/305 (50%), Gaps = 4/305 (1%)
 Frame = +1

Query: 373  GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 552
            GG+  +  +   FR   G F   ++E ++ D  +  +  +  +  +    QE AP  L R
Sbjct: 44   GGVG-AISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLAR 102

Query: 553  ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA-SD 729
            +S +   + G D  Y+Y    G GV  Y+LDTGID  H + EGR +  A +  N  +  D
Sbjct: 103  LSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGD 161

Query: 730  LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXX 909
             +GHGT  AG+IGS  FG AK  N+  V+V  S G  T+  VI+ +E+ +K         
Sbjct: 162  PHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASK-------LA 214

Query: 910  XXXXXXXTANLSLGSSKSPAMEMAVNAAV-DCGVHFAIAAGNEDEDACLSSPAGAEKSIT 1086
                      +     K+  +  A+ A + D  +   +A GN +++AC SSPA A  ++T
Sbjct: 215  SVTQRPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALT 274

Query: 1087 VGAS--TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            +G+   T  D  A F+N+G C+D FA G+NI S   G   +    SGTS++A   +G+++
Sbjct: 275  IGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVA 334

Query: 1261 YLLSL 1275
            Y +SL
Sbjct: 335  YYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6.313
            YCR045C
          Length = 497

 Score =  154 bits (388), Expect = 1e-40
 Identities = 109/329 (33%), Positives = 162/329 (49%), Gaps = 10/329 (3%)
 Frame = +1

Query: 484  EHESTVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLY---EDAAGTGVTSYVLDTGI 654
            E E        S Q +AP  L R S   +     +  Y Y    D  G  VT YVLD+GI
Sbjct: 132  EEEGEFGHEKYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGI 191

Query: 655  DTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNG 834
              +H +FEGR        ++    D  GHGT  AGIIGS+ +GVAKN N++ +KVL + G
Sbjct: 192  RMDHPEFEGRILEAYDFTDSG-VGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKG 250

Query: 835  EGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHF 1014
            +G V  +++G++++ K+                 N SLG+     +  A     + G+  
Sbjct: 251  KGNVFSILQGLQFITKH------CEENTNGNCIINASLGAINIQILNKAFEEVHNAGIPV 304

Query: 1015 AIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR-AFFSNWGTCVDVFAPGINIMSTYIG 1191
              AAGN   +AC  +PAG++   TVG+    DD  A FSNWG CVD+ APG+ + +    
Sbjct: 305  ICAAGNNAVNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYT 364

Query: 1192 SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLG 1371
            ++  +   SGTS++ P V G+ + LLS             V  + L ++I K  +R +L 
Sbjct: 365  NQKGSRESSGTSVSTPIVTGLAAILLS-----------KGVPKENLYDEIRKMGSRDLLR 413

Query: 1372 DVNEE------TPNRLVYNGGGKKLDEFW 1440
              N+E      TPN L+ N G +K D+ +
Sbjct: 414  --NKEFSRLPGTPN-LIVNIGPQKEDDVY 439

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
            similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045C Hypothetical ORF
          Length = 380

 Score =  145 bits (366), Expect = 2e-38
 Identities = 95/308 (30%), Positives = 160/308 (51%), Gaps = 7/308 (2%)
 Frame = +1

Query: 373  GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 552
            GG+  +  +   FR   G F  +++E  ++   +  +  +  + ++    Q+ AP  L R
Sbjct: 44   GGVG-AITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLAR 102

Query: 553  ISHRERAKYGQDLE---YLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 723
            +S +   + G   +   Y+Y   AG GV  Y+LDTGID  H  FEGR +  A    +  A
Sbjct: 103  LSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVA 162

Query: 724  S-DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 900
            + D +GHGT  AG+IGS  FGVAK  N+  V+V  S G  ++  V++ +E+ +K      
Sbjct: 163  TGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK------ 216

Query: 901  XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAV-DCGVHFAIAAGNEDEDACLSSPAGAEK 1077
                         + L   ++  +  AV A V D  +   +AAGNE+  AC  SPAGA  
Sbjct: 217  -LAAVTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYG 275

Query: 1078 SITVGASTF--SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
            ++T+G+     +D  A F+N+  CVD+F  G+++ +  +   ++   LSGTS++A   +G
Sbjct: 276  ALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVASG 334

Query: 1252 ILSYLLSL 1275
            +++Y +S+
Sbjct: 335  LVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] {ON}
            complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  134 bits (336), Expect = 4e-34
 Identities = 106/355 (29%), Positives = 171/355 (48%), Gaps = 14/355 (3%)
 Frame = +1

Query: 253  LIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGIDISFDINGLFRGYTGYF 432
            L  +H  ++Q   + S++      SFL + S +    P    +D    I   F G++G F
Sbjct: 20   LATAHEYVVQLTSETSLN------SFLESNSLNNLDEP----VD-KIVIGSDFHGFSGEF 68

Query: 433  TDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH---RERAKYGQDLEYLY 603
             DEV+  ++ DP V  I  +  + +    RQ DAP  L R+S+     R     +  +++
Sbjct: 69   EDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNENAFIF 128

Query: 604  EDAAGTGVTSYVLDTGIDTEHEDFEGR--AKWGAVIPENDEASDLNGHGTHCAGIIGSRH 777
               AG GV  Y++D+GID++H  F  R  +K   +        D +GHGT  AG++ S  
Sbjct: 129  HSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGDPHGHGTAIAGLVTSDT 188

Query: 778  FGVAKNTNILAVKVLRSNGEGT-VSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGS 954
            FGV K  N+  V+V+ +   G  +S ++K +E++ +NH               A L    
Sbjct: 189  FGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI-ENH------SRATMRPSVAVLPFSM 241

Query: 955  SKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS---ITVGASTF--SDDRA 1119
            SK+  +  A+ +  +  +   + AGN+   AC  SPA A  S   ++VG+  +  S + A
Sbjct: 242  SKNAILNSAIESMPN-SIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDYRSSIEIA 300

Query: 1120 FFSNWGTCVDVFAPGI---NIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
             FSN+G CVDVF  G+    + +T     N    +SGTSM+    AG + Y +SL
Sbjct: 301  SFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYMSL 355

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] {ON}
            Anc_1.78
          Length = 388

 Score =  123 bits (309), Expect = 2e-30
 Identities = 90/314 (28%), Positives = 157/314 (50%), Gaps = 18/314 (5%)
 Frame = +1

Query: 385  ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 564
            +  +I   F  ++G  + E +  VF+D     I  E  + +    +Q DAP  L R++ +
Sbjct: 51   LPIEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-K 109

Query: 565  ERAKYGQ----DLEYLYEDAAGTGVTSYVLDTGIDTEHEDF--EGRAKWGAVIPENDEAS 726
            +  K  Q    + +Y++ D +G GV  Y++DTGID +H  +      K   +      + 
Sbjct: 110  DSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSG 169

Query: 727  DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGE-GTVSDVIKGIEYVAKNHIAXXX 903
            D NGHGT  AGII S  FGV K+ N++ V+V+ +N +  T+S V+  +  + K+      
Sbjct: 170  DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHE----- 224

Query: 904  XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEK-- 1077
                        L   + K+  +E A+   +   +   I AGN+ ++AC  SP G +K  
Sbjct: 225  --QKTMRPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 1078 -SITVGASTFSD-----DRAFFSNWGTCVDVFAPGINI---MSTYIGSRNATLSLSGTSM 1230
              + VG+  +S+     D A FSN+G+CVD++  G++I    ++  G +    +++GTS 
Sbjct: 282  NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 1231 AAPHVAGILSYLLS 1272
            +   VAG++ Y +S
Sbjct: 342  SCGIVAGVVGYYMS 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa] {ON}
            conserved hypothetical protein
          Length = 386

 Score =  116 bits (291), Expect = 6e-28
 Identities = 91/305 (29%), Positives = 150/305 (49%), Gaps = 14/305 (4%)
 Frame = +1

Query: 403  GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYG 582
            G FR +TG F+  +++ ++ DP V  I  + ++++     Q +AP  L  +S      + 
Sbjct: 52   GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPLSHQ 111

Query: 583  QDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEG-RAKWGAVIPEND--EASDLNGHGTHC 753
                ++Y    G GV  Y+LDTGID +H +         A + ++   + +D  GHGT  
Sbjct: 112  P---FIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTDPQGHGTAM 168

Query: 754  AGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXT 933
            AGII S  FGV K  N++ V+V  SNG+  +S +++ +  + + HI              
Sbjct: 169  AGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT-LTQRHI----EGTKRPSVVV 223

Query: 934  ANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGA----EKSITVGAST 1101
              L +    +P +  A+ A+ D  V   I AGN  +DA   SPA      +  I VG+  
Sbjct: 224  IPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVD 282

Query: 1102 FSDDRAFFSNWGTCVDVFAPG---INIMSTYIGSRNATLSL----SGTSMAAPHVAGILS 1260
             +++   F+N+G+ VDVF  G     + ST + S+  + SL    SGTS ++   AG++ 
Sbjct: 283  VNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIG 342

Query: 1261 YLLSL 1275
            Y +SL
Sbjct: 343  YYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] {ON}
            Anc_1.78
          Length = 364

 Score = 99.0 bits (245), Expect = 6e-22
 Identities = 80/298 (26%), Positives = 132/298 (44%), Gaps = 9/298 (3%)
 Frame = +1

Query: 409  FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQD 588
            F+   G F+ E +E ++ D  V  I  +  +++     Q  +P  L ++S          
Sbjct: 53   FKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGG------- 105

Query: 589  LEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKW------GAVIPENDEASDLNGHGTH 750
              + ++  +G  V  YV DTGID +H   +            + +P     +D +GHGT 
Sbjct: 106  -SFTFDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---ADPHGHGTM 161

Query: 751  CAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXX 930
             AG+I S  FGV K+ +++ V+V   +GE  +S ++KGI        A            
Sbjct: 162  MAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-------ASVAHARFTKRPS 214

Query: 931  TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 1110
               L +   K   +      A+   +   + AGN+  DAC  SP      + +G+    +
Sbjct: 215  VFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDN 274

Query: 1111 DRAFFSNWGTCVDVFAPGINIM---STYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
              A FSN+G CVDV+  G +I+   ST  G+     S +GTS +    AGI+ Y +S+
Sbjct: 275  RLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 98.6 bits (244), Expect = 1e-21
 Identities = 92/353 (26%), Positives = 159/353 (45%), Gaps = 20/353 (5%)
 Frame = +1

Query: 274  MIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEI 453
            +IQ   +V + K T  + FLR        N     +++ + +   F+ ++     + +  
Sbjct: 21   IIQLTNEVELHKYT--NKFLREFGI----NSDEAQVEL-YSVGKNFQAFSAILEQDHLRS 73

Query: 454  VFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTS 633
            ++ D  +  I  +  +       Q+DAP  L ++   E      D E++Y+  AG GV  
Sbjct: 74   LYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAG----DNEFVYDSTAGNGVDI 129

Query: 634  YVLDTGIDTEH--------EDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVA 789
            Y+ DTGI             D  G        P  D+  ++  HGT  +G+IGS  FGV 
Sbjct: 130  YIFDTGIARNSPGLSASRIHDMPGMPG----PPIRDQ--EILEHGTAMSGLIGSPAFGVL 183

Query: 790  KNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPA 969
            K  N++ V V   NG+  +S V+KG+  V + H+               N S  + K+  
Sbjct: 184  KKCNLIDVNVGDENGKVFMSKVLKGLNLV-QQHV------KHTNRPSVINFSYCTLKNAI 236

Query: 970  MEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS---ITVGASTFSDD---RAFFSN 1131
            +  A +      V  A+AAGN  +  C  SP G +++   +  G+   +DD    + FSN
Sbjct: 237  LNSAFD-NFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSN 295

Query: 1132 WGTCVDVFAPGINIMSTYI------GSRNATLSLSGTSMAAPHVAGILSYLLS 1272
            +G+CV  +APG  +++  I       SR+  + +SGTS ++   AG++ Y ++
Sbjct: 296  YGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Kwal_56.22390 s56 complement(108145..108450) [306 bp, 101 aa] {OFF}
            [contig 185] FULL
          Length = 101

 Score = 83.6 bits (205), Expect = 7e-19
 Identities = 52/101 (51%), Positives = 59/101 (58%)
 Frame = -2

Query: 1082 MLFSAPAGELRQASSSSFPAAIAK*TPQSTAAFTAISIAGDLLLPKERLAVDPLNFEPLF 903
            M FSA AGE   AS  S PAA AK  P  TAA TA+S AGDL  PK+  AV+PL     F
Sbjct: 1    MAFSAAAGEELHASWFSLPAATAKWIPALTAALTAMSKAGDLPPPKDMFAVEPLKPFLFF 60

Query: 902  FDDAI*FLATYSIPLITSETVPSPFERRTFTAKMFVFLATP 780
               +   LA  S PL TS+ +P P + RT TA  F FLATP
Sbjct: 61   LTASWWDLAANSTPLTTSDILPEPLDLRTLTATTFAFLATP 101

>Kwal_23.6185 s23 (1485516..1485773) [258 bp, 85 aa] {OFF} [contig 15]
            FULL
          Length = 85

 Score = 52.8 bits (125), Expect = 3e-08
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -2

Query: 1178 DIIFIPGANTSTHVPQFEKNALSSL-NVEAPTVMLFSAPAGELRQASSSSFPAAIAK*TP 1002
            D I  PGAN ST +PQ E  A+ S+ + +APT +  S  AG L+QA +   PAA    TP
Sbjct: 18   DAILTPGANKSTQLPQLENRAMVSVRSSKAPTEIAESEEAGLLQQALALELPAATTTTTP 77

Query: 1001 QSTAAFTA 978
             S+AA TA
Sbjct: 78   ASSAASTA 85

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
            (REAL)
          Length = 814

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 62/253 (24%), Positives = 94/253 (37%), Gaps = 21/253 (8%)
 Frame = +1

Query: 589  LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 744
            L+  Y +  G GV + ++D G+D E+ED    F     W       +P+     D   HG
Sbjct: 157  LDVWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY--HG 214

Query: 745  THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            T CAG I ++        GV  N  I  +++L  +GE T  D    + Y    +      
Sbjct: 215  TRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDEAASLIYGLDTNDIYSCS 272

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEK 1077
                             K   ++         G  +  A+GN     ++        +  
Sbjct: 273  WGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYTNSIY 332

Query: 1078 SITVGASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHV 1245
            SIT+GA    D    +S   + V         G  I S+ I  R  + S  GTS AAP  
Sbjct: 333  SITIGAIDHKDLHPPYSEGCSAVMAVTYSSGSGEYIHSSDINGR-CSNSHGGTSAAAPLA 391

Query: 1246 AGILSYLLSLQPA 1284
            AG+ + LL   P+
Sbjct: 392  AGVYTLLLEANPS 404

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
            (REAL)
          Length = 809

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 62/251 (24%), Positives = 95/251 (37%), Gaps = 23/251 (9%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            Y +  G GV + ++D G+D E+ED    F     W       +P+   + D   HGT CA
Sbjct: 161  YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 757  GIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            G I ++        GV  N  I  +++L  +GE T  D    + Y    +          
Sbjct: 219  GEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIYGLDTNDIYSCSWGPA 276

Query: 919  XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSITV 1089
                         K   ++         G  +  A+GN     ++        +  SIT+
Sbjct: 277  DDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYTNSIYSITI 336

Query: 1090 GASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
            GA    D    +S   +C  V A       G  I S+ I  +  + S  GTS AAP  AG
Sbjct: 337  GAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGK-CSDSHGGTSAAAPLAAG 393

Query: 1252 ILSYLLSLQPA 1284
            + + LL   P+
Sbjct: 394  VYTLLLEANPS 404

>YCR045W-A Chr3 (208751..209101) [351 bp, 116 aa] {OFF} Dubious ORF
           unlikely to encode a protein, based on available
           experimental and comparative sequence data; completely
           overlaps with YCR045C; identified by gene-trapping,
           microarray expression analysis, and genome-wide homology
           searching
          Length = 116

 Score = 44.7 bits (104), Expect = 4e-05
 Identities = 35/89 (39%), Positives = 39/89 (43%)
 Frame = -2

Query: 992 AAFTAISIAGDLLLPKERLAVDPLNFEPLFFDDAI*FLATYSIPLITSETVPSPFERRTF 813
           A  TA+ I G L LP+ RLA   L    L F          S PL T    P P   +T 
Sbjct: 2   APSTAMLIMGLLKLPRLRLATHFLPCGRLTFVQCS---TMNSRPLRTLLASPDPSLPKTL 58

Query: 812 TAKMFVFLATPKCLEPIIPAQ*VPWPFKS 726
           T+      A P  LEP  PA  VPWPF S
Sbjct: 59  TSTRLTLFAAPYVLEPTSPATCVPWPFWS 87

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
            Anc_2.6 YNL238W
          Length = 833

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 65/250 (26%), Positives = 94/250 (37%), Gaps = 23/250 (9%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            YE+  G G+   ++D G+D E+ D    F     W       +P+   A D   HGT CA
Sbjct: 175  YENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGTRCA 232

Query: 757  GII------GSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            G I      G    GVA N  +  +++L  +GE T  D    + +    +          
Sbjct: 233  GEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPK 290

Query: 919  XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE--DAC-LSSPAGAEKSITV 1089
                         K   +    +     G  +  A+GN     D C       +  SIT+
Sbjct: 291  DDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYSITI 350

Query: 1090 GASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
            GA         +S   +C  V A       G  I ST IG++  +    GTS AAP  AG
Sbjct: 351  GALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNK-CSDHHGGTSAAAPLAAG 407

Query: 1252 ILSYLLSLQP 1281
            I S +L + P
Sbjct: 408  IFSLVLQVNP 417

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
            KEX2Subtilisin-like protease (proprotein convertase), a
            calcium-dependent serine protease involved in the
            activation of proproteins of the secretory pathway
          Length = 814

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 61/252 (24%), Positives = 94/252 (37%), Gaps = 21/252 (8%)
 Frame = +1

Query: 589  LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 744
            L+  Y +  G GV + ++D G+D E+ED    F     W       +P+   + D   HG
Sbjct: 157  LDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 745  THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 906
            T CAG I ++        GV  N  I  +++L  +G+ T  D    + Y    +      
Sbjct: 215  TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDVNDIYSCS 272

Query: 907  XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEK 1077
                             K   ++         G  +  A+GN     ++        +  
Sbjct: 273  WGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIY 332

Query: 1078 SITVGASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHV 1245
            SIT+GA    D    +S   + V         G  I S+ I  R  + S  GTS AAP  
Sbjct: 333  SITIGAIDHKDLHPPYSEGCSAVMAVTYSSGSGEYIHSSDINGR-CSNSHGGTSAAAPLA 391

Query: 1246 AGILSYLLSLQP 1281
            AG+ + LL   P
Sbjct: 392  AGVYTLLLEANP 403

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa] {ON}
            YNL238W (KEX2) - Ca2+-dependent serine protease [contig
            160] FULL
          Length = 803

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 64/247 (25%), Positives = 94/247 (38%), Gaps = 20/247 (8%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            YE+  G  V   V+D G+D E ED    F     W       +P+   + D   HGT CA
Sbjct: 156  YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDY--HGTRCA 213

Query: 757  GII--GSRHF---GVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 921
            G I  G   F   GVA N  +  +++L  + E T  D    + +    +           
Sbjct: 214  GEIAAGKNQFCGVGVAYNAKVAGLRIL--SAEVTSEDEAASLIHALDVNDIYSCSWGPSD 271

Query: 922  XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE---DEDACLSSPAGAEKSITVG 1092
               +        K   +   +    + G  +  A+GN    D++        +  SITVG
Sbjct: 272  DGRSLQGPDDLVKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYSITVG 331

Query: 1093 ASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            A         +S   + V V       G +I ST I  R  + +  GTS AAP  AG+ S
Sbjct: 332  AIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGR-CSDTHGGTSAAAPLAAGVYS 390

Query: 1261 YLLSLQP 1281
             +L   P
Sbjct: 391  LVLEANP 397

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
            (REAL)
          Length = 819

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 62/259 (23%), Positives = 97/259 (37%), Gaps = 24/259 (9%)
 Frame = +1

Query: 580  GQDLEYL---YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEAS 726
            G D+  L   Y +  G GV + ++D G+D E+ED    F     W       +P+   + 
Sbjct: 151  GNDMNVLKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSD 210

Query: 727  DLNGHGTHCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNH 888
            D   HGT CAG I ++        GV  N  I  +++L  +G+ T  D    + Y    +
Sbjct: 211  DY--HGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDTN 266

Query: 889  IAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSS 1059
                                   K   ++         G  +  A+GN     ++     
Sbjct: 267  DIYSCSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYDG 326

Query: 1060 PAGAEKSITVGASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTS 1227
               +  SIT+GA    D    +S   + V V       G  I S+ I     + +  GTS
Sbjct: 327  YTNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSGEYIHSSDING-GCSNTHGGTS 385

Query: 1228 MAAPHVAGILSYLLSLQPA 1284
             AAP  AG+ + LL   P+
Sbjct: 386  AAAPLAAGVYTLLLEANPS 404

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
            uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
            Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 61/247 (24%), Positives = 95/247 (38%), Gaps = 20/247 (8%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            YE+  G GV + ++D G+D E+ D    F     W       +P+     D   HGT CA
Sbjct: 185  YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDY--HGTRCA 242

Query: 757  GIIGSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 921
            G I +        GVA N  +  +++L  +GE T  D    + Y    +           
Sbjct: 243  GEIAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVYGLGVNDIYSCSWGPAD 300

Query: 922  XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSITVG 1092
                        K   ++  +    + G  +  A+GN    D++        +  SITVG
Sbjct: 301  DGRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNSIYSITVG 360

Query: 1093 ASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            A         ++   + V V       G +I ST + ++  +    GTS AAP  AGI S
Sbjct: 361  AIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQ-CSHRHGGTSAAAPLAAGIYS 419

Query: 1261 YLLSLQP 1281
             +L   P
Sbjct: 420  LVLEANP 426

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
            YNL238W
          Length = 833

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 59/248 (23%), Positives = 93/248 (37%), Gaps = 21/248 (8%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEH----EDFEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            YE+  GTG+ + ++D G+D ++    ++F     W       +P+     D   HGT CA
Sbjct: 186  YENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDY--HGTRCA 243

Query: 757  GII------GSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            G I      G    GVA +  +  +++L  +GE T  D    + +    +          
Sbjct: 244  GEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPR 301

Query: 919  XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE--DAC-LSSPAGAEKSITV 1089
                         K   +          G  +  A+GN     D C       +  SITV
Sbjct: 302  DDGTHLQGPTDLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSIYSITV 361

Query: 1090 GASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVAGIL 1257
            GA         +S   + V V       G  I +T IG +  + +  GTS AAP  AG+ 
Sbjct: 362  GAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIGDK-CSNTHGGTSAAAPLAAGVY 420

Query: 1258 SYLLSLQP 1281
            + +L   P
Sbjct: 421  TLVLQANP 428

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
            uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
            Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 60/247 (24%), Positives = 91/247 (36%), Gaps = 20/247 (8%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            YE+  G  V   V+D G+D E ED    F     W       +P+   + D   HGT CA
Sbjct: 155  YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 757  GIIGSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 921
            G I +        GVA N  +  +++L  + E T  D    + +    +           
Sbjct: 213  GEIAAVKNKACGIGVAYNAKVAGIRIL--SAEVTAEDEAASLIHALDVNDIYSCSWGPLD 270

Query: 922  XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSITVG 1092
                        +   +        + G  +  A+GN    D++        +  SITVG
Sbjct: 271  DGRVLQGPDDLVRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSITVG 330

Query: 1093 ASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 1260
            A         +S   + V V       G +I ST I  +  + +  GTS AAP  AG+ S
Sbjct: 331  AIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGK-CSDTHGGTSAAAPLAAGVYS 389

Query: 1261 YLLSLQP 1281
             +L   P
Sbjct: 390  LVLEANP 396

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
            YNL238W
          Length = 842

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 60/242 (24%), Positives = 94/242 (38%), Gaps = 20/242 (8%)
 Frame = +1

Query: 616  GTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNG------HGTHCAGIIGSRH 777
            G  VT  ++D G+D E+ED + +  +      ND  +          HGT CAG I +  
Sbjct: 167  GKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAVR 226

Query: 778  -----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANL 942
                  GVA + +I  +++L  +GE TV D    + Y  K +                  
Sbjct: 227  NDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKYNDIFSCSWGPPDDGQHLQG 284

Query: 943  SLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSDD 1113
                 K   ++   +   + G  +  A+GN     ++        +  SIT+GA      
Sbjct: 285  PYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGAIDHRGL 344

Query: 1114 RAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 1275
               +S   +C  V A       G  I +T I  + +T    GTS AAP  AG+ + LL  
Sbjct: 345  HPAYSE--SCSAVMAVTYSSGSGKFIETTDINGKCSTHH-GGTSAAAPLAAGVYALLLEA 401

Query: 1276 QP 1281
             P
Sbjct: 402  NP 403

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa] {ON}
            uniprot|P09231 Kluyveromyces lactis KLLA0D19811g KEX1
            protease precursor
          Length = 756

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 17/243 (6%)
 Frame = +1

Query: 604  EDAAGTGVTSYVLDTGIDTEHEDF------EGRAKWGAVIPENDEASDLNGHGTHCAGII 765
            E+  G GV + ++D G+D E+ED       EG   +    P        + HGT CAG I
Sbjct: 151  ENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEI 210

Query: 766  GSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXX 930
             +        GVA N+ +  +++L  +G+ T  D    + Y    +              
Sbjct: 211  AAFRNDICGVGVAYNSKVSGIRIL--SGQITAEDEAASLIYGLDVNDIYSCSWGPSDDGK 268

Query: 931  TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNED--EDAC-LSSPAGAEKSITVGAST 1101
            T        K   ++         G  +  A+GN     D+C       +  SITVGA  
Sbjct: 269  TMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVGAID 328

Query: 1102 FSDDRAFFSNWGTCVDV--FAPGI-NIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 1272
            +      +S   + V V  ++ G  N + T       + +  GTS AAP  AGI + +L 
Sbjct: 329  WKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTLVLE 388

Query: 1273 LQP 1281
              P
Sbjct: 389  ANP 391

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 18/114 (15%)
 Frame = +1

Query: 580 GQDL---EYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEAS 726
           G DL   E  Y +  G GV + ++D G+D E ED    F     W       +P+     
Sbjct: 144 GNDLNITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGD 203

Query: 727 DLNGHGTHCAGIIGSRH-----FGVAKNTNILAVKVLRSN--GEGTVSDVIKGI 867
           D   HGT CAG I +        GVA N  +  +++L ++   E   + ++ G+
Sbjct: 204 D--NHGTRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSADITSEDEAASLVYGL 255

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
            YNL238W
          Length = 826

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 67/250 (26%), Positives = 92/250 (36%), Gaps = 23/250 (9%)
 Frame = +1

Query: 601  YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 756
            Y +  G+GV   ++D G+D E+ D    F     W       +P+   A D   HGT CA
Sbjct: 165  YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 757  GII------GSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAK-NHIAXXXXXXX 915
            G I      G    GVA N+ +  +++L  +G  T  D    + Y    N I        
Sbjct: 223  GEIAASKNNGFCGIGVAYNSKVSGLRIL--SGPLTPEDEAASLMYALDVNDIFSCSWGPQ 280

Query: 916  XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVH-FAIAAGNEDEDAC-LSSPAGAEKSITV 1089
                     S    K+    +         V+ FA   G    D C       +  SIT+
Sbjct: 281  DDGRHLQGPSELVRKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYSITI 340

Query: 1090 GASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAG 1251
            GA         +S   +C  V A       G  I ST I  + +     GTS AAP  AG
Sbjct: 341  GAIDHKGLHPPYSE--SCSAVMAVTYSSGSGEFIHSTDINDQCSDRH-GGTSAAAPLAAG 397

Query: 1252 ILSYLLSLQP 1281
            I + LL   P
Sbjct: 398  IYALLLEANP 407

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 37.7 bits (86), Expect = 0.075
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 13/103 (12%)
 Frame = +1

Query: 601 YEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS------DLNGHGTHCAGI 762
           YE+  G GV + ++D G+D E ED +           ND         D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 763 IGS-----RHFGVAKNTNILAVKVLRS--NGEGTVSDVIKGIE 870
           I +        GVA N  +  +++L      E   + +I G++
Sbjct: 214 IAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLD 256

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] {ON}
            similar to uniprot|P13134 Saccharomyces cerevisiae
            YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 63/253 (24%), Positives = 93/253 (36%), Gaps = 27/253 (10%)
 Frame = +1

Query: 604  EDAAGTGVTSYVLDTGIDTEHEDFEGR----AKWGAVIPENDEA-----SDLNGHGTHCA 756
            ++  G GV + ++D G+D    D +        W     EN +      SD N HGT CA
Sbjct: 166  QNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWD--FNENQQLPMPLLSDDN-HGTRCA 222

Query: 757  GIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 918
            G I +         GVA +  +  +++L  +G  T  D     E  +  H          
Sbjct: 223  GEIAAIRNNNYCGVGVAYDAKVSGIRIL--SGPLTAED-----EAASLVHALDVNDIYSC 275

Query: 919  XXXXTANLSLGSSKSPAMEMAVNAAV-----DCGVHFAIAAGN---EDEDACLSSPAGAE 1074
                T +       SP ++ A+   V     + G  +  A+GN     ++        + 
Sbjct: 276  SWGPTDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSI 335

Query: 1075 KSITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPH 1242
             SITVGA         +S   + V V       G  I ST I          GTS AAP 
Sbjct: 336  YSITVGAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDING-GCYDRHGGTSAAAPI 394

Query: 1243 VAGILSYLLSLQP 1281
             AGI + +L   P
Sbjct: 395  AAGIYALVLEANP 407

>YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subunit
           of the HIR complex, a nucleosome assembly complex
           involved in regulation of histone gene transcription;
           contributes to nucleosome formation, heterochromatic
           gene silencing, and formation of functional kinetochores
          Length = 840

 Score = 32.0 bits (71), Expect = 4.7
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 5/87 (5%)
 Frame = +1

Query: 157 ENLHLGRQKVLRGSKSLPYRY-----IIVFNEDITNRLIESHTQMIQKAQKVSVSKITED 321
           EN  LG+   L  +    YRY      + F E I   L+E  T+   K  K+S SK+ E+
Sbjct: 386 ENNELGKPIPLEKNMEQLYRYGVDKDSLDFPESINQLLLEDQTKSF-KHTKISTSKLGEN 444

Query: 322 DSFLRTVSASASPNPQFGGIDISFDIN 402
              L T SAS   +     +  S  IN
Sbjct: 445 HPTLATNSASNQKDNNDASVSRSEHIN 471

>CAGL0I00770g Chr9 complement(56013..56969) [957 bp, 318 aa] {ON}
           weakly similar to uniprot|P40214 Saccharomyces
           cerevisiae YMR144w
          Length = 318

 Score = 30.8 bits (68), Expect = 8.4
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 5/87 (5%)
 Frame = +1

Query: 76  NEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKVLRGSKSLPY-RYIIVFNEDITN- 249
           NE     E  EN +  + +    Q  +EN+HL  Q  ++ +K   Y + II  N+ I   
Sbjct: 93  NENQMRHEVEENLKTQQFEKLKSQLYVENVHLNEQLHIKENKVTKYKKKIIAKNKHINQL 152

Query: 250 -RLIESHTQMIQKAQKVS--VSKITED 321
            RL+    Q++  +Q  S  +S   ED
Sbjct: 153 MRLLNQTPQLLDSSQSESSMISNARED 179

>KNAG0D00890 Chr4 (137292..142964) [5673 bp, 1890 aa] {ON} Anc_6.257
            YPL231W
          Length = 1890

 Score = 31.2 bits (69), Expect = 8.7
 Identities = 38/160 (23%), Positives = 67/160 (41%), Gaps = 9/160 (5%)
 Frame = +1

Query: 430  FTDEVIEIVFQDPLVKFIEHESTVR---ISNSSRQEDAPWGLHRISHRERAKYGQDLEYL 600
            +T+E+ E V+ DPL +    +  V     +N S Q+DA +    +S++E +   + L   
Sbjct: 1709 YTEELEESVYLDPLARVTPDKKNVNELVFTNKSIQKDASF----VSNKETSDLIKSLTEQ 1764

Query: 601  YEDAAGTGV-TSYVLDTGIDTEHEDFEGRAKWGAVIP--ENDEASDLNGHGTHCAGIIGS 771
                AG+GV     L   ++ ++E F  R    A I   +       +  GT  A     
Sbjct: 1765 TVSTAGSGVGVDVELIQAVNADNETFVERNFTAAEIAYCKKQPCVQSSFAGTWSAKEAVF 1824

Query: 772  RHFGV---AKNTNILAVKVLRSNGEGTVSDVIKGIEYVAK 882
            +  GV       ++  ++++R NG   V  +    E  AK
Sbjct: 1825 KSLGVKSQGSGASLKDIEIVRVNGNAPVVKLAGAAEKSAK 1864

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 135,257,610
Number of extensions: 3028522
Number of successful extensions: 8673
Number of sequences better than 10.0: 81
Number of HSP's gapped: 8462
Number of HSP's successfully gapped: 83
Length of query: 483
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 370
Effective length of database: 40,524,141
Effective search space: 14993932170
Effective search space used: 14993932170
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)