Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1646.14ON48248225140.0
Suva_15.1786.14ON47647819690.0
YOR003W (YSP3)6.14ON47847818920.0
Smik_15.1726.14ON47847818790.0
Skud_5.296.14ON60841713061e-175
YEL060C (PRB1)6.14ON63541813071e-175
Smik_5.276.14ON60841813011e-174
Suva_5.76.14ON66441812961e-173
Kwal_56.223876.14ON54341812851e-173
SAKL0E01012g6.14ON54441812701e-171
KLTH0C11396g6.14ON55042812681e-170
TBLA0A073006.14ON57341512601e-169
NCAS0F002206.14ON69541312441e-165
TDEL0G045506.14ON56441612311e-164
KLLA0D00979g6.14ON56141912211e-163
ZYRO0C07942g6.14ON54841311781e-157
CAGL0B03619g6.14ON46841811511e-154
KAFR0L003606.14ON50248711501e-153
ACR012C6.14ON54142411471e-152
NDAI0K028806.14ON70442311581e-152
KNAG0E009206.14ON53141411381e-151
Kpol_1032.56.14ON68041611461e-150
Ecym_30186.14ON57542011351e-150
Kpol_1045.756.14ON47742011231e-149
CAGL0E02651g6.14ON48541410301e-135
TPHA0M002306.14ON58541710391e-135
KAFR0B065506.14ON45648110251e-135
NCAS0D026306.14ON4514259921e-130
NDAI0I022806.14ON4824978991e-116
KNAG0F02970singletonON4203258761e-113
CAGL0L13266gsingletonON5794867014e-85
SAKL0A02002g6.313ON4793725374e-62
Suva_3.846.313ON5273925161e-58
Kpol_1018.56.313ON4653395052e-57
YCR045C (RRT12)6.313ON4913315026e-57
Smik_3.1496.313ON4913235026e-57
KLTH0A06094g6.313ON4963225011e-56
NCAS0D043906.313ON4923784983e-56
ZYRO0D08822g6.313ON4903814948e-56
KNAG0I024706.313ON4753844912e-55
TDEL0A072806.313ON4363504831e-54
Kpol_1028.616.313ON5183164871e-54
NDAI0I005606.313ON4833864842e-54
Skud_3.1246.313ON5403314847e-54
AAR069W6.313ON7683184876e-53
Kwal_23.61836.313ON4933224651e-51
TBLA0F039706.313ON7343144733e-51
KLLA0F06028g6.313ON5083224634e-51
KAFR0J024506.313ON4783834562e-50
CAGL0L10802g6.313ON5173444573e-50
Ecym_21056.313ON6103184615e-50
TPHA0D037606.313ON6073124307e-46
Kwal_33.133721.78ON3772933784e-40
TBLA0A067006.313ON4973183802e-39
KLTH0F02288g1.78ON3803353583e-37
Kpol_2000.691.78ON3863033277e-33
TPHA0B045201.78ON3883143065e-30
ZYRO0F16764g1.78ON3863082933e-28
TDEL0C062301.78ON3642982385e-21
TBLA0A054101.78ON3823112361e-20
Smik_14.972.6ON8142571063e-04
Suva_14.1062.6ON8092571036e-04
YNL238W (KEX2)2.6ON8142561010.001
NDAI0F038902.6ON833250950.005
Kwal_56.248002.6ON803249940.008
Skud_14.1012.6ON819257920.014
SAKL0G00440g2.6ON836256910.018
Ecym_64862.6ON781100870.054
KAFR0A080402.6ON766250870.058
NCAS0A008802.6ON833101870.058
KLTH0H00418g2.6ON811249860.067
TBLA0B001302.6ON842244850.083
KNAG0F007702.6ON82688850.098
KLLA0D19811g2.6ON756243820.18
ZYRO0F15598g2.6ON790105780.55
Kpol_1015.82.6ON843102761.0
ABL203W2.6ON76882751.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.164
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   972   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   763   0.0  
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   733   0.0  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   728   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   507   e-175
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   508   e-175
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   505   e-174
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   503   e-173
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   499   e-173
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   493   e-171
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   493   e-170
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   489   e-169
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   483   e-165
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   478   e-164
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   474   e-163
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   458   e-157
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   447   e-154
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   447   e-153
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   446   e-152
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   450   e-152
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   442   e-151
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   446   e-150
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   441   e-150
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   437   e-149
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   401   e-135
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   404   e-135
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   399   e-135
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     386   e-130
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   350   e-116
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              342   e-113
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   274   4e-85
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   211   4e-62
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   203   1e-58
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   199   2e-57
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   197   6e-57
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   197   6e-57
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   197   1e-56
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   196   3e-56
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   194   8e-56
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   193   2e-55
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   190   1e-54
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   192   1e-54
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    191   2e-54
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   191   7e-54
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   192   6e-53
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   183   1e-51
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   186   3e-51
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   182   4e-51
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   180   2e-50
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   180   3e-50
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   182   5e-50
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   170   7e-46
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   150   4e-40
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   150   2e-39
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   142   3e-37
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   130   7e-33
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   122   5e-30
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   117   3e-28
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    96   5e-21
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    96   1e-20
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    45   3e-04
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    44   6e-04
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    44   0.001
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    41   0.005
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    41   0.008
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    40   0.014
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    40   0.018
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    38   0.054
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    38   0.058
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    38   0.058
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    38   0.067
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    37   0.083
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    37   0.098
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    36   0.18 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.55 
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    34   1.0  
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    33   1.4  

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/482 (97%), Positives = 470/482 (97%)

Query: 1   MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 60
           MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ
Sbjct: 1   MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 60

Query: 61  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 120
           KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP
Sbjct: 61  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 120

Query: 121 NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 180
           NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW
Sbjct: 121 NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 180

Query: 181 GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 240
           GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE
Sbjct: 181 GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 240

Query: 241 ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 300
           ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA  
Sbjct: 241 ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASS 300

Query: 301 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 360
                     TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS
Sbjct: 301 KKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 360

Query: 361 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 420
           ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS
Sbjct: 361 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 420

Query: 421 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW
Sbjct: 421 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

Query: 481 RF 482
           RF
Sbjct: 481 RF 482

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/478 (76%), Positives = 410/478 (85%), Gaps = 2/478 (0%)

Query: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62
           MKL  +LL LCAG  +CMIIP L+EI Y +E+ E+FRNAK Q+GLGQQ   N HL   KV
Sbjct: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122
           +  ++SLPYRYII F+ED + R IESH +MIQ+ Q  SVSK+ +DD+F   VS SA  + 
Sbjct: 61  VYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF--VSTSAPSDL 118

Query: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182
           QFGGID  FDINGLFRGYTGYFT+EVI+ V QDP++KFIE ESTV+++NS+ QE+APWGL
Sbjct: 119 QFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGL 178

Query: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242
           HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGID  HEDFEGRA WGAVIP+NDEAS
Sbjct: 179 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEAS 238

Query: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 302
           DLNGHGTHCAGIIGSRHFGV KNTN++AVKVLRSNGEGTVSDVIKGIEYV K+HI     
Sbjct: 239 DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKK 298

Query: 303 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362
                   TANLSLGSSKSPAMEMAVNAAV+ GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 299 GGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSIT 358

Query: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422
           VGASTFSDDRAFFS+WGTCVDVFAPG+NI+STYIGSRNA+LSLSGTSMAAPHVAGILSY 
Sbjct: 359 VGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYF 418

Query: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           LSLQP+ DSEFF  TVSPQQLKEKI+ FST+GVLGDV E+TPNRL+YNGGG+KLD FW
Sbjct: 419 LSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/478 (74%), Positives = 400/478 (83%)

Query: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62
           MK   IL IL A   LCMIIP+ + I  + E  +  R+ +A +GLGQ +  N H   Q V
Sbjct: 1   MKFSTILPILWANCCLCMIIPDFDGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQHV 60

Query: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122
              ++ LPYRY+IVFNEDI+ + I+SH Q++QK    SV K+TE+D+F R +S+S S   
Sbjct: 61  AHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKS 120

Query: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182
           QFGGID  FDINGLFRGYTGYFTDE+I+I+ QDP++KF+E E+TV+ISNSS QE+APWGL
Sbjct: 121 QFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGL 180

Query: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242
           HR+SHRE+ KYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA+WGAVIP NDEAS
Sbjct: 181 HRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEAS 240

Query: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 302
           DLNGHGTHCAGIIGS+HFGVAKNT I+AVKVLRSNGEGTVSDVIKGIEYV K HI     
Sbjct: 241 DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKK 300

Query: 303 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362
                   TANLSLGSSKS AMEMAVNAAVD GVHFAIAAGNEDEDACLSSPAGAEKSIT
Sbjct: 301 KNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSIT 360

Query: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA+PHVAGILSY 
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYF 420

Query: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           LSLQPA DSEFF D  SPQ+LKEK+LKFST+GVLGD+ ++TPN+L+YNGGGKKLD FW
Sbjct: 421 LSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/478 (73%), Positives = 398/478 (83%)

Query: 3   MKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQKV 62
           MK   IL IL A   LCMIIPE +EI  +++  ++ RN K+   L QQ      +G    
Sbjct: 1   MKFSTILPILWASCNLCMIIPEFDEIVRFTQITDDSRNTKSLKNLRQQYSGGFLMGGLDN 60

Query: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122
              ++ +PYRYI+VFNEDI+ + IESH +M+Q+A  VSVSK+ EDD FL  VS+S +P+ 
Sbjct: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDL 120

Query: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182
           Q GGID SFDINGLFRGY GYFTDE++ +V QDPL+KFIE ESTVR+SN+S Q+DAPWGL
Sbjct: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242
           HRISHRE+AKYGQDLEYLYEDAAG GVTSYVLDTGIDTEHEDFEGRA WGAVIP NDEAS
Sbjct: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 302
           DLNGHGTHCAGIIGS+H+GVAKNT ++AVKVLRSNGEGTVSDVIKGIEYVA+ HI     
Sbjct: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 303 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362
                   TANLSLGSSKS AMEMAV+AAVD GVHFAIAAGNE+EDACLSSPAGA+KSIT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422
           VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG+LSY 
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 423 LSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           LSLQPA DSE+F + +SPQ+LKEK+LKFST GVLGD+ + TPNRL+YNGGGK LD+ W
Sbjct: 421 LSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  507 bits (1306), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 236/417 (56%), Positives = 308/417 (73%), Gaps = 3/417 (0%)

Query: 67  KSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGG 126
           K +P RYIIVF + +     + H + + +AQ  SV  ++ +D+F  +   S+    + GG
Sbjct: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209

Query: 127 IDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRIS 186
           I  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  ++   Q  APWGL RIS
Sbjct: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269

Query: 187 HRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNG 246
           HRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D NG
Sbjct: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329

Query: 247 HGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 306
           HGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY A+ H          
Sbjct: 330 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389

Query: 307 XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 366
               TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGAS
Sbjct: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449

Query: 367 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQ 426
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQ
Sbjct: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 427 PAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           P  DSEFF    D+++PQQLK K++ +ST+ +L DV E+TPN L+YNGGG+ L  FW
Sbjct: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/418 (57%), Positives = 309/418 (73%), Gaps = 3/418 (0%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125
           SK +P RYIIVF        I+ H + +Q+AQ  SV  ++ +D+F  +   ++    + G
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235

Query: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185
           GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295

Query: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355

Query: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 305
           GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 356 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK 415

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365
                TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475

Query: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535

Query: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  505 bits (1301), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 307/418 (73%), Gaps = 3/418 (0%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125
           SK +P RYI+VF + +    +  H + + +AQ  SV  ++ +D+F  +   +     + G
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208

Query: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185
           GI  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268

Query: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328

Query: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 305
           GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 329 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKK 388

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365
                TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448

Query: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508

Query: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  503 bits (1296), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 310/418 (74%), Gaps = 3/418 (0%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125
           +K +P RYIIVF +D+       H + +Q+AQ  SV  +  +D+F  +   +A  + + G
Sbjct: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263

Query: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185
           GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  ++   Q  APWGL R+
Sbjct: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323

Query: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383

Query: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXX 305
           GHGTHCAG I S+H+GVAKN N++AVKVLRSNG GT+SDV+KG+EY AK H         
Sbjct: 384 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKK 443

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365
                TAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503

Query: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563

Query: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ ++TPN L+YNGGG+ L  FW
Sbjct: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  499 bits (1285), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/418 (54%), Positives = 305/418 (72%), Gaps = 5/418 (1%)

Query: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTV---SASASPNPQF 124
           ++P+RYI+VF + +    ++ H +++ +A   SV K+  +D+F               + 
Sbjct: 79  AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSRE 138

Query: 125 GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 184
           GGI  SFD+NG+ RGY GYFT E+++ +  +PLV F+E +S V  +    Q  APWGL R
Sbjct: 139 GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSR 198

Query: 185 ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 244
           ISHRE+   G   +YLY+DAAG GVTSYV+DTGI+ +H+DFEGRA WG  +P ND   D 
Sbjct: 199 ISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDG 258

Query: 245 NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXX 304
           NGHGTHCAG I S+H+GVAKN N++AVKVLRSNG G++SDV+KG+E+ AK+H        
Sbjct: 259 NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNK 318

Query: 305 XXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 364
                 TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSPA AE +ITVG
Sbjct: 319 KGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVG 378

Query: 365 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 424
           AST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y LS
Sbjct: 379 ASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLS 438

Query: 425 LQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           LQP  DSE+F+    ++P QLK+K++ +ST+  LGD+ E+T N L+YNGGG+ LD+FW
Sbjct: 439 LQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  493 bits (1270), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/418 (55%), Positives = 301/418 (72%), Gaps = 6/418 (1%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASA-----SPNPQ 123
           +P+RYIIVF +D T   I  H ++I +A   SV+K+   DSF      SA     +    
Sbjct: 78  IPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSS 137

Query: 124 FGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLH 183
            GGI  SFDI  +  GY GYFTDEV++ +  +  V+FIE +S V  S    Q  APWGL 
Sbjct: 138 EGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLS 197

Query: 184 RISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASD 243
           RISHRER   G   +YLY+D AG GVTSYV+DTGI+  H+DF GRA WG  +P+NDE +D
Sbjct: 198 RISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDAD 257

Query: 244 LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXX 303
            NGHGTHCAG I S H+GVAKN  ++A+KVLRSNG GT+SDV+KG+E+ A++H       
Sbjct: 258 GNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKN 317

Query: 304 XXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITV 363
                  TAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 318 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITV 377

Query: 364 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 423
           GAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y L
Sbjct: 378 GASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437

Query: 424 SLQPAQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           SLQP  DSEFF  + ++P QLK+K++ +ST+ VL ++ E+TPN L+YNGGG+ L +FW
Sbjct: 438 SLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  493 bits (1268), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/428 (53%), Positives = 308/428 (71%), Gaps = 15/428 (3%)

Query: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKI-------------TEDDSFLRTV 114
           ++P+RYI+VF ++++   ++ H Q++ +A   SV+K+              ED  F    
Sbjct: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137

Query: 115 SASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSR 174
             S S   + GGI  SFD++GL  GY GYFTDE+++ +  +PLV F+E +S V       
Sbjct: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197

Query: 175 QEDAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAV 234
           Q  APWGL RISHRE+   G   +YLY+D AG GVTSYV+DTG++ +H+DFEGRA WG  
Sbjct: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257

Query: 235 IPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAK 294
           IP ND   D NGHGTHCAG I S+H+GVAKN N++AVKVLRSNG G++SDV+KG+E+ AK
Sbjct: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAK 317

Query: 295 NHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSP 354
           +H              TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSP
Sbjct: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377

Query: 355 AGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPH 414
           A AE ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PH
Sbjct: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437

Query: 415 VAGILSYLLSLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGG 472
           VAG+L+Y LSLQP  DSE+F+    ++P QLK+K++ +ST+ VLGD+ ++T N L++NGG
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497

Query: 473 GKKLDEFW 480
           G+ LD+FW
Sbjct: 498 GEGLDDFW 505

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  489 bits (1260), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 230/415 (55%), Positives = 302/415 (72%), Gaps = 7/415 (1%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           +P+RYII F +D+    I+ H Q I + Q+ S++++  D  +  +V       P    I 
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQP----II 180

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
            SF+IN L +GY GYFTD+VI+ +  +PLV+F+E +STV I+    Q  APWGL RISHR
Sbjct: 181 DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR 240

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           ER   G   +YL++D AG GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D NGHG
Sbjct: 241 ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG 300

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG I S+H+GVAKN N++AVKVLRSNG G++SDV+KG+EY   +H+A          
Sbjct: 301 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK 360

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
             TAN+SLG  KSP++++AVNAAV  G+HFA+AAGNE++DAC +SPA A+ +ITVGAST 
Sbjct: 361 GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL 420

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428
           SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+LSY LSLQP 
Sbjct: 421 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE 480

Query: 429 QDSEFFYDT---VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           QDSEF       ++P QLK++++ + T+ +L D+ E TPN LV+NG G+ L +FW
Sbjct: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  483 bits (1244), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 304/413 (73%), Gaps = 2/413 (0%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           +P RYI+VF + I    ++ H ++I + Q  S +K+ +DD F  + SA    +   GGI 
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF-SASAIEDESINQGGIL 157

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
            +F+I+ L  GY GYFTDEV+E++  +PLV+++E +S V+ +    Q +APWGL RISHR
Sbjct: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           ER   G   +YLY+D AG GVT YV+DTGI+TEH DF  RA WG  IP ND+  D NGHG
Sbjct: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG I S H+GVAKN  ++AVKVLRSNG G++SDVIKG+E+ A++HI           
Sbjct: 278 THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFK 337

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
             TAN+SLG  KSP +++AVNAAVD G+HFA+AAGNE++DAC +SPA AE++ITVGAST 
Sbjct: 338 GSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428
           SDDRA+FSNWG CVD+FAPG+NI+STYIG  +AT +LSGTSMA+PHVAG+L+Y LSLQP 
Sbjct: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457

Query: 429 QDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
            DSEFF  T ++P Q+K+K++ +S++ VL D+ E TPN+L++NG G  LD+ W
Sbjct: 458 SDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  478 bits (1231), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 228/416 (54%), Positives = 299/416 (71%), Gaps = 9/416 (2%)

Query: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGI 127
           + P+RYI+V     +   I  H + I ++Q  SV ++ +DD F        +     GGI
Sbjct: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTT-----GGI 163

Query: 128 DISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 187
             SFD+ GL  GY GYFTD V+E++ + P+V F+E +S V  S    Q  APWGL RISH
Sbjct: 164 QDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISH 223

Query: 188 RERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGH 247
           RER   G   +YL++D AG GVTSYV+DTGI+ +H+DFEGRA WG  IP NDE  D NGH
Sbjct: 224 RERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGH 283

Query: 248 GTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 307
           GTHCAG I S+H+GVAK  +++AVKVLRSNG G++SDVIKG+E+ A++H           
Sbjct: 284 GTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGF 343

Query: 308 XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 367
              TAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE+++TVGAST
Sbjct: 344 KGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGAST 403

Query: 368 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQP 427
            SDDRA+FSN+G CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 404 LSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 463

Query: 428 AQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
             DS+FF      V+P+QLK+K++ +ST+ +L D+ E+TPN L+YNGGG  L  FW
Sbjct: 464 DSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  474 bits (1221), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 227/419 (54%), Positives = 298/419 (71%), Gaps = 7/419 (1%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASAS-----PNPQ 123
           +P RYIIVF +D +   ++ H +++      ++  + ++D F    S   S      +  
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 124 FGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLH 183
            GGI  SFDI G   GY GYFT EVI+ + + PLV+F+E +S V  ++ + Q  APWGL 
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 184 RISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASD 243
           RISHRE+   G   +YLY+D AG GVT+YV+DTG++  H+DF+GRA WG  IP++D   D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 244 LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXX 303
            NGHGTHCAG IGS H+GVAKN +I+AVKVLRSNG GT+SDV+KG+EYVA+ H       
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 304 XXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITV 363
                  TAN+SLG  KSPA+++AVNAAV  GVHFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 364 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 423
           GAST SD+RA+FSNWG CVD+F PG+NI+STYIGS  AT +LSGTSMA PHV G+L+Y L
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456

Query: 424 SLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           SLQP  DSE+F+    ++P QLK+K++ FST+ VL D+ E+T N L+YNGGG+ LD+ W
Sbjct: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  458 bits (1178), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/413 (53%), Positives = 289/413 (69%), Gaps = 1/413 (0%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           L  RYII+F + +  + I  H ++I++     VS++ E+ SF   +      +   GGID
Sbjct: 89  LENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGID 148

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
            +FDING+  GY+GYF  +V++++   PL++ +E +S V    +  +  APWGL RISHR
Sbjct: 149 HTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHR 208

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           ER   G   +YLY++  G+GVTSYV+DTG++  H  F GRAKWG  IP  D   D NGHG
Sbjct: 209 ERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHG 268

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG IGS  +GVAK  +I+AVKVLRSNG G++SDV+KG+E+ A++H            
Sbjct: 269 THCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFK 328

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
             TAN+SLG  KSP+++ AVNAAV  G++FA+AAGNED+DAC +SPA A   ITVGAST 
Sbjct: 329 GSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTL 388

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428
           SDDRA+FSN+G CVDVFAPG+NI+STYIGS ++T +LSGTSMA+PHVAG+L+Y LSLQP 
Sbjct: 389 SDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPG 448

Query: 429 QDSEF-FYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
            DSEF    ++SP QLK+K+L FST+ VL D+   TPN L+YNGGG  L  FW
Sbjct: 449 SDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFW 501

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  447 bits (1151), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 296/418 (70%), Gaps = 11/418 (2%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           +P++YI+V  + ++   + +    +  A   ++  + ++  F   V+A   P    GGI 
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGIK 58

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
             F+IN LF+G  GYF + V++++ +  +V+F+E +S V  SN   Q +APWGL RISHR
Sbjct: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           +R   G   +YLY++A G GVT+YV+DTGI+ +H +F+GRA+WG  IP ND   D NGHG
Sbjct: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG I S+H+G+AK  N++AVKVL+S+G GT+SDVIKG+EY A+ H+           
Sbjct: 179 THCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHL-KESKNNKKFK 237

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
             TAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC +SPA AEK+ITVGAST 
Sbjct: 238 GSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTL 297

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSYLLSLQP 427
           SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 298 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQP 357

Query: 428 AQDSEFFYDT----VSPQQLKEKILKFSTRGVLGDV-NEETPNRLVYNGGGKKLDEFW 480
             DSE FYD     V+P QLK+K++ +ST+ VL D+ + ++PN L+YNG G  L  FW
Sbjct: 358 DSDSE-FYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  447 bits (1150), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 224/487 (45%), Positives = 317/487 (65%), Gaps = 21/487 (4%)

Query: 3   MKLFNILLILCAGGTLCMIIPELNE-IAYYSETFENFRNAKAQDGLG---QQNIENLHLG 58
           M+L   LL++C+     ++IP L + I  +S+      ++     L      + EN+   
Sbjct: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENI--- 57

Query: 59  RQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITED-DSFLRT-VSA 116
                     +P+RYIIVF + ++   I+ H ++I        S  + D   +L+T ++ 
Sbjct: 58  ----------IPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINV 107

Query: 117 SASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQE 176
             S     GGI   FDI+ L  GY  Y +DE++  +  +PL+ FIEH++ V  ++ + Q 
Sbjct: 108 PESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQN 167

Query: 177 DAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIP 236
           +APWGL RISHRE        +YLY+D AG  V +YV+DTG+D  H +F  RA WG  IP
Sbjct: 168 NAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIP 227

Query: 237 ENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNH 296
            ND+  D NGHGTH AG IGS+H+GVAK+ NI+AVKVLRSNG G++SDV+KG+E+   +H
Sbjct: 228 LNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSH 287

Query: 297 IAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAG 356
           +              AN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE+++AC SSPA 
Sbjct: 288 L-ERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPAS 346

Query: 357 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHV 415
           AE+++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMA+PHV
Sbjct: 347 AEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHV 406

Query: 416 AGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKK 475
           AG+L+Y LSLQP + SEF    +S  QLK+K+++++T+ VL D+ E TPN L+YNGGG+ 
Sbjct: 407 AGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQD 466

Query: 476 LDEFWRF 482
           L +FW  
Sbjct: 467 LSDFWNL 473

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  446 bits (1147), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 294/424 (69%), Gaps = 12/424 (2%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125
           ++++P++YI+VF E +++     H ++++ A   SV+++ E  +F R+       N +FG
Sbjct: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGE---NNEFG 124

Query: 126 --------GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQED 177
                   GI+  F +    RGY GYFT++++ ++  +P V F+E +S V  S+ + Q  
Sbjct: 125 IAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNG 184

Query: 178 APWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPE 237
           APWGL R+SHRE+   G   +YLY+D +G GVTSYV+DTGI+ +H DFE RA WG  IP 
Sbjct: 185 APWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPN 244

Query: 238 NDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHI 297
           ND   D NGHGTHCAG I S+ +GVAK  N++AVKVLRSNG G++SDV++G+EY  K H 
Sbjct: 245 NDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHR 304

Query: 298 AXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGA 357
                        TAN+SLG  +S A+++AV+AAVD G+HFA+AAGNE++DAC +SPA +
Sbjct: 305 KAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAAS 364

Query: 358 EKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG 417
           +K+ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG
Sbjct: 365 QKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAG 424

Query: 418 ILSYLLSLQPAQDSEFF-YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKL 476
           +L+Y LSLQP  DSEF    T+SP+ LK+K++ F T+  L  +   T N L+YNGGG  L
Sbjct: 425 LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484

Query: 477 DEFW 480
            +FW
Sbjct: 485 SDFW 488

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/423 (52%), Positives = 295/423 (69%), Gaps = 6/423 (1%)

Query: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122
            +  + LP +YIIVF + I    I  H ++I + Q+ S S++     F  + S     + 
Sbjct: 233 FKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESF 292

Query: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182
           + GGI  SF+IN +  GY+GYFT EVI+++  +PLVK++E +S V+ +  + Q +APWGL
Sbjct: 293 RNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352

Query: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242
            RISHRER   G   +YLY+D AG GVT +V+DTGI+  H DF  RA WG  IP ND+  
Sbjct: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412

Query: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXX 302
           D NGHGTHCAG I S H+GVAKN  ++AVKVLRSNG G++SDVIKG+E+ A+ H+     
Sbjct: 413 DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHL-NNEK 471

Query: 303 XXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362
                   TAN+SLG  KSP +++AVNAAV+ G+HF++AAGNE++DAC SSPA AE +IT
Sbjct: 472 NKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAIT 531

Query: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSY 421
           VGAST SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMA+PHVAG+L+Y
Sbjct: 532 VGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTY 591

Query: 422 LLSLQPAQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLD 477
            LSLQP   S FF       ++P+QLK+K++ +ST  +L D+ + TPN+L+YNG G  + 
Sbjct: 592 FLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDIS 651

Query: 478 EFW 480
           + W
Sbjct: 652 DLW 654

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  442 bits (1138), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 214/414 (51%), Positives = 290/414 (70%), Gaps = 24/414 (5%)

Query: 72  RYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGI--DI 129
           +YII+F E +T   I +H Q++Q+               L T   SA       GI  D+
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQV-------------LLETSDVSAQ------GIVADV 137

Query: 130 --SFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 187
             SFD+ G+  GY    +  V+E+V + P V+ +E +S V  +    Q +APWGL RISH
Sbjct: 138 LDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISH 197

Query: 188 RERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGH 247
           R+    G   +YLY+DAAG GV SY++DTGI+ +H++FEGRA+WG  IP+ND   D NGH
Sbjct: 198 RDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGH 257

Query: 248 GTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXX 307
           GTHCAG I S+H+GVAK  N++AVKVLRSNG G++SDVI G+E+ AK H +         
Sbjct: 258 GTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKF 317

Query: 308 XXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 367
              TAN+SLG  KSP+++  V+AAV  G+HF++AAGNE++DAC +SPA +E++ITVGAST
Sbjct: 318 KGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGAST 377

Query: 368 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQP 427
            SDDRA+FSNWG+CVD+FAPG+NI+STY GS +AT +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 378 LSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQP 437

Query: 428 AQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
            + S+F     ++P+QLK+K+L +ST+GVL D+ E+TPN L+YNGGG  L +FW
Sbjct: 438 EKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  446 bits (1146), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 294/416 (70%), Gaps = 16/416 (3%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           +P +YIIVF +D++ + ++ H  +I +AQ    S   E  S +             GGI+
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSI------------LGGIE 279

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
            +F++  LF GY G+F +++++ +   P+V F+E +S V  +    Q +APWGL RISHR
Sbjct: 280 EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           +    G   +YLY+D AG GVT+YV+DTGI+ +H++F GRA WG  IPEND+  D NGHG
Sbjct: 340 DGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHG 399

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG I S+++GVAKN  ++AVKVLRS+G GT+SDV+KG+EY A +H            
Sbjct: 400 THCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFK 459

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
             TAN+SLG  KS ++++AV+AAV  G+HFA+AAGNE++DAC SSPA +E +ITVGAST 
Sbjct: 460 GSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTL 519

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428
           SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+LSY LS+QP 
Sbjct: 520 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPD 579

Query: 429 QDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFWR 481
            DSEFF    +++SP QLK+K++ +ST+ +  D+ E+TPN LVYN  G  + +FW+
Sbjct: 580 ADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  441 bits (1135), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/420 (50%), Positives = 291/420 (69%), Gaps = 7/420 (1%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA----SASPN 121
           S+++P+RYI++F + +T+  +  H  ++  A   +++++    SF            S  
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 122 PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181
              GGI+  F+I G  RGY GYFTD +++++ +  LVK IE +S V  S+   Q  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 182 LHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 241
           L R+SHRER   G   +YLY+D AG GVT+YV+DTGI+ +H +FEGRA+WG  IP ND  
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 242 SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXX 301
            D NGHGTHCAG I S+ +GVAKN  ++AVKVLR+NG GT+SDV++G+EYV   H     
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKA 343

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSI 361
                    TAN+SLG  KS A+E+AV+AAV  G+HFA+AAGNE++DAC +SPA ++K I
Sbjct: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 362 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSY 421
           TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 422 LLSLQPAQDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
            LSLQP   SE++   ++SP+ LK+KI+ + ++ +L +V   T N L++NGGG  LD FW
Sbjct: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/420 (51%), Positives = 281/420 (66%), Gaps = 7/420 (1%)

Query: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLR-TVSASASPNPQF 124
           S+ +PY YI+VFNE +T   I  H + + + Q  SV+ +  D  F   + S+  + N   
Sbjct: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91

Query: 125 GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 184
           GG+   F I     GYTG FTDEV+E +   PLVKFIE +S V  + ++ Q +APWGL R
Sbjct: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151

Query: 185 ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 244
           ISHR R       +YLY+D  G GV +YV+DTGI+  + DF GRA WG  IP  +   D 
Sbjct: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211

Query: 245 NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXX 304
           NGHGTH AG I S H+GVAK   + AVKVLRSNG G++SDV+KG+EYV   H        
Sbjct: 212 NGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH--QRDVGT 269

Query: 305 XXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 364
                  AN+SLG  KS ++++AVNAAV  GVHFA+AAGNE++DAC +SPA AE++ITVG
Sbjct: 270 AGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVG 329

Query: 365 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 424
           AST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMA+PH+AG+++Y LS
Sbjct: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389

Query: 425 LQPAQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           LQPA  S+F+       ++P QLK+KI+ F T+  L D+   TPN + YNG GK L++FW
Sbjct: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  401 bits (1030), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 204/414 (49%), Positives = 273/414 (65%), Gaps = 6/414 (1%)

Query: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128
           +P RYI++F + +T++ I+SH   I++   ++ S I   DS     +     + +  G+ 
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEE---INSSSIFLQDSDFGKATQYNDISTRGIGLQ 130

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
             F I     GY GYFT+   + +   PLV+ +EH+S VRI+N   QE  PWGL RIS R
Sbjct: 131 HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190

Query: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248
           E+        Y Y+D  G    ++V+DTGI  +HEDFEGRA WG  I END   DLNGHG
Sbjct: 191 EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           THCAG I S+H+G+AK   ++AVKVLRS+G G++SDVI+G+EY  + +            
Sbjct: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNLK 309

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368
               N+SLG+ KS A+  A++AA   G+ FA+AAGNE +DAC SSPA A   ITVG ST 
Sbjct: 310 GAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTL 369

Query: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428
           SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM++PHVAG+L+Y LSLQP 
Sbjct: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429

Query: 429 QDSEFFYD--TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
             S+F+++   +SP+ LK+K+L ++T G L  +  ET N LVYNGGGK L +FW
Sbjct: 430 HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  404 bits (1039), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 283/417 (67%), Gaps = 15/417 (3%)

Query: 72  RYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGIDISF 131
           RYIIVF + +    ++ H +M+    +    +++E+        ASA  +  F  +  +F
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMSALFR----RLSEEQRPAAAPGASALRD-GFDRVMDTF 189

Query: 132 DINGLFRGYTGYF-TDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRER 190
           ++ G F GY     + ++++ +  +PLV ++E +S V  S    Q +APWGL RISHRE 
Sbjct: 190 EVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH-SLDETQNNAPWGLARISHREG 248

Query: 191 AKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGT 249
              G   +YLY  ++AG GVT+YV+DTGI   H +F  RAKWG  IP ND   D NGHGT
Sbjct: 249 LNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGT 308

Query: 250 HCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA----XXXXXXX 305
           HCAG IGS H+GVAK  N++AVKVLRS+G GT+SDV+KG+E+VA  H             
Sbjct: 309 HCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNS 368

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365
                TAN+SLG  KSPA++ AVNAAV  GVHFA+AAGNE++DAC SSPA AE +ITVGA
Sbjct: 369 NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGA 428

Query: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
           ST SDDRA+FSN+G CVD+FAPG+NI+STYIG+ +AT +LSGTSMA+PHVAG+L+YLLSL
Sbjct: 429 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSL 488

Query: 426 QPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           QP + SEF+     ++P Q+K+KI+ ++T+  L D+  +TPN+L+YNGG    D FW
Sbjct: 489 QPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FW 544

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  399 bits (1025), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/481 (44%), Positives = 289/481 (60%), Gaps = 27/481 (5%)

Query: 1   MNMKLFNILLILCAGGTLCMIIPELNEIAYYSETFENFRNAKAQDGLGQQNIENLHLGRQ 60
           MN  LF     +  GG L +++PE+ +        +  R++        + +E+L   + 
Sbjct: 1   MNPLLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQKDRDSTFSR---TEVLEHLSAKQN 57

Query: 61  KVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASP 120
            +++       +YI++F         E H + ++   K    +  E D     ++     
Sbjct: 58  DIIKD------QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNI---- 107

Query: 121 NPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPW 180
                     F I     GY      E ++++ QDP+V+ IE +S V       QED PW
Sbjct: 108 ----------FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPW 157

Query: 181 GLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDE 240
           GL RIS R R + GQD  Y Y+DA    VT+YVLDTGI   HE F GRA+WG  I  ND 
Sbjct: 158 GLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDV 217

Query: 241 ASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXX 300
             D +GHGTH AGII S  FGVAK   ++AVKVLRSNGEG +SDV+KGIE+V  +H    
Sbjct: 218 DEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---- 273

Query: 301 XXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS 360
                       NLSLG+SKSPA+ +A++AA+   +HFA+AAGNE+ DAC +SPA A ++
Sbjct: 274 SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333

Query: 361 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILS 420
           ITVGAS FSD+RAFFSNWG CVDVFAPG+N+MSTYIGS NATLSLSGTS AAP+ AG+++
Sbjct: 334 ITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIA 393

Query: 421 YLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480
           Y LSLQP +DS +F   ++P +LKEKI+ F ++ VL ++ E TPN ++YNG G+ L  FW
Sbjct: 394 YYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

Query: 481 R 481
           +
Sbjct: 454 K 454

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  386 bits (992), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 269/425 (63%), Gaps = 27/425 (6%)

Query: 62  VLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPN 121
           +   +  +P +YI++F  D T+   E+H   +              +S+L         +
Sbjct: 46  IHHAASPIPNQYIVLFKSDTTDIQRETHLATL--------------NSWLLNT------D 85

Query: 122 PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181
           PQ+  I  SF +    +GYT    +++I  +  DP+++ IE +S V      +Q D+PWG
Sbjct: 86  PQYT-ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWG 144

Query: 182 LHRISHRERAKYGQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVI-PEND 239
           L RIS RER K  QD  Y Y+D+ A +    Y+LDTGI+  H +F+GRAKWGAV  P   
Sbjct: 145 LARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP 204

Query: 240 EASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAX 299
              D NGHGTHCAG+IGS  +GVAKNT ++AVKVL + G+G +S VI+GIEYV + H   
Sbjct: 205 NQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQD 264

Query: 300 XXXXXXXXXXXTA-NLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 358
                      +  NLSLG+ KSPA+   + AAV  GVHFA+AAGNED+DAC +SPA + 
Sbjct: 265 MKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSP 324

Query: 359 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHVAG 417
            ++TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM+AP V G
Sbjct: 325 HALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTG 384

Query: 418 ILSYLLSLQPAQDSEFFYDTVSPQ--QLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKK 475
           +++Y LSLQP   S+F+    SP   QLK KI+ FST GVL ++ E TPNR+VYNGGG  
Sbjct: 385 LIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444

Query: 476 LDEFW 480
           L +FW
Sbjct: 445 LKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  350 bits (899), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 217/497 (43%), Positives = 297/497 (59%), Gaps = 41/497 (8%)

Query: 3   MKLFNILLILC--AGGTLCMIIPEL----NEIAYYSETFENFRNAKAQDGLGQQNIENL- 55
           M L   LLIL   A     +IIPE+    N  A +++  E       +D L +  I  + 
Sbjct: 1   MTLGGTLLILSWFARSITSLIIPEIIHSGNNDASHAKLNE-------RDTLDKNQIPFII 53

Query: 56  -HLGRQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTV 114
              G QK       +P +YI++F  D T+  I    Q +    +    K   +D++ + +
Sbjct: 54  PTHGPQKNF-----IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVL 108

Query: 115 SASASPNPQFGGIDISFDINGLF-RGYTGYFTDEVIEIVFQ-DPLVKFIEHESTVRISNS 172
           S             IS D  G+  R     F ++V   +F    ++K IE +S V ++  
Sbjct: 109 SR----------FQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKF 158

Query: 173 SRQEDAPWGLHRISHRERAKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDFEGRAKW 231
           + Q D+ WGL RIS R   K  QD  Y Y+D  +G GV  Y+LDTGI++ H +FEGRA W
Sbjct: 159 TTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASW 218

Query: 232 GAVIPENDEA-SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIE 290
           G  +P  + +  D NGHGTHCAGIIGS+ +GVAK TN++AVKVL   G+G++SDVI G+E
Sbjct: 219 GVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLE 278

Query: 291 YVAKNH------IAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN 344
           +VA +H      I+              NLSLG+ KSP++++A+ +A   G+H  +AAGN
Sbjct: 279 FVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGN 338

Query: 345 EDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATL 403
           EDEDAC++SPA +   ITVGAS+FSDDRAFFSNWG CVDVFAPGINI STYIG + N TL
Sbjct: 339 EDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETL 398

Query: 404 SLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEET 463
           SLSG+SM++P V+G+ +Y LSLQP   S+F    ++P QLK KI+ FST G+L ++  +T
Sbjct: 399 SLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDT 458

Query: 464 PNRLVYNGGGKKLDEFW 480
            N+LVYNGGGK L  FW
Sbjct: 459 ANKLVYNGGGKDLSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  342 bits (876), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 224/325 (68%), Gaps = 5/325 (1%)

Query: 149 IEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLYED-AAGT 207
           +  + Q P V+ +E  S V   N + QED PWGL R+S R+R + G +  Y Y+   +  
Sbjct: 96  VYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAK 155

Query: 208 GVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTN 267
            V  Y+LDTGI  +HE+FEGRA+WG  I  ND   D NGHGTHCAGI+G   +GVAK  N
Sbjct: 156 DVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEAN 215

Query: 268 ILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMA 327
           ++AVKVL + G+G +SDVI+GIE+    H+               NLSLG+ +SPA++  
Sbjct: 216 LIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDEVRGS---IINLSLGAGESPALQRV 272

Query: 328 VNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAP 387
           V AA++ GVHFA+AAGNED++AC SSPA  +  +TVG STFSDDRAFFSNWG C+DVFAP
Sbjct: 273 VTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAP 332

Query: 388 GINIMSTYIG-SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEK 446
           G+N+ S+Y+G ++N TLSLSGTS +APHVAG+++YLLSL+P   S+F     +P QLK+K
Sbjct: 333 GVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQK 392

Query: 447 ILKFSTRGVLGDVNEETPNRLVYNG 471
           ++  +T G L +V ++T N +++NG
Sbjct: 393 LVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  274 bits (701), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 158/486 (32%), Positives = 258/486 (53%), Gaps = 13/486 (2%)

Query: 3   MKLFNILLILCAGGTL--CMIIPELNEIAYYSET--FENFRNAKAQDGLGQQNIENLHLG 58
           M+L NI+ ++    +L   +++P++N +   SE+  ++NF     + G  +  +    LG
Sbjct: 1   MRLSNIITLVIGIISLSNAIVLPDINTLEQTSESQEYDNFFKQSKRPGNVKAPLV-APLG 59

Query: 59  RQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASA 118
               ++ +  +PYRYI++F        I+ H Q + K Q      +  +D F        
Sbjct: 60  ENDEIQ-NNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKE 118

Query: 119 SPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDA 178
               + GG+  +FDI   F GY GYFTDEV+E + +  +V ++E +S + I +     ++
Sbjct: 119 FSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNS 178

Query: 179 PWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPEN 238
            W L RISHR +       EY ++   G  + +Y+LDTG+   H  +  R   G VI  N
Sbjct: 179 HWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPN 238

Query: 239 DEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIA 298
           ++  D+NGHGT  AG++G R  GVA+   ++ VKVL   G GTVS++IKG+ +V  NH  
Sbjct: 239 EDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV--NHHH 296

Query: 299 XXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 358
                           S+  +KS ++  A +  V  G+H  + AG +  +AC SSPA + 
Sbjct: 297 PQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSS 356

Query: 359 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNA---TLSLSGTSMAAPH 414
           K ITV   + +D+     NWG+CVD++ PG  + +TY    RN     +S++G+S AA  
Sbjct: 357 KPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQ 416

Query: 415 VAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGK 474
           VAG+L+Y  SLQP   +      ++P++LKE+++ F T+G L ++   +PN + +NG G 
Sbjct: 417 VAGLLAYFASLQPGLGTPDVI-PLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGG 475

Query: 475 KLDEFW 480
            LD F+
Sbjct: 476 NLDSFF 481

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  211 bits (537), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 140/372 (37%), Positives = 194/372 (52%), Gaps = 49/372 (13%)

Query: 135 GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQ------------EDAPWGL 182
           G F G+T  F  + +E + ++PLV  +   S   + +   Q            EDAP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 183 HRISHRERAKYG------QDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVI 235
            R+S R    Y       Q+  Y Y+    G  V +Y++DTGI  +H+D  GRA +GA +
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 236 PENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKN 295
              +   D NGHGTH AGI+GSR FGVAK  N++ VK L + G+G ++ VI  IE+ + N
Sbjct: 179 -VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEF-SVN 236

Query: 296 HIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPA 355
           H               ANLSLGS ++  +  AV AAV+ G+   +AAGN + +AC +SPA
Sbjct: 237 HCK------KSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 356 GAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMA 411
            A  +ITVGA    DDR    A FSNWG CVDVFA G+ +MS         ++ SGTSMA
Sbjct: 291 SAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMA 347

Query: 412 APHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRL 467
           +P VAG+ + LL              + P  +K+KI+  +T  V           TPNR+
Sbjct: 348 SPSVAGLAAVLLD-----------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRI 396

Query: 468 VYNGGGKKLDEF 479
            +NG  K+ D F
Sbjct: 397 AFNGVRKEDDIF 408

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  203 bits (516), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 141/392 (35%), Positives = 199/392 (50%), Gaps = 55/392 (14%)

Query: 127 IDISFDINGLFRGYTGYFTDEVIEIVFQDPLV-------KFIEHESTVRIS--------- 170
           I+  F I G FRG T   +  ++  + + PL+       KF   ++   +S         
Sbjct: 89  IEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKY 147

Query: 171 ---------NSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYEDA-AGTGVTSY 212
                    N + Q DAP  L RIS          ++ +Y     Y YED   G GV +Y
Sbjct: 148 AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAY 207

Query: 213 VLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVK 272
           ++DTGI  EH +FE R   G  + + +   D NGHGTH AG++GSR FG AK  +++ VK
Sbjct: 208 IMDTGIHAEHPEFEDRVIQGVDLTK-EGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVK 266

Query: 273 VLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAV 332
           VL  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A+
Sbjct: 267 VLGKDGSGEASNVLSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAI 323

Query: 333 DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINI 391
           + G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I
Sbjct: 324 EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 383

Query: 392 MSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFS 451
            S    + N +L LSGTSM+ P V G+ + LLS             + P+ + ++I   S
Sbjct: 384 ESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPELIAQEIEYLS 432

Query: 452 TRGVLGD----VNEETPNRLVYNGGGKKLDEF 479
           TR V           TPN+++YNG  K  D +
Sbjct: 433 TRNVFHRRTLFFKPSTPNQILYNGVDKLDDPY 464

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  199 bits (505), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 189/339 (55%), Gaps = 39/339 (11%)

Query: 151 IVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLYEDAA--GTG 208
           + + D ++  I+ E+   +S  SR+   P+ ++ I      +Y    +Y Y DA   G+ 
Sbjct: 106 LTYSDKII--IQREAPRHLSRLSRRGQLPYDINNID-----RYDNAFDY-YFDAKYQGSS 157

Query: 209 VTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNI 268
           V +Y++DTGI  EH +FEGR K+ A+    +   D NGHGTH AGI+GS+ FGVAK  NI
Sbjct: 158 VNAYIIDTGIYKEHPEFEGRVKF-AIDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNI 216

Query: 269 LAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAV 328
           + VK L   G+G +S ++K +E+  ++                ANLS G+ ++  ++ A+
Sbjct: 217 IDVKALDKKGQGQLSTILKALEFTIRH------CKESVDKKCVANLSFGAIRTAIIDEAI 270

Query: 329 NAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDV 384
             A + G+   +AAGN + DAC +SPA ++  ITVGA    DDR    A FSNWG+CVDV
Sbjct: 271 KEAHNAGIVLVVAAGNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDV 327

Query: 385 FAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLK 444
           FAPG+ + S    + +  L LSGTSMA+P V+GI + LL              ++P+ +K
Sbjct: 328 FAPGVKVKSLSHINGSDVLLLSGTSMASPSVSGIAAILLD-----------KGLNPKFVK 376

Query: 445 EKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEF 479
            KI++ ST+ +       +   TPN +V+NG  K  D F
Sbjct: 377 SKIIESSTKNIFHQGTIMIKPNTPNLIVFNGIEKMDDSF 415

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  197 bits (502), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 177/331 (53%), Gaps = 29/331 (8%)

Query: 163 HESTVRISNSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYE-DAAGTGVTSYV 213
           +E      N + Q DAP  L RIS          ++ +Y     Y YE D  G  V +Y+
Sbjct: 113 YEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYI 172

Query: 214 LDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKV 273
           +DTGI  +H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKV
Sbjct: 173 MDTGIFADHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKV 231

Query: 274 LRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVD 333
           L  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++
Sbjct: 232 LGKDGSGEASNVLSGLEFIVEH---CTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIE 288

Query: 334 CGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIM 392
            G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 289 EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 348

Query: 393 STYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFST 452
           S    + N TL LSGTSM+ P V G+ + LLS             + P+ + ++I   ST
Sbjct: 349 SLSHLNYNDTLILSGTSMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLST 397

Query: 453 RGVLGD----VNEETPNRLVYNGGGKKLDEF 479
           R V           TPN+++YNG  K  D +
Sbjct: 398 RNVFHRRTLFFKPSTPNQILYNGVDKLDDPY 428

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  197 bits (502), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 125/323 (38%), Positives = 175/323 (54%), Gaps = 29/323 (8%)

Query: 171 NSSRQEDAPWGLHRISH--------RERAKYGQDLEYLYED-AAGTGVTSYVLDTGIDTE 221
           N + Q DAP  L RIS          ++ +Y     Y YED   G  V +Y++DTGI  +
Sbjct: 121 NITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFAD 180

Query: 222 HEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGT 281
           H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKVL  +G G 
Sbjct: 181 HPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 239

Query: 282 VSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIA 341
            S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++ G+ F  A
Sbjct: 240 ASNVLSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 342 AGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN 400
           AGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFN 356

Query: 401 ATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD-- 458
            TL LSGTSM+ P V G+ + LLS             + P+ + +++   STR V     
Sbjct: 357 DTLVLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 459 --VNEETPNRLVYNGGGKKLDEF 479
                 TPN+++YNG  K  D +
Sbjct: 406 LFFKPSTPNQILYNGVDKLDDRY 428

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  197 bits (501), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 176/322 (54%), Gaps = 39/322 (12%)

Query: 175 QEDAPWGLHRISHRERAKY--------GQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 225
           Q+ AP  L RIS R    Y          +  Y Y+D  +GT V +YV+DTGI  EH   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 226 EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 285
           EGRAK+GA +   +   D NGHGTH AG+IGSR FGVAK+ +++ VK L + G+G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 286 IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           I  IE+   NH               ANLSLGS ++  +  AV AA++ GV   +AAGN 
Sbjct: 254 ISAIEFTV-NHC------RKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 346 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 401
           + +AC SSPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 402 TLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD--- 458
            ++ SGTSMA+P V+G+++ LL      DS      + P  +K +++  +T  V      
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL------DS-----GIHPFDIKTELIDLATDSVFHKRTL 412

Query: 459 -VNEETPNRLVYNGGGKKLDEF 479
                TPNR+ + G  K  D +
Sbjct: 413 LFKPGTPNRVAFTGIDKTDDVY 434

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  196 bits (498), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 130/378 (34%), Positives = 195/378 (51%), Gaps = 61/378 (16%)

Query: 135 GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQED----------------- 177
           G F+G+T   TD+++E + ++PLV  +     V      + E+                 
Sbjct: 65  GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 178 -------APWGLHRISHRERAKYG--------QDLEYLYED-AAGTGVTSYVLDTGIDTE 221
                  AP  L R+S R++  Y           L+Y Y+  + G  V +Y++D+GI  E
Sbjct: 125 SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLE 184

Query: 222 HEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGT 281
           HE+F GRA  G  +   + + D NGHGTH AGI+GS+ +GVAK   ++ +KVL   G+G+
Sbjct: 185 HEEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGS 243

Query: 282 VSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIA 341
           ++ V+ GIE+  K+                ANLSLGS ++  +  A+ AA+D G+   +A
Sbjct: 244 LAMVLGGIEFAVKH-----CQETSKKGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVA 298

Query: 342 AGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIG 397
           AGN + +AC  SPA A ++ITVGA    DDR    A FSNWG C+D+FAPG+ I S  I 
Sbjct: 299 AGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIF 355

Query: 398 SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLG 457
                ++ SGTSMA+P VAG+ +  L              VS +++K+ IL+  T  V  
Sbjct: 356 KDKEDVTYSGTSMASPTVAGLAALTLD-----------QGVSAEEVKDYILEMGTDNVFH 404

Query: 458 D----VNEETPNRLVYNG 471
                    TPN++ +NG
Sbjct: 405 RRSLLFKPGTPNKICFNG 422

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  194 bits (494), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 196/381 (51%), Gaps = 54/381 (14%)

Query: 116 ASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQ 175
           A   PN QF   D    +  L + Y G   D+      +D    F      V++     Q
Sbjct: 83  ADLVPNIQFKAFDDVLGVQELQQNYHGDNLDD------EDGFNPF-----KVKV-----Q 126

Query: 176 EDAPWGLHRISHRERAKYGQDLEYLYEDA---------AGTGVTSYVLDTGIDTEHEDFE 226
            +AP  L R+S R    Y  D E  YE++          G  + +Y++DTGI  EH+DF 
Sbjct: 127 GEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFC 186

Query: 227 GRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVI 286
           GRA +G      +   D NGHGTH AGI+GS +FGVAK  N++ VK L + G+G ++ VI
Sbjct: 187 GRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVI 245

Query: 287 KGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNED 346
             +E+ A NH               ANLSLG+ ++  +  A+ AA + G+   +AAGN +
Sbjct: 246 SAVEF-AVNHCK-----SSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSN 299

Query: 347 EDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNAT 402
            +AC +SPA A ++ITVGA    DDR    A FSNWG CVD+FA G+ + S      +  
Sbjct: 300 INACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKP 356

Query: 403 LSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD---- 458
           ++ SGTSMA+P V G+++ LL              V P+ +K K+++ +T  +L      
Sbjct: 357 IAFSGTSMASPSVTGLVAILLD-----------KGVEPENIKAKLVELATHDLLQRRTLF 405

Query: 459 VNEETPNRLVYNGGGKKLDEF 479
               TPNR+ +NG  ++ DE+
Sbjct: 406 FKPGTPNRIAFNGMEREDDEY 426

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  193 bits (491), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 194/384 (50%), Gaps = 51/384 (13%)

Query: 125 GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVR------------ISNS 172
           G I+  F I G  +G T   + +V++ + + P VK +     V+            +   
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 173 SRQEDAPWGLHRISHRERAKYGQDLEYLYED---------AAGTGVTSYVLDTGIDTEHE 223
            RQ  AP  L RIS R +  Y  + +  Y D         A G    +Y+LDTG+  +H+
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 224 DFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVS 283
           +FE R ++G       E  DLNGHGTH AG++GS+ FGVAK+  ++ VK L + G GT+ 
Sbjct: 169 EFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 284 DVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAG 343
            ++  +E+  ++                 N+SLGS KS  +  A+N     G+   +AAG
Sbjct: 228 SILSALEFAVQD------CQEHEDSQCVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 344 NEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSR 399
           N + +AC +SP+ A  +ITVGA    DDR    A FSNWG CVD+FAPG+N+ S      
Sbjct: 282 NFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDW 338

Query: 400 NATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD- 458
            + +  SGTSMA+P V G+++ LL            D V P+ +++ + + +T GV    
Sbjct: 339 PSFVKYSGTSMASPIVCGMVALLLD-----------DGVPPEDIRDYLQELATDGVFKKR 387

Query: 459 ---VNEETPNRLVYNGGGKKLDEF 479
                  TPN ++YNG  K  DE+
Sbjct: 388 TLVFKPGTPNSVLYNGNKKHDDEY 411

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  190 bits (483), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 186/350 (53%), Gaps = 36/350 (10%)

Query: 148 VIEIVFQDPLVKFIEHESTVRISNSS---RQEDAPWGLHRISHRERAKYGQDLE------ 198
           V E+V     V + EH+      NS    RQ  AP  L R+S R +  Y  + E      
Sbjct: 84  VAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEG 143

Query: 199 ---YLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGI 254
              Y Y++   G G+ +Y++DTGI  EH +F GRA +G  +   +   D NGHGTH AGI
Sbjct: 144 SFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTHVAGI 202

Query: 255 IGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANL 314
           +GS  +GVAK+  ++ VK L + G+G ++ VI  +E+ A NH                NL
Sbjct: 203 VGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEF-AVNHC-----RSSEGKGCVINL 256

Query: 315 SLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRA 373
           SLG+ ++  +  AV AA + G+   +AAGN + +ACL+SPA A ++ITVGA    +D  A
Sbjct: 257 SLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTDSIA 316

Query: 374 FFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEF 433
            FSNWG+CVD+FAPG+ + S         +  SGTSMA+P + G+ + LL      D   
Sbjct: 317 KFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL------DEGV 370

Query: 434 FYDTVSPQQLKEKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEF 479
            YD     ++K+ ILK +T  V           TPNR+ +NG  K  D+F
Sbjct: 371 PYD-----KIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKNDDKF 415

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  192 bits (487), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 174/316 (55%), Gaps = 37/316 (11%)

Query: 175 QEDAPWGLHRISHR--------ERAKYGQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 225
           Q  AP  L RIS R           ++ + + Y YED   G+ + +Y+LDTGI  EH DF
Sbjct: 154 QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 226 EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 285
           E R   GA +   +   D NGHGTH AGI+GS+ FGVAKN  ++ VKVL   G G ++ V
Sbjct: 214 ENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 286 IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           + GI++ A +H               AN+SLG+ ++  +  A++ A   G+   +AAGN 
Sbjct: 273 LSGIQF-AVDHC--RLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 346 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINI--MSTYIGSR 399
           +  AC +SPA A+ +ITVGA    DDR    A+FSNWG CVD+FAPG+ I  +S    S 
Sbjct: 330 NVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESH 386

Query: 400 NATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDV 459
           +  ++ SGTSMA+P VAG+ + LL              V P  +K+K+L  ST+ V   +
Sbjct: 387 HKHVTHSGTSMASPVVAGLAAILLD-----------KGVEPFDVKDKLLHLSTKDVFNKL 435

Query: 460 ----NEETPNRLVYNG 471
                  TPN++ YNG
Sbjct: 436 TLFFKYGTPNKIAYNG 451

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  191 bits (484), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/386 (36%), Positives = 194/386 (50%), Gaps = 60/386 (15%)

Query: 135 GLFRGYTGYFTDEVIEIVFQDPLV-----------------------KFIEHESTVRISN 171
           G FRG T   T +V+  + ++PLV                         I+    +   N
Sbjct: 63  GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKN 122

Query: 172 S---SRQEDAPWGLHRISHR--------ERAKYGQDLEYLYED-AAGTGVTSYVLDTGID 219
           S     Q  AP  L R+S R        ++  Y   L Y Y     GT V +Y++D+GID
Sbjct: 123 SYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGID 182

Query: 220 TEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGE 279
              E+FEGRA  G  +   +   D NGHGTH AG++GS+ +GVAKN  ++ VK L   G 
Sbjct: 183 INQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGS 241

Query: 280 GTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFA 339
           G++  VI  +E+V  NH               ANLSLG+   P +  A+ A VD GV   
Sbjct: 242 GSLITVISALEFVV-NHCGKSKSKKC-----VANLSLGAFMMPLLNEAIKATVDSGVVVV 295

Query: 340 IAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTY 395
           +AAGN + DAC  SPA  + +ITVGA    DDR    A FSNWG+CVD+FAPG+ I S  
Sbjct: 296 VAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLS 352

Query: 396 IGSRNATLSLSGTSMAAPHVAGILSYLLS--LQPAQDSEFFYDTVSPQQLKEKILKFSTR 453
           I     ++  SGTSMA+P VAGI+S LL   ++     ++ ++  +    +++ L F  R
Sbjct: 353 IKDNQKSVEFSGTSMASPQVAGIVSILLDQGVENEDIRDYLFELATDDVFQKRTLLFKPR 412

Query: 454 GVLGDVNEETPNRLVYNGGGKKLDEF 479
                    TPNR+ +NG  KK ++F
Sbjct: 413 ---------TPNRITFNGISKKDEDF 429

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  191 bits (484), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 175/331 (52%), Gaps = 29/331 (8%)

Query: 163 HESTVRISNSSRQEDAPWGLHRISHR--------ERAKYGQDLEYLYED-AAGTGVTSYV 213
           +E      N + Q DAP  L RIS          ++ +Y     Y YED   G  V +Y+
Sbjct: 162 YEDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYI 221

Query: 214 LDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKV 273
           +DTGI ++H +FE R   G  + + +   D NGHGTH AG++GS+ +G AK  N++ VKV
Sbjct: 222 MDTGIFSDHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKV 280

Query: 274 LRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVD 333
           L  +G G  S+V+ G+E++ ++                ANLSLGS +SP + MAV  A++
Sbjct: 281 LGKDGSGEASNVLSGLEFIVEH---CTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIE 337

Query: 334 CGVHFAIAAGNEDEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIM 392
            G+ F  AAGN + DA  +SPA AE  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 338 EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 397

Query: 393 STYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFST 452
           S    +   TL LSGTSM+ P V G+ + LLS             + P  + ++I   ST
Sbjct: 398 SLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS-----------KGIEPALIAQEIEYLST 446

Query: 453 RGVLGD----VNEETPNRLVYNGGGKKLDEF 479
           R V           T N+++YNG  K  D +
Sbjct: 447 RNVFHRRTLFFKPSTANQILYNGVDKLDDPY 477

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  192 bits (487), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 174/318 (54%), Gaps = 32/318 (10%)

Query: 175 QEDAPWGLHRISHRERAKYGQ--DLEYLY-----EDAAGTGVTSYVLDTGIDTEHEDFEG 227
           Q DAP  L R   R    +    D EY +     E+  G GV  YVLD+GI   H +F+G
Sbjct: 428 QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDG 487

Query: 228 RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 287
           RA +G +    +   DLNGHGTH AG++GSR FG+AK  NI  +KV+  +G G+ S++I 
Sbjct: 488 RAHFG-IDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNIIA 546

Query: 288 GIEYVAKNHIAXXXXXXXXXXXXTANLSLG--SSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           G+E+  K+                AN+SLG  S    A++ AV AA++ G+ F +AAGN 
Sbjct: 547 GVEFAVKH-------CQQSGKRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNS 599

Query: 346 DEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLS 404
            E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N    
Sbjct: 600 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTMRV 659

Query: 405 LSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD---VNE 461
           L+GTSM+AP  AG+++ LL              + P ++K+ +L  ST+G+      V+ 
Sbjct: 660 LNGTSMSAPITAGVVAVLLD-----------QGIEPHEVKDHLLSISTKGLFHKRRLVSS 708

Query: 462 ETPNRLVYNGGGKKLDEF 479
            TP+R ++ G  ++ D F
Sbjct: 709 RTPDRALFTGVKREDDSF 726

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  183 bits (465), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 179/322 (55%), Gaps = 39/322 (12%)

Query: 175 QEDAPWGLHRISHRERAKYG--------QDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 225
           Q++AP  L RIS R    Y          +  Y Y+D+  GT V +YV+DTGI  EH  F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 226 EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 285
           +GRAK+GA +   +   DLNGHGTH AG+IGS+ +GVAK+ +++ VK L + G+G ++ V
Sbjct: 193 QGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 286 IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           I  IE+   NH               ANLSLGS ++  +  AV AA++ GV   +AAGN 
Sbjct: 252 ISAIEFTV-NHC------RKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 346 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 401
           + +AC SSPA +  +I+VGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 305 NANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 402 TLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD--- 458
           +++ SGTSMA+P V G+++ LL              + P  +KE+++  +T  V      
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLLD-----------SGIHPFDIKEELINTATDSVFHKRAL 410

Query: 459 -VNEETPNRLVYNGGGKKLDEF 479
                TPNR+ + G  K+ D F
Sbjct: 411 LFKPGTPNRVAFTGVEKEDDIF 432

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  186 bits (473), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/314 (38%), Positives = 167/314 (53%), Gaps = 37/314 (11%)

Query: 175 QEDAPWGLHRISHRERA--------KYGQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDF 225
           Q  AP  L RIS R++         ++ + L Y Y+D   G GV +YV+DTGI  EH+DF
Sbjct: 287 QRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEHKDF 346

Query: 226 EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 285
           E R ++G  +   + A DLNGHGTH AG+IGS+ +GV K   I+ VK +   G   +S +
Sbjct: 347 EDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQLSHI 405

Query: 286 IKGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           I+ IEY   +                 N+SLGS     +  AV +A+  GV F +AAGN 
Sbjct: 406 IEAIEYTVND-----CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAGNN 460

Query: 346 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 401
           + DAC SSP  ++ +ITVGA    DDR    A FSNWG CVD+FA G+ + S        
Sbjct: 461 NIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPYK 517

Query: 402 TLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD--- 458
            +  SGTSMA+P V G +S LLS             V P  ++E+++K ST+G       
Sbjct: 518 YIKYSGTSMASPIVCGFVSILLS-----------QGVKPNDVQEEMVKLSTKGDFTRRSL 566

Query: 459 -VNEETPNRLVYNG 471
                T NR+++NG
Sbjct: 567 IFKPFTSNRILFNG 580

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  182 bits (463), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 132/322 (40%), Positives = 179/322 (55%), Gaps = 41/322 (12%)

Query: 175 QEDAPWGLHRISHR------ERAKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEG 227
           Q  AP  L RIS R      E+      L+Y Y E+  G GV  YVLD+G++ +H DFEG
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 228 RAKWGAVIPENDEAS-DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVI 286
           RA  G  I    E S DL GHGTH AG+IGS+ +GVAK  NI+ VKVL S G+GTV+++I
Sbjct: 214 RAMKG--IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 287 KGIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPA-MEMAVNAAVDCGVHFAIAAGNE 345
           +G+EYV    I               N+SLG+  + + ++ AV+A ++ GV   +A GN 
Sbjct: 272 EGLEYVVNQCIG-------KKRKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNS 324

Query: 346 DEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNA 401
             +AC  SPA   K+ITV A    DDR    A FSNWG C+D++APG+N+ S     R  
Sbjct: 325 GLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGR-G 380

Query: 402 TLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD--- 458
           T  LSGTSMA+P VAG  +  L                P ++++ + K +TRGV      
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYLD-----------QGADPAEVRKILSKTATRGVFKKRAI 429

Query: 459 -VNEETPNRLVYNGGGKKLDEF 479
            V   TPN+++Y G  ++ DEF
Sbjct: 430 AVRPRTPNKVLYTGNNQEDDEF 451

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  180 bits (456), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 191/383 (49%), Gaps = 56/383 (14%)

Query: 135 GLFRGYTGYFT----DEVIEIVFQDPLVKFI--------------EHESTVRISNSSRQE 176
           G F+G T         +++E + Q+PLV  I               +E T    +   Q 
Sbjct: 61  GKFKGITMNIAHNKKQKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQS 120

Query: 177 DAPWGLHRISHRER--------AKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHEDFEG 227
           +AP  L RIS R++        + Y +   Y Y ++  G  V +Y+LD+G+     DFEG
Sbjct: 121 EAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEG 180

Query: 228 RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 287
           R ++G     + E  D NGHGTH AG++GS+ +GVAK   ++ VK L   G GT+  V+ 
Sbjct: 181 RVEFGFDFTGDGEG-DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLS 239

Query: 288 GIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE 347
            IE+      A             ANLSLGS K+  +  A+ AA + GV   +AAGN + 
Sbjct: 240 AIEF------AVNDCHEHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNI 293

Query: 348 DACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATL 403
           +AC +SPA AE++ITVGA    DDR    A FSNWG CVD++APG+ + S         +
Sbjct: 294 NACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNI 350

Query: 404 SLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD----V 459
           S SGTSMA+P V G ++ LL      D            +K  ++K +T  V        
Sbjct: 351 SYSGTSMASPIVCGQVAILLDKGIPND-----------DIKSTLIKMATDDVFQKRTLLF 399

Query: 460 NEETPNRLVYNGGGKKLDEFWRF 482
              TPNR+++NG  K+ D++  +
Sbjct: 400 KPNTPNRVLFNGIEKEDDQYKEY 422

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  180 bits (457), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 171/344 (49%), Gaps = 51/344 (14%)

Query: 175 QEDAPWGLHRISHRER--------AKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDF 225
           Q +AP  L R+S R +         +Y  D  Y Y     G  V +YVLD+G+  +H DF
Sbjct: 160 QSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCDF 219

Query: 226 EGRAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDV 285
           EGRA +GA    +  + D NGHGTH AG+IGS+ +GV+K  NI+ VKVL S G GT+  V
Sbjct: 220 EGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDTV 279

Query: 286 IKGIEYVAKNHIAXXXXXX-------------------XXXXXXTANLSLGSSKSPAMEM 326
           + G+E+V+ NH                                   NLSLG+ +S  +  
Sbjct: 280 MSGLEFVS-NHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 327 AVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCV 382
           A+   +  G+   +AAGN + +AC +SPA     ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 383 DVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQ 442
           D+FAPG+ + S         +  +GTSMA P V G+++ LL              + P Q
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD-----------SGIKPTQ 444

Query: 443 LKEKILKFSTRGVLGD----VNEETPNRLVYNGGGKKLDEFWRF 482
           +K+++ + +T  +           TPNR+ +NG  +  D++  +
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHY 488

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  182 bits (461), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 173/318 (54%), Gaps = 32/318 (10%)

Query: 175 QEDAPWGLHRISHRERAKY----GQDLEY-LYEDAA--GTGVTSYVLDTGIDTEHEDFEG 227
           Q  AP  L R   R    +     +D E+  Y DA   G  V  Y+LD+GI   H +FEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 228 RAKWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 287
           RA +G +   N+   DLNGHGTH AG++GS+ +G AK   I  VKV+  +G G+ S++I 
Sbjct: 330 RAVFG-IDTTNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 288 GIEYVAKNHIAXXXXXXXXXXXXTANLSLG--SSKSPAMEMAVNAAVDCGVHFAIAAGNE 345
           G+E+  K+                AN+SLG  S    A++ AV AA++ G+ F +AAGN 
Sbjct: 389 GVEFAVKH-------CQQSGKKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNS 441

Query: 346 DEDACLSSPAGAEKSITVGA-STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLS 404
            E AC  SPA  + +ITVGA    SD  A FSN+G CVD+FAPG+ + S      N    
Sbjct: 442 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRV 501

Query: 405 LSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGD---VNE 461
           L+GTSM+AP  AG+++ LL              V  + +KE+++  ST+GV      V+ 
Sbjct: 502 LNGTSMSAPITAGVVAVLLD-----------QGVKHEDVKERLIDLSTKGVFHRRRLVSS 550

Query: 462 ETPNRLVYNGGGKKLDEF 479
            TP+R ++NG  ++ D F
Sbjct: 551 RTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  170 bits (430), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 112/312 (35%), Positives = 163/312 (52%), Gaps = 37/312 (11%)

Query: 178 APWGLHRISHRERAKYG--------QDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGR 228
           AP  L ++S R +  Y         + + Y Y+    GT    Y++DTG+  EH++F  R
Sbjct: 153 APRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEFGNR 212

Query: 229 AKWGA-VIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIK 287
             +G   I E     D NGHGTH AG+IGS+ FGVAKN  +  VKVL   G G ++ V++
Sbjct: 213 VHFGGDFIGEG--KGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSVLE 270

Query: 288 GIEYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE 347
           GIE+   N                 N+SLG+ ++P +  A+  A   G+   +AAGN + 
Sbjct: 271 GIEFAVNN---CKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNNNF 327

Query: 348 DACLSSPAGAEKSITVGASTFSDDR----AFFSNWGTCVDVFAPGINIMSTYIGSRNATL 403
            AC +SPA +  +ITVGA    DDR    A FSNWG CVD+FAPG+ I S         +
Sbjct: 328 SACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGV 384

Query: 404 SLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDV---- 459
             SGTSMA+P VAG+++ L+      D           ++K+K++  S++ +   +    
Sbjct: 385 IHSGTSMASPIVAGLVAILMEKGYKCD-----------EIKQKLIDDSSKSIFSKLTLFF 433

Query: 460 NEETPNRLVYNG 471
              TPNR++YNG
Sbjct: 434 KYGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  150 bits (378), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 150/293 (51%), Gaps = 12/293 (4%)

Query: 137 FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQD 196
           FR   G F   ++E ++ D  +  +  +  +  +    QE AP  L R+S +   + G D
Sbjct: 55  FRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSD 113

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA-SDLNGHGTHCAGII 255
             Y+Y    G GV  Y+LDTGID  H + EGR +  A +  N  +  D +GHGT  AG+I
Sbjct: 114 GTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVI 173

Query: 256 GSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTANLS 315
           GS  FG AK  N+  V+V  S G  T+  VI+ +E+ +K                   + 
Sbjct: 174 GSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASK-------LASVTQRPSVVVIP 226

Query: 316 LGSSKSPAMEMAVNAAV-DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA--STFSDDR 372
               K+  +  A+ A + D  +   +A GN +++AC SSPA A  ++T+G+   T  D  
Sbjct: 227 FTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSL 286

Query: 373 AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
           A F+N+G C+D FA G+NI S   G   +    SGTS++A   +G+++Y +SL
Sbjct: 287 APFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  150 bits (380), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 160/318 (50%), Gaps = 31/318 (9%)

Query: 173 SRQEDAPWGLHRISHRERAKYGQDLEYLY---EDAAGTGVTSYVLDTGIDTEHEDFEGRA 229
           S Q +AP  L R S   +     +  Y Y    D  G  VT YVLD+GI  +H +FEGR 
Sbjct: 143 STQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGRI 202

Query: 230 KWGAVIPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGI 289
              A    +    D  GHGT  AGIIGS+ +GVAKN N++ +KVL + G+G V  +++G+
Sbjct: 203 -LEAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQGL 261

Query: 290 EYVAKNHIAXXXXXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDA 349
           +++ K+                 N SLG+     +  A     + G+    AAGN   +A
Sbjct: 262 QFITKH------CEENTNGNCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNA 315

Query: 350 CLSSPAGAEKSITVGASTFSDDR-AFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGT 408
           C  +PAG++   TVG+    DD  A FSNWG CVD+ APG+ + +    ++  +   SGT
Sbjct: 316 CWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGT 375

Query: 409 SMAAPHVAGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEE------ 462
           S++ P V G+ + LLS             V  + L ++I K  +R +L   N+E      
Sbjct: 376 SVSTPIVTGLAAILLS-----------KGVPKENLYDEIRKMGSRDLLR--NKEFSRLPG 422

Query: 463 TPNRLVYNGGGKKLDEFW 480
           TPN L+ N G +K D+ +
Sbjct: 423 TPN-LIVNIGPQKEDDVY 439

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  142 bits (358), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 169/335 (50%), Gaps = 26/335 (7%)

Query: 137 FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQD 196
           FR   G F  +++E  ++   +  +  +  + ++    Q+ AP  L R+S +   + G  
Sbjct: 55  FRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNG 114

Query: 197 LE---YLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS-DLNGHGTHCA 252
            +   Y+Y   AG GV  Y+LDTGID  H  FEGR +  A    +  A+ D +GHGT  A
Sbjct: 115 SDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVA 174

Query: 253 GIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTA 312
           G+IGS  FGVAK  N+  V+V  S G  ++  V++ +E+ +K                  
Sbjct: 175 GVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK-------LAAVTKRPSLI 227

Query: 313 NLSLGSSKSPAMEMAVNAAV-DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFS-- 369
            + L   ++  +  AV A V D  +   +AAGNE+  AC  SPAGA  ++T+G+   +  
Sbjct: 228 TIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARN 287

Query: 370 DDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPAQ 429
           D  A F+N+  CVD+F  G+++ +  +   ++   LSGTS++A   +G+++Y +S+    
Sbjct: 288 DALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVASGLVAYYMSI---- 342

Query: 430 DSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETP 464
              +  D V+      KI   S   V+ ++ + +P
Sbjct: 343 -GHYGMDAVN------KIKLLSLPNVIPNLQQRSP 370

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  130 bits (327), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 151/303 (49%), Gaps = 22/303 (7%)

Query: 137 FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH---RERAKY 193
           F G++G F DEV+  ++ DP V  I  +  + +    RQ DAP  L R+S+     R   
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 194 GQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGR--AKWGAVIPENDEASDLNGHGTHC 251
             +  +++   AG GV  Y++D+GID++H  F  R  +K   +        D +GHGT  
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGDPHGHGTAI 180

Query: 252 AGIIGSRHFGVAKNTNILAVKVLRSNGEGT-VSDVIKGIEYVAKNHIAXXXXXXXXXXXX 310
           AG++ S  FGV K  N+  V+V+ +   G  +S ++K +E++ +NH              
Sbjct: 181 AGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI-ENH------SRATMRPS 233

Query: 311 TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS---ITVGAST 367
            A L    SK+  +  A+ +  +  +   + AGN+   AC  SPA A  S   ++VG+  
Sbjct: 234 VAVLPFSMSKNAILNSAIESMPN-SIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLD 292

Query: 368 F--SDDRAFFSNWGTCVDVFAPGI---NIMSTYIGSRNATLSLSGTSMAAPHVAGILSYL 422
           +  S + A FSN+G CVDVF  G+    + +T     N    +SGTSM+    AG + Y 
Sbjct: 293 YRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYY 352

Query: 423 LSL 425
           +SL
Sbjct: 353 MSL 355

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  122 bits (306), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 90/314 (28%), Positives = 156/314 (49%), Gaps = 27/314 (8%)

Query: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188
           +  +I   F  ++G  + E +  VF+D     I  E  + +    +Q DAP  L R++ +
Sbjct: 51  LPIEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-K 109

Query: 189 ERAKYGQ----DLEYLYEDAAGTGVTSYVLDTGIDTEHEDF--EGRAKWGAVIPENDEAS 242
           +  K  Q    + +Y++ D +G GV  Y++DTGID +H  +      K   +      + 
Sbjct: 110 DSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSG 169

Query: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGE-GTVSDVIKGIEYVAKNHIAXXX 301
           D NGHGT  AGII S  FGV K+ N++ V+V+ +N +  T+S V+  +  + K+      
Sbjct: 170 DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHE----- 224

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEK-- 359
                       L   + K+  +E A+   +   +   I AGN+ ++AC  SP G +K  
Sbjct: 225 --QKTMRPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 360 -SITVGASTFSD-----DRAFFSNWGTCVDVFAPGINIMSTYI---GSRNATLSLSGTSM 410
             + VG+  +S+     D A FSN+G+CVD++  G++I +      G +    +++GTS 
Sbjct: 282 NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 411 AAPHVAGILSYLLS 424
           +   VAG++ Y +S
Sbjct: 342 SCGIVAGVVGYYMS 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  117 bits (293), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/308 (29%), Positives = 148/308 (48%), Gaps = 29/308 (9%)

Query: 135 GLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYG 194
           G FR +TG F+  +++ ++ DP V  I  + ++++     Q +AP  L  +S      + 
Sbjct: 52  GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPLSHQ 111

Query: 195 QDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKW------GAVIPENDEASDLNGHG 248
               ++Y    G GV  Y+LDTGID +H +              + +P+    +D  GHG
Sbjct: 112 ---PFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQ---GTDPQGHG 165

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           T  AGII S  FGV K  N++ V+V  SNG+  +S +++ +  + + HI           
Sbjct: 166 TAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT-LTQRHIEGTKRPSVVVI 224

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKS----ITVG 364
                L +    +P +  A+ A+ D  V   I AGN  +DA   SPA         I VG
Sbjct: 225 P----LEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVG 279

Query: 365 ASTFSDDRAFFSNWGTCVDVFAPG---INIMSTYIGSRNATLSL----SGTSMAAPHVAG 417
           +   +++   F+N+G+ VDVF  G     + ST + S+  + SL    SGTS ++   AG
Sbjct: 280 SVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAG 339

Query: 418 ILSYLLSL 425
           ++ Y +SL
Sbjct: 340 VIGYYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 132/298 (44%), Gaps = 27/298 (9%)

Query: 137 FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQD 196
           F+   G F+ E +E ++ D  V  I  +  +++     Q  +P  L ++S          
Sbjct: 53  FKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGG------- 105

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKW------GAVIPENDEASDLNGHGTH 250
             + ++  +G  V  YV DTGID +H   +            + +P     +D +GHGT 
Sbjct: 106 -SFTFDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPR---GADPHGHGTM 161

Query: 251 CAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXX 310
            AG+I S  FGV K+ +++ V+V   +GE  +S ++KGI        A            
Sbjct: 162 MAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-------ASVAHARFTKRPS 214

Query: 311 TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 370
              L +   K   +      A+   +   + AGN+  DAC  SP      + +G+    +
Sbjct: 215 VFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDN 274

Query: 371 DRAFFSNWGTCVDVFAPGINIM---STYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425
             A FSN+G CVDV+  G +I+   ST  G+     S +GTS +    AGI+ Y +S+
Sbjct: 275 RLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/311 (27%), Positives = 144/311 (46%), Gaps = 44/311 (14%)

Query: 137 FRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHRERAKYGQD 196
           F+ ++     + +  ++ D  +  I  +  +       Q+DAP  L ++   E      D
Sbjct: 59  FQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAG----D 114

Query: 197 LEYLYEDAAGTGVTSYVLDTGID--------TEHEDFEGRAKWGAVIPENDEASDLNGHG 248
            E++Y+  AG GV  Y+ DTGI         +   D  G        P  D+  ++  HG
Sbjct: 115 NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGP----PIRDQ--EILEHG 168

Query: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXX 308
           T  +G+IGS  FGV K  N++ V V   NG+  +S V+KG+  V + H+           
Sbjct: 169 TAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLV-QQHVK------HTNR 221

Query: 309 XXTANLSLGSSKSPAMEMAVNAAVDC---GVHFAIAAGNEDEDACLSSPAGAEKS---IT 362
               N S  + K+  +    N+A D     V  A+AAGN  +  C  SP G +++   + 
Sbjct: 222 PSVINFSYCTLKNAIL----NSAFDNFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLA 277

Query: 363 VGASTFSDD---RAFFSNWGTCVDVFAPGINIMSTYI------GSRNATLSLSGTSMAAP 413
            G+   +DD    + FSN+G+CV  +APG  +++  I       SR+  + +SGTS ++ 
Sbjct: 278 FGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSA 337

Query: 414 HVAGILSYLLS 424
             AG++ Y ++
Sbjct: 338 LGAGVIGYYMA 348

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 100/257 (38%), Gaps = 34/257 (13%)

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 248
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P+     D   HG
Sbjct: 157 LDVWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY--HG 214

Query: 249 THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY-VAKNHIAXXX 301
           T CAG I ++        GV  N  I  +++L  +GE T  D    + Y +  N I    
Sbjct: 215 TRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDEAASLIYGLDTNDIYSCS 272

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDC-GVHFAIAAGN--EDEDAC-LSSPAGA 357
                        S    K  A+   V    D  G  +  A+GN     D C       +
Sbjct: 273 WGPADDGRHLQGPSDLVKK--ALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYTNS 330

Query: 358 EKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMA 411
             SIT+GA    D    +S    C  V A       G  I S+ I  R +  S  GTS A
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSN-SHGGTSAA 387

Query: 412 APHVAGILSYLLSLQPA 428
           AP  AG+ + LL   P+
Sbjct: 388 APLAAGVYTLLLEANPS 404

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 102/257 (39%), Gaps = 34/257 (13%)

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 248
           ++  Y +  G GV + ++D G+D E+ED    F     W       +P+   + D   HG
Sbjct: 157 VDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 249 THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY-VAKNHIAXXX 301
           T CAG I ++        GV  N  I  +++L  +GE T  D    + Y +  N I    
Sbjct: 215 TRCAGEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIYGLDTNDIYSCS 272

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDC-GVHFAIAAGN---EDEDACLSSPAGA 357
                        S    K  A+   V    D  G  +  A+GN     ++        +
Sbjct: 273 WGPADDGRHLQGPSDLVKK--ALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYTNS 330

Query: 358 EKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMA 411
             SIT+GA    D    +S   +C  V A       G  I S+ I  +  + S  GTS A
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGK-CSDSHGGTSAA 387

Query: 412 APHVAGILSYLLSLQPA 428
           AP  AG+ + LL   P+
Sbjct: 388 APLAAGVYTLLLEANPS 404

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 100/256 (39%), Gaps = 34/256 (13%)

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 248
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P+   + D   HG
Sbjct: 157 LDLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 249 THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY-VAKNHIAXXX 301
           T CAG I ++        GV  N  I  +++L  +G+ T  D    + Y +  N I    
Sbjct: 215 TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDVNDIYSCS 272

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDC-GVHFAIAAGN---EDEDACLSSPAGA 357
                        S    K  A+   V    D  G  +  A+GN     ++        +
Sbjct: 273 WGPADDGRHLQGPSDLVKK--ALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNS 330

Query: 358 EKSITVGASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMA 411
             SIT+GA    D    +S    C  V A       G  I S+ I  R +  S  GTS A
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSN-SHGGTSAA 387

Query: 412 APHVAGILSYLLSLQP 427
           AP  AG+ + LL   P
Sbjct: 388 APLAAGVYTLLLEANP 403

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 94/250 (37%), Gaps = 30/250 (12%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           YE+  G G+   ++D G+D E+ D    F     W       +P+   A D   HGT CA
Sbjct: 175 YENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY--HGTRCA 232

Query: 253 GIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXX 306
           G I +         GVA N  +  +++L  +GE T  D    + +    +          
Sbjct: 233 GEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPK 290

Query: 307 XXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE--DAC-LSSPAGAEKSITV 363
                        K   +    +     G  +  A+GN     D C       +  SIT+
Sbjct: 291 DDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYSITI 350

Query: 364 GASTFSDDRAFFSNWGTCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAG 417
           GA         +S   +C  V A       G  I ST IG++  +    GTS AAP  AG
Sbjct: 351 GALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNK-CSDHHGGTSAAAPLAAG 407

Query: 418 ILSYLLSLQP 427
           I S +L + P
Sbjct: 408 IFSLVLQVNP 417

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 96/249 (38%), Gaps = 29/249 (11%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           YE+  G  V   V+D G+D E ED    F     W       +P+   + D   HGT CA
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDY--HGTRCA 213

Query: 253 GII--GSRHF---GVAKNTNILAVKVLRS--NGEGTVSDVIKGIEYVAKNHIAXXXXXXX 305
           G I  G   F   GVA N  +  +++L +    E   + +I  ++       +       
Sbjct: 214 GEIAAGKNQFCGVGVAYNAKVAGLRILSAEVTSEDEAASLIHALDVNDIYSCSWGPSDDG 273

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNE---DEDACLSSPAGAEKSIT 362
                  +L     K   +   +    + G  +  A+GN    D++        +  SIT
Sbjct: 274 RSLQGPDDL----VKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYSIT 329

Query: 363 VGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPHVAGI 418
           VGA         +S   + V V       G +I ST I  R  + +  GTS AAP  AG+
Sbjct: 330 VGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGR-CSDTHGGTSAAAPLAAGV 388

Query: 419 LSYLLSLQP 427
            S +L   P
Sbjct: 389 YSLVLEANP 397

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 101/257 (39%), Gaps = 34/257 (13%)

Query: 197 LEYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHG 248
           L+  Y +  G GV + ++D G+D E+ED    F     W       +P+   + D   HG
Sbjct: 157 LKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HG 214

Query: 249 THCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY-VAKNHIAXXX 301
           T CAG I ++        GV  N  I  +++L  +G+ T  D    + Y +  N I    
Sbjct: 215 TRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDTNDIYSCS 272

Query: 302 XXXXXXXXXTANLSLGSSKSPAMEMAVNAAVDC-GVHFAIAAGN---EDEDACLSSPAGA 357
                        +    K  A+   V    D  G  +  A+GN     ++        +
Sbjct: 273 WGPADDGRHLQGPNDLVKK--ALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYDGYTNS 330

Query: 358 EKSITVGASTFSDDRAFFSNWGTCVDV--FAPGINIMSTYIGSRNATLSLS----GTSMA 411
             SIT+GA    D    +S   + V V  ++ G      YI S +     S    GTS A
Sbjct: 331 IYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSG---SGEYIHSSDINGGCSNTHGGTSAA 387

Query: 412 APHVAGILSYLLSLQPA 428
           AP  AG+ + LL   P+
Sbjct: 388 APLAAGVYTLLLEANPS 404

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 98/256 (38%), Gaps = 43/256 (16%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           YE+  G GV + ++D G+D E+ D    F     W       +P+     D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDY--HGTRCA 242

Query: 253 GIIGSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY-VAKNHIAXXXXXXXX 306
           G I +        GVA N  +  +++L  +GE T  D    + Y +  N I         
Sbjct: 243 GEIAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVYGLGVNDIYSCSWGPAD 300

Query: 307 XXXXTANLSLGSSKSPAMEMAVNAAV--------DCGVHFAIAAGN---EDEDACLSSPA 355
                     G       E+   A V        + G  +  A+GN    D++       
Sbjct: 301 D---------GRQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYT 351

Query: 356 GAEKSITVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMA 411
            +  SITVGA         ++   + V V       G +I ST + ++  +    GTS A
Sbjct: 352 NSIYSITVGAIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQ-CSHRHGGTSAA 410

Query: 412 APHVAGILSYLLSLQP 427
           AP  AGI S +L   P
Sbjct: 411 APLAAGIYSLVLEANP 426

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 18/100 (18%)

Query: 194 GQDL---EYLYEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEAS 242
           G DL   E  Y +  G GV + ++D G+D E ED    F     W       +P+     
Sbjct: 144 GNDLNITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGD 203

Query: 243 DLNGHGTHCAGIIGSRH-----FGVAKNTNILAVKVLRSN 277
           D   HGT CAG I +        GVA N  +  +++L ++
Sbjct: 204 D--NHGTRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 97/250 (38%), Gaps = 30/250 (12%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           Y++  G GV + V+D G+D E+ D    F     W       +P+   A D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY--HGTRCA 209

Query: 253 GIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSDVIKG-IEYVAKNHIAXXXXXXX 305
           G I +         GVA +  +  +++L  +GE T  D     I  +  N I        
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL--SGEITAEDEAAALINALDINDIYSCSWGPQ 267

Query: 306 XXXXXTANLSLGSSKSPAMEMAVN-AAVDCGVHFAIAAGNEDE--DAC-LSSPAGAEKSI 361
                    S    K  A+   VN    + G  +  A+GN     D C       +  SI
Sbjct: 268 DDGTHLQGPSDLVKK--ALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYTNSIYSI 325

Query: 362 TVGASTFSDDRAFFSNWGTCVDVFA----PGINIMSTYIGSRNATLSLSGTSMAAPHVAG 417
           TVGA    D    +S   + V V       G  I +T I ++       GTS AAP  AG
Sbjct: 326 TVGAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDINNK-CNDRHGGTSAAAPLAAG 384

Query: 418 ILSYLLSLQP 427
           I + LL   P
Sbjct: 385 IYTLLLQANP 394

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 18/101 (17%)

Query: 198 EYLYEDAAGTGVTSYVLDTGIDTEH----EDFEGRAKW----GAVIPENDEASDLNGHGT 249
           +  YE+  GTG+ + ++D G+D ++    ++F     W       +P+     D   HGT
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDY--HGT 240

Query: 250 HCAGIIGSRH------FGVAKNTNILAVKVLRSNGEGTVSD 284
            CAG I +         GVA +  +  +++L  +GE T  D
Sbjct: 241 RCAGEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAED 279

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 94/249 (37%), Gaps = 29/249 (11%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           YE+  G  V   V+D G+D E ED    F     W       +P+   + D   HGT CA
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDY--HGTRCA 212

Query: 253 GIIGSRH-----FGVAKNTNILAVKVLRS--NGEGTVSDVIKGIEYVAKNHIAXXXXXXX 305
           G I +        GVA N  +  +++L +    E   + +I  ++       +       
Sbjct: 213 GEIAAVKNKACGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALDVNDIYSCSWGPLDDG 272

Query: 306 XXXXXTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSIT 362
                  +L     +   +        + G  +  A+GN    D++        +  SIT
Sbjct: 273 RVLQGPDDL----VRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSIT 328

Query: 363 VGASTFSDDRAFFSNWGTCVDVF----APGINIMSTYIGSRNATLSLSGTSMAAPHVAGI 418
           VGA         +S   + V V       G +I ST I  +  + +  GTS AAP  AG+
Sbjct: 329 VGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGK-CSDTHGGTSAAAPLAAGV 387

Query: 419 LSYLLSLQP 427
            S +L   P
Sbjct: 388 YSLVLEANP 396

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 95/244 (38%), Gaps = 27/244 (11%)

Query: 205 AGTGVTSYVLDTGIDTEHED------FEGRAKWGAVIPENDEASDLNGHGTHCAGIIGSR 258
            G  VT  ++D G+D E+ED      FEG   +     +       + HGT CAG I + 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 259 H-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXXTAN 313
                  GVA + +I  +++L  +GE TV D    + Y  K +                 
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKYNDIFSCSWGPPDDGQHLQ 283

Query: 314 LSLGSSKSPAMEMAVNAAVDCGVHFAIAAGN---EDEDACLSSPAGAEKSITVGASTFSD 370
                 K   ++   +   + G  +  A+GN     ++        +  SIT+GA    D
Sbjct: 284 GPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGAI---D 340

Query: 371 DRAFFSNWG-TCVDVFA------PGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 423
            R     +  +C  V A       G  I +T I  + +T    GTS AAP  AG+ + LL
Sbjct: 341 HRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCSTHH-GGTSAAAPLAAGVYALLL 399

Query: 424 SLQP 427
              P
Sbjct: 400 EANP 403

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 16/88 (18%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           Y +  G+GV   ++D G+D E+ D    F     W       +P+   A D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 253 GIIGSRH------FGVAKNTNILAVKVL 274
           G I +         GVA N+ +  +++L
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRIL 250

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 19/243 (7%)

Query: 202 EDAAGTGVTSYVLDTGIDTEHEDF------EGRAKWGAVIPENDEASDLNGHGTHCAGII 255
           E+  G GV + ++D G+D E+ED       EG   +    P        + HGT CAG I
Sbjct: 151 ENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEI 210

Query: 256 GSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAXXXXXXXXXXXX 310
            +        GVA N+ +  +++L  +G+ T  D    + Y    +              
Sbjct: 211 AAFRNDICGVGVAYNSKVSGIRIL--SGQITAEDEAASLIYGLDVNDIYSCSWGPSDDGK 268

Query: 311 TANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDE--DAC-LSSPAGAEKSITVGAST 367
           T        K   ++         G  +  A+GN     D+C       +  SITVGA  
Sbjct: 269 TMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVGAID 328

Query: 368 FSDDRAFFSNWGTCVDV--FAPGI-NIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 424
           +      +S   + V V  ++ G  N + T       + +  GTS AAP  AGI + +L 
Sbjct: 329 WKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTLVLE 388

Query: 425 LQP 427
             P
Sbjct: 389 ANP 391

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 17/105 (16%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCA 252
           YE+  G GV + ++D G+D E ED    F     W       +P+     D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDY--HGTRCA 211

Query: 253 GIIGSR-----HFGVAKNTNILAVKVLRS--NGEGTVSDVIKGIE 290
           G I +        GVA N  +  +++L      E   + +I G++
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLD 256

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 13/102 (12%)

Query: 201 YEDAAGTGVTSYVLDTGIDTEHED----FEGRAKWGAVIPENDEASDL--NGHGTHCAGI 254
           YE   G GV   ++D G+D E ED    F     W     +N     L  + HGT CAG 
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDYHGTRCAGE 216

Query: 255 IGSRH-----FGVAKNTNILAVKVLRSNGEGTVSDVIKGIEY 291
           I +        GVA  + +  +++L  +G+ T  D    + Y
Sbjct: 217 IAAAKNEYCGLGVAYGSKVSGIRIL--SGQITAEDEAASLVY 256

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 15/82 (18%)

Query: 206 GTGVTSYVLDTGIDTEHED----FEGRAKW----GAVIPENDEASDLNGHGTHCAGIIGS 257
           G G+   V+D G+D E ED    F     W       +P+   + D   HGT CAG I +
Sbjct: 156 GHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDT--HGTRCAGEIAA 213

Query: 258 RH-----FGVAKNTNILAVKVL 274
                   GVA N+ +  +++L
Sbjct: 214 AKNQFCGLGVAFNSKVSGIRIL 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,773,343
Number of extensions: 2139145
Number of successful extensions: 5627
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5545
Number of HSP's successfully gapped: 84
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)