Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1636.22ON54454428020.0
Suva_15.1776.22ON54454426960.0
Smik_15.1716.22ON54454426920.0
YOR002W (ALG6)6.22ON54454426850.0
Kpol_1037.276.22ON54654620570.0
KAFR0A050706.22ON56453820450.0
CAGL0E02629g6.22ON54853620100.0
TBLA0G009706.22ON55954420050.0
TDEL0G044706.22ON54254419740.0
ZYRO0C07744g6.22ON54754019710.0
NCAS0D021606.22ON56353419660.0
NDAI0C026306.22ON58055019650.0
KLLA0D01221g6.22ON56653019590.0
SAKL0E01364g6.22ON54154319350.0
KNAG0F028906.22ON56353319300.0
TPHA0J003506.22ON55953119280.0
KLTH0C11176g6.22ON53653119110.0
Kwal_56.224376.22ON53654018810.0
Ecym_30276.22ON54953118620.0
ACR004W6.22ON56353618440.0
TPHA0J013805.669ON5752642881e-26
TBLA0A093105.669ON5463592801e-25
KLLA0F16621g5.669ON5613172801e-25
KLTH0F17666g5.669ON5552642764e-25
Kpol_1018.735.669ON6212642749e-25
CAGL0L10450g5.669ON5502652721e-24
YOR067C (ALG8)5.669ON5772642712e-24
Skud_15.2345.669ON5772632685e-24
Kwal_55.217425.669ON5552732667e-24
Smik_15.2475.669ON5772632651e-23
ZYRO0A11506g5.669ON5562662632e-23
Suva_8.1185.669ON5762592613e-23
KAFR0D024405.669ON5752932614e-23
SAKL0G00836g5.669ON5612702605e-23
NCAS0G004505.669ON5703002605e-23
TDEL0B025405.669ON5692582596e-23
ADR210C5.669ON5723012552e-22
NDAI0F005105.669ON5702632552e-22
Ecym_40515.669ON6042702463e-21
KNAG0L019205.669ON5682732427e-21
ZYRO0D01914g7.500ON27576713.8
TDEL0E014304.229ON45463698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.163
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...  1083   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...  1043   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...  1041   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...  1038   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   796   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   792   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   778   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   776   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   764   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   763   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   761   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   761   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   759   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   749   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   748   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   747   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   740   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   729   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   721   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   714   0.0  
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   115   1e-26
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   112   1e-25
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   112   1e-25
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   110   4e-25
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   110   9e-25
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   109   1e-24
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   108   2e-24
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   107   5e-24
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   107   7e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   106   1e-23
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   105   2e-23
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   105   3e-23
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   105   4e-23
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   104   5e-23
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   104   5e-23
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   104   6e-23
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   102   2e-22
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   102   2e-22
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    99   3e-21
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    98   7e-21
ZYRO0D01914g Chr4 complement(154320..155147) [828 bp, 275 aa] {O...    32   3.8  
TDEL0E01430 Chr5 complement(286064..287428) [1365 bp, 454 aa] {O...    31   8.5  

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/544 (97%), Positives = 532/544 (97%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
           KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP
Sbjct: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP
Sbjct: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
           SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS
Sbjct: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540

Query: 541 VKDL 544
           VKDL
Sbjct: 541 VKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/544 (93%), Positives = 522/544 (95%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
           K +PPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHS L GLIGTFFNP
Sbjct: 61  KATPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAA+CFVLSICFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFFAYLLSRSL FPKFNIARLTVIAFATLATFS++ APLYFLGGGLRNI+QCI+R+FPF
Sbjct: 241 PIFFAYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPF 300

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCV+NIFVKYK+RF+IQQLQLYSLVATV+GFLPAM+MTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQY VSFLL+NWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
           SFIIGTYIAMG+YH LDLFV PP KYPDLWVLLNCAVGF CFSIFWIWSYYKIFTSGNKS
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKS 540

Query: 541 VKDL 544
           +KDL
Sbjct: 541 MKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/544 (92%), Positives = 524/544 (96%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRC IGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
           K SPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHS L GLIG+FFNP
Sbjct: 61  KGSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAA+CFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFFAYLLSRSLLFPKFNIARLTVI+FATLATF+++LAPLYFLGGGL+NI+QCI+RIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPF 300

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCVTN+FVKYK+RF++QQLQLYSLVATVIGFLPAM+MTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           +DGLHLQY VSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 RDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
           SFIIGTYIAMG+YH LDLFV PPSKYPDLWVLLNC VGFTCFSIFW+WSYYKIFTSG+KS
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKS 540

Query: 541 VKDL 544
           +KDL
Sbjct: 541 MKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/544 (92%), Positives = 521/544 (95%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVI+RC IGLGPYSG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
           K SPPL+GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHS L GLIG+FFNP
Sbjct: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           SWFAL+KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA
Sbjct: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           +AILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFFAYLLSRSLLFPKFNIARLTVIAFATLATF++I APLYFLGGGL+NIHQCI+RIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF 300

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCVTN+FVKYK+RFTIQQLQLYSL+ATVIGFLPAMIMTLLHPKKHLLP
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           YVLIACSMSFFLFSFQVHEK            YSSTDWNVLSLVSWINNVALFTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGLHLQY VSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK
Sbjct: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
           SFIIGTYIAMG YH LD FV PPSKYPDLWVLLNCAVGF CFSIFW+WSYYKIFTSG+KS
Sbjct: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540

Query: 541 VKDL 544
           +KDL
Sbjct: 541 MKDL 544

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/546 (69%), Positives = 450/546 (82%), Gaps = 2/546 (0%)

Query: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYS 59
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+IVRCAIGLG YS
Sbjct: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 60  GKDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFN 119
           G  +PP+ GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HS + G+IG+F N
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 120 PSWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179
            SWFAL+ SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 180 AAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239
           AAAILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AA+CFVLSICFKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 240 APIFFAYLLSRSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIF 298
           APIFF YLL RSL   K FNI+R   IA +T+  F  + APLY  GGGLRN+ Q ++RIF
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 299 PFSRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHL 358
           PF+RG+FEDKVANFWCVTNIF+KYK  +T ++LQLYSL+ATV+GFLPA++  L +PKKHL
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 359 LPYVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPL 418
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 419 LKKDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478
           LKKDGL LQY V F LSNWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 479 WKSFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGN 538
           WK  I+ +YI M + HL ++FV PP +YPD+WVL+NC +GF CF +FW+W+YYKIFT  N
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 539 KSVKDL 544
           K+++ L
Sbjct: 541 KTLQYL 546

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/538 (69%), Positives = 442/538 (82%), Gaps = 3/538 (0%)

Query: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLH 67
           L N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RCAIGLG YSG    P+ 
Sbjct: 29  LNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMF 88

Query: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDK 127
           GDFEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HS + G IG+F  P WF L+ 
Sbjct: 89  GDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLND 148

Query: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQP 187
           SRG E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA AILFQP
Sbjct: 149 SRGIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQP 206

Query: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247
           SLMLIDHGHFQYNSVMLGLT YAINNLLD++Y++A+VCFVLSICFKQM+LYYAPIFF YL
Sbjct: 207 SLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYL 266

Query: 248 LSRSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFE 306
           LS+SL FP+ FNI RL  IA  T+ TF  + +PLY  GGGL N+ Q ++RIFPF+RGIFE
Sbjct: 267 LSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFE 326

Query: 307 DKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIAC 366
           DKVANFWCVTNI +KYK +FT  QLQLYSL ATV+GFLPA+++ +L+PKKHLLPY L AC
Sbjct: 327 DKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAAC 386

Query: 367 SMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHL 426
           SMSFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLKKDGL L
Sbjct: 387 SMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLIL 446

Query: 427 QYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGT 486
           QY V F LSNWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +
Sbjct: 447 QYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSS 506

Query: 487 YIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           Y++M V+H LD FV PP+ YPD+W+ LNC +GF  F  FW+W+YY +FT  NK++ DL
Sbjct: 507 YLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 438/536 (81%), Gaps = 4/536 (0%)

Query: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGD 69
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RCAIGLGPYSG    P+HGD
Sbjct: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75

Query: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSR 129
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHS L G +GTF NP WFALD SR
Sbjct: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135

Query: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSL 189
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAAAAILFQPSL
Sbjct: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193

Query: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253

Query: 250 RSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDK 308
           RS+ FPK FNI R   I+ ATL TF+ + +P Y  GG L  + Q + RIFPF+RGIFEDK
Sbjct: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312

Query: 309 VANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368
           VANFWCV N  VK+K  FT  QL++YSL+ TV+GF PAMI+ +L+P+KHLLPY L ACSM
Sbjct: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372

Query: 369 SFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLK++GL+LQY
Sbjct: 373 SFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432

Query: 429 TVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488
            V F LSNWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492

Query: 489 AMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
            M  YH LDLF+  P ++PDLWV+LNC +GF  FS+FW+W+YYK  T   K+++DL
Sbjct: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/544 (68%), Positives = 443/544 (81%), Gaps = 12/544 (2%)

Query: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEA 72
            EE+FYASP++DFLYPFRPVG+QWL EY+I + A+I+RCAI LG YSGK +PP+ GDFEA
Sbjct: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEA 75

Query: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFE 132
           QRHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HS  FG +G+FFNP WFAL+ SRG+E
Sbjct: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135

Query: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLI 192
           S DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAAAAILFQPSLMLI
Sbjct: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195

Query: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252
           DHGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL
Sbjct: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255

Query: 253 LFPKFNIARLTVIAFATLATFSVILAPLYFLG------------GGLRNIHQCIYRIFPF 300
           + P  NI+R  ++A +T+ +F V+  P+Y  G             GL N+ QCI RIFPF
Sbjct: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCVTN+ +KY++ FT +QLQ YSLVAT+IGFLP+MI   L+P+K L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLSLV WINNVALFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGL LQY V + LSNWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
             II +YI MG   +LDLF  PP+ YPDLW++LNC VGF CF +FW+W+ YKI    NK+
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 541 VKDL 544
           + DL
Sbjct: 556 LNDL 559

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/544 (65%), Positives = 442/544 (81%), Gaps = 2/544 (0%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           MA   +       EESFYASP+YDFLYPFRP G+QWL EY+I + A+I+ CA+G G YSG
Sbjct: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
           + SPP+ GDFEAQRHWMEITQHL  S+WYW+DL+YWGLDYPPLTA+HS + G IG+F  P
Sbjct: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
            WF L++SRG E+PD  LKT+MR TV++S+ LFY PAV+YFTKWLG++R +SPIGQ I+A
Sbjct: 121 EWFELNESRGIETPD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISA 178

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           AAILFQPSLMLIDHGHFQYN VMLGLT YAIN+L +E+YA+AA+CFVLSICFKQMALYYA
Sbjct: 179 AAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYA 238

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFFAYLLS+SL  P+FN  RL  IA AT+ +F+ + APLY  GGGL N+ Q ++RIFPF
Sbjct: 239 PIFFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           +RGIFEDKVANFWCVTN+F KYK+ F  +QLQLYSL+AT++GFLPA+I+  L+PKKH++ 
Sbjct: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           Y L  CSMSF+LFSFQVHEK            Y+S++W+VLS+ +WINNV LFTL+PLLK
Sbjct: 359 YALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLK 418

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGL LQY V F LSNWL+GNFSF+TP+FLPK LTPGPS+SS++ +YRRRS LP NV+WK
Sbjct: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
             I+ +Y AMGV H++D  + PP  YPDLWVLLNCA+GF CF++FW+WSYY +FT   K+
Sbjct: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538

Query: 541 VKDL 544
           ++ L
Sbjct: 539 LQQL 542

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/540 (67%), Positives = 444/540 (82%), Gaps = 2/540 (0%)

Query: 5   KRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSP 64
           ++   +  AEESFYASP+YDFLYPF+PVG+QWLPEYII + AVI+RCAIGLGPYSG+   
Sbjct: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69

Query: 65  PLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFA 124
           P+HGDFEAQRHW+EITQHLP+S+WY++DL+YWGLDYPPLTA+HS + G +G+  NP WFA
Sbjct: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129

Query: 125 LDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAIL 184
           L+ SRG ES  N LKTYMR TVI+S+++FY PAV+YFTKW+GR+R  SP+GQ IAAAAIL
Sbjct: 130 LNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAIL 187

Query: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244
           FQP+LMLIDHGHFQYN VMLG T YAIN+L+DE+YA AA CFVLSICFKQMALYY+PIFF
Sbjct: 188 FQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFF 247

Query: 245 AYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGI 304
           AYLL R +        R   IA AT+ATF V+  PLY +G G +N+ Q ++RIFPF+RGI
Sbjct: 248 AYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGI 307

Query: 305 FEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLI 364
           FEDKVANFWCVTNIFVKYK  FT QQLQLYSL+AT +GFLPA+++ LL+PKKHL+P+ L 
Sbjct: 308 FEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALA 367

Query: 365 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGL 424
           ACSMSFFLFSFQVHEK            Y+ST+W+VLSLVSWINNV LFTLWPLLKKDGL
Sbjct: 368 ACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGL 427

Query: 425 HLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFII 484
            LQY V F   NWLIGNFSF+TP FLPK LTPGPS+SS++S+YRRRSLLP +++WK  I+
Sbjct: 428 ALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIV 487

Query: 485 GTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           G+YI+MG  H+LD+FV PP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   +S++ L
Sbjct: 488 GSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 431/534 (80%), Gaps = 5/534 (0%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RCA+GLGP+SG   PP+ GDFEAQ
Sbjct: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HS + G IG+FFNP+WFALD SRG+E+
Sbjct: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAAAAIL QPSL+LID
Sbjct: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYNSV LGLT YAINNLLDE+YAMAAVCFVLSICFKQM LYY+PIFFAYLLS+SL 
Sbjct: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269

Query: 254 FPK-FNIARLTVIAFATLATFSVILAPLYFLGG--GLRNIHQCIYRIFPFSRGIFEDKVA 310
            PK FNI R   IA AT+ +F ++  PLY  GG  GL N+ Q I+RIFPF+RGIFEDKVA
Sbjct: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329

Query: 311 NFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSF 370
           NFWCVTN+  KYK  FT Q+LQLYSLV TV+GFLPAM++ L +PKK+LLPY L ACSM+F
Sbjct: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389

Query: 371 FLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTV 430
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDGL LQY V
Sbjct: 390 YLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449

Query: 431 SFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490
             LLSNWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509

Query: 491 GVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           G  H+LD FV PP  YPDLWV+LNC +GF CF +FWIW+YYK+F+   KS+  L
Sbjct: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/550 (66%), Positives = 439/550 (79%), Gaps = 11/550 (2%)

Query: 4   GKRLLVNKPAE-----ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPY 58
            K++  N+P E     ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RCA+GLGPY
Sbjct: 33  SKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPY 92

Query: 59  SGKDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFF 118
           SG ++PP+ GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHS L G IG+FF
Sbjct: 93  SGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFF 152

Query: 119 NPSWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSI 178
            P+WF L  SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ I
Sbjct: 153 QPNWFTLGDSRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFI 210

Query: 179 AAAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALY 238
           A AAILFQPSL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AAVCFVLSICFKQMALY
Sbjct: 211 AVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALY 270

Query: 239 YAPIFFAYLLSRSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGG---GLRNIHQCI 294
           Y+PIFFAYLLS+SL  P+ FNI R   I+FAT+ TF+ +  P+YF GG   G+ N+ Q I
Sbjct: 271 YSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSI 330

Query: 295 YRIFPFSRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHP 354
            RIFPF+RGIFEDKVANFWCVTN+  KYK  FT +QLQLYSL+ T+I FLPAM++ LL+P
Sbjct: 331 KRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYP 390

Query: 355 KKHLLPYVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFT 414
           +K+LL Y L ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFT
Sbjct: 391 RKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFT 450

Query: 415 LWPLLKKDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLP 474
           LWPLLKKDGL LQY V  +LSNWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP
Sbjct: 451 LWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLP 510

Query: 475 YNVVWKSFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIF 534
            N +WK  I+ +Y+ MGV H +D F+ PPS YPDLWV+LNC +GF CF +FW+W+YYK+F
Sbjct: 511 SNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLF 570

Query: 535 TSGNKSVKDL 544
           +   K++  L
Sbjct: 571 SMTKKNIHQL 580

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/530 (67%), Positives = 432/530 (81%), Gaps = 3/530 (0%)

Query: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQR 74
           E+F+ASPMYDFL PFRPVGNQW  +Y+I + A+I+RCA+GLG YSG ++PP+ GDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESP 134
           HWMEITQHLP+ +WYWYDLQYWGLDYPPLTA+HS L G +G+FF   WF L+ SRG+ES 
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194
           +  LK+YMR TVIIS++L Y PAVIYFTKW+G+YR+QSPIGQ IAAAAILFQP+L+L+DH
Sbjct: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217

Query: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254
           GHFQYN VMLG+T Y +NNLLD +YAM A+CFVLS+CFKQMALYY+PIFFAYLLS+S   
Sbjct: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277

Query: 255 PKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFWC 314
           P  N+ RL  I+ +T   F     P+Y  GG  +N+ Q ++RIFPF+RGIFEDKVANFWC
Sbjct: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRIFPFARGIFEDKVANFWC 336

Query: 315 VTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLFS 374
           V+NIF+KY++ FT + LQLYSL+ATVIG LP+ I+T L+PK+HLLPY L ACSMSFFLFS
Sbjct: 337 VSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFS 396

Query: 375 FQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFLL 434
           FQVHEK            Y+S DWNVLSLV WINNVALFTLWPLLKKD L LQY V F+ 
Sbjct: 397 FQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMF 456

Query: 435 SNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVYH 494
           SNWLIGNFSF+TPRFLPK LTPGPSIS I+ DYRR SLLP +++W+  I+G+YIAMG+ H
Sbjct: 457 SNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIH 516

Query: 495 LLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
            LD +V PPSKYPDLWVL NC++GF+CF  FWIW+ YK+F   N +++DL
Sbjct: 517 FLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/543 (66%), Positives = 438/543 (80%), Gaps = 3/543 (0%)

Query: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60

Query: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120
            + PP+HGDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HS + G +G  F+P
Sbjct: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120

Query: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178

Query: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240
           AAILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238

Query: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300
           PIFF+YLLS+SL  P FN+ RL  +A ATL +F+ +  PLY + GG+RN+ Q I+RIFPF
Sbjct: 239 PIFFSYLLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297

Query: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360
           SRGIFEDKVANFWC +NIF+KYK  +T  QLQ+YSL AT +GFLPA I+   +PKKHL+P
Sbjct: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357

Query: 361 YVLIACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLK 420
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 358 YALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLK 417

Query: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480
           KDGL LQY    LLSNWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477

Query: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540
             I+ +YI+MG+ HLLD +V PP+KYPDLWVLLNC++GF  F +FW+W+YYK+FT  NK+
Sbjct: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537

Query: 541 VKD 543
           + D
Sbjct: 538 LYD 540

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/533 (66%), Positives = 431/533 (80%), Gaps = 4/533 (0%)

Query: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEA 72
            EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++ AIGLG YSG  +PP+ GDFEA
Sbjct: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93

Query: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFE 132
           QRHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HS L G IGTF  P WF LD SRG E
Sbjct: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153

Query: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLI 192
           +  +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AAAAILFQP+LMLI
Sbjct: 154 T--DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLI 211

Query: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252
           DHGHFQYN VMLGLT YAINNLLD +YAMAAVCFVLSICFKQMALYYAPIFFA LLS+SL
Sbjct: 212 DHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSL 271

Query: 253 LFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVAN 311
            FP+ FNI R   +AFATLA+  V+ APLY  GG + N+ Q I+RIFPF+RGIFEDKVAN
Sbjct: 272 FFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVAN 330

Query: 312 FWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFF 371
           FWCVTN+F KYK  FT  +LQ YSLVATV+GF PA ++ + +PKK L+PY L ACSM+FF
Sbjct: 331 FWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFF 390

Query: 372 LFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVS 431
           LFSFQVHEK            ++ST+WN LS+V W+NNVALFTLWPLLKKDGL LQY V 
Sbjct: 391 LFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVC 450

Query: 432 FLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMG 491
            ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M 
Sbjct: 451 LVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCML 510

Query: 492 VYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           + H+L+  +  PS+YPDLWV LNC VGF CF +FW+W+YYK+ T  NK++++L
Sbjct: 511 MIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/531 (67%), Positives = 427/531 (80%), Gaps = 3/531 (0%)

Query: 15  ESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQR 74
           E FYASP+Y FL PF+   NQWL  YII + A+I+RCAIGLGPYSG +  P+ GDFEAQR
Sbjct: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90

Query: 75  HWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFESP 134
           HWMEITQHLP+S+WY+YDLQYWGLDYPPLTA+HS + GLIG FFNP+WF L+ SRG E  
Sbjct: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150

Query: 135 DNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLIDH 194
           +  LKT+MR T I+S+++FY PA+IYFT W+G+ R QSP+GQ IAAAAILFQP LMLIDH
Sbjct: 151 E--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDH 208

Query: 195 GHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLLF 254
           GHFQYNSVMLGLT YAINNLLD+ YA AA+ FV+SICFKQM+LYYAPIFFAYLL RSL  
Sbjct: 209 GHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFK 268

Query: 255 PKF-NIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313
            +F N++R   IA AT+ +F  + APLY  GGG RNI Q ++RIFPF+RGIFEDKVANFW
Sbjct: 269 KQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFW 328

Query: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373
           CVTN+ +KYK  +T  +LQLYSL+ TV+GFLPAM+  L  PKKHLLPY L AC+MSFFLF
Sbjct: 329 CVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLF 388

Query: 374 SFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433
           SFQVHEK            Y+STDWNVLSLVSWINNVALFTLWPLLKKDG+ LQY V F+
Sbjct: 389 SFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFI 448

Query: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493
           LSNWLIGNFSF TPRFLPK LTPGP I ++N+ YRRRSLLP N++WK  I+ +YI M   
Sbjct: 449 LSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAI 508

Query: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
             L+LFV PP +YPD++VLLNC +GF CF+ FW+W+YYK+FT  +K+++ L
Sbjct: 509 QGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/531 (65%), Positives = 423/531 (79%), Gaps = 3/531 (0%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG+ + P+HGDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HS   G +G+  NP WFAL  SRG E+
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAILFQPSL+LID
Sbjct: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSL 
Sbjct: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246

Query: 254 FPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313
            P F  +R   +A +T+ TF ++ +PLY  GG ++N+ Q I+RIFPFSRGIFEDKVANFW
Sbjct: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305

Query: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373
           CV+N+ VKY D FT  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365

Query: 374 SFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD L LQY +  L
Sbjct: 366 GFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425

Query: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493
           LSNWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M V 
Sbjct: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485

Query: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           H+LDLFV PP+K PDLWVL+NCA+GFTCFS+FW+W+ YK+FT  NKS+ DL
Sbjct: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/540 (63%), Positives = 422/540 (78%), Gaps = 7/540 (1%)

Query: 4   GKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDS 63
           GK++  N+P    F+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG++S
Sbjct: 3   GKKVSKNEP----FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENS 58

Query: 64  PPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWF 123
            P+HGDFEAQRHWME+T HLPLS+WYWYDLQYWGLDYPPLTA+HS + G +G+  N  WF
Sbjct: 59  GPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWF 118

Query: 124 ALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAI 183
           AL  SRG E+PD  +K YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAI
Sbjct: 119 ALLSSRGIENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAI 176

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           LFQPSL+LIDHGHFQYNSVMLGLT Y+INNLLD YY  AA+CFVLS+CFKQMALYY+P+F
Sbjct: 177 LFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVF 236

Query: 244 FAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRG 303
           FAYLLS  L+ P  N+ R   +AF+T+ +F +I +PLY  GG  +N+ Q I+RIFPFSRG
Sbjct: 237 FAYLLSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRG 295

Query: 304 IFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVL 363
           IFEDKVANFWCV+N+  KY   +T Q+LQ +S++AT  GFLP+ ++ L +PKKH++P+ L
Sbjct: 296 IFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFAL 355

Query: 364 IACSMSFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423
            ACSM+FFLFSFQVHEK            Y STDWNVLS+VSWINNVALFTLWPLLKKD 
Sbjct: 356 AACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDH 415

Query: 424 LHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483
           L LQY +  LLSNWLIGNFSF+TPRFLPK +TPGPSIS ++  YRRRS LP N  WK  I
Sbjct: 416 LTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLII 475

Query: 484 IGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKD 543
           + +Y+ M   H+LD FV  P   PDLWVLLNCA+GF CF+IFW+W +YK+FT  N +++D
Sbjct: 476 VASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/531 (64%), Positives = 416/531 (78%), Gaps = 3/531 (0%)

Query: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73
           EESF+ASP+YDFLYP RPV NQW  +YII + A+IVR A+GLG YSGK   PL GDFEAQ
Sbjct: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQ 81

Query: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133
           RHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HS + G +G+F N +WF L+ SRGFES
Sbjct: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141

Query: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193
            D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A AAILFQPSL+LID
Sbjct: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199

Query: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253
           HGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS  
Sbjct: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259

Query: 254 FPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313
           +P+FN  R   IA ATL TF  + APL  L G  RNI Q +YR+FPFSRGIFEDKVANFW
Sbjct: 260 YPRFNFPRFAGIAIATLLTFGALYAPLC-LFGDFRNIIQSVYRVFPFSRGIFEDKVANFW 318

Query: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373
           CVTN+ +KY++ +T +QLQ Y L+ T I   PA I+  L+PKK LLPY L ACSM+FFLF
Sbjct: 319 CVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFLF 378

Query: 374 SFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433
           SFQVHEK            + ST+W+VLS+V+WINNVALFTLWPLLKKDGL LQY + FL
Sbjct: 379 SFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMFL 438

Query: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493
           LSNWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M   
Sbjct: 439 LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI 498

Query: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
           HLLDL+V PP  YPD+WVL  CA+GF CF+ FW+W+YY+++   N S+ +L
Sbjct: 499 HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/536 (62%), Positives = 417/536 (77%), Gaps = 4/536 (0%)

Query: 10  NKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHG 68
            KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R A+GLG YSG   PP+ G
Sbjct: 31  KKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFG 90

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HS L G +G++ +P WF+L  S
Sbjct: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150

Query: 129 RGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPS 188
           RG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA AAILFQP+
Sbjct: 151 RGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208

Query: 189 LMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLL 248
           L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AAV FV S+ FKQMALYYAP+ F YLL
Sbjct: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268

Query: 249 SRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDK 308
           SRS+ +P+ NI R   +A ATL  F V+ APLY LG  +  I Q I+R+FPF RG+FEDK
Sbjct: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFEDK 327

Query: 309 VANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368
           VANFWCVTN+ VKYK ++T  QL+ +SLV T    LP++I+T L+PKK +LPY L ACSM
Sbjct: 328 VANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSM 387

Query: 369 SFFLFSFQVHEKXXXXXXXXXXXXYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428
           SFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLKKDGL LQY
Sbjct: 388 SFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQY 447

Query: 429 TVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488
            + FLLSNWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N++W+  I+ +YI
Sbjct: 448 AIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYI 507

Query: 489 AMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544
            +G  H+ +L+  P  + PD+WVL NC VG + F++FW+W+ YK+F   N ++ DL
Sbjct: 508 CVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 125/264 (47%), Gaps = 31/264 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT +LP+SKWY+ +   W LDYPP  A+    F  + + F P     D  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAY----FEWVLSRFAPEIVKNDGC 119

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    GL T  + R TVIIS+IL +     Y      + R Q      + A++I+ 
Sbjct: 120 LDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVL 175

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I     + Y   AV + +S+CFK + LY AP +F 
Sbjct: 176 SPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFV 235

Query: 246 YLLSRSLL-FPKFNI------------ARLTVIAFATLATFSVILAPLYFLGGGLRNIHQ 292
           +LL   +L F  F               RL  +A      F++  AP  F       + Q
Sbjct: 236 FLLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPFIF------QLPQ 289

Query: 293 CIYRIFPFSRGIFEDKVA-NFWCV 315
            + R+FPFSRG+     A NFW +
Sbjct: 290 VLSRLFPFSRGLTHAYWAPNFWAM 313

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 165/359 (45%), Gaps = 55/359 (15%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY+ +   W LDYPP  A+    F    + F P +   D  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAY----FEWFLSQFVPKFVKEDGC 98

Query: 129 RG-FESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
                  + G  T  + R TVIIS+IL +    ++        + QS     + A++I+ 
Sbjct: 99  LDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIIL 154

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  + G+   +I    ++ Y +  + + +++CFK + LY AP +F 
Sbjct: 155 SPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFV 214

Query: 246 YLLSRSLL-FPKFNIAR----LTVIAFATLATFSVILAPLYFLGGG--LRNIHQCIYRIF 298
           +LL   +L F  F        + V+ +  L     I+  +  +  G   R+++Q + R+F
Sbjct: 215 FLLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLF 274

Query: 299 PFSRGI--------------FEDKVANFWCVTNIFVKYKDRFTIQQLQLYS-----LVAT 339
           PFSRG+              F DK+ +   V   F K+ +   I++ + ++     LV  
Sbjct: 275 PFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVED 334

Query: 340 V-IGFLPAM------IMTLLHPKKHLLPYV-----------LIACSMSFFLFSFQVHEK 380
           V    LP +      ++TL +    ++P +           L  C  + FLF + VHEK
Sbjct: 335 VFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEK 393

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/317 (28%), Positives = 151/317 (47%), Gaps = 35/317 (11%)

Query: 44  VCAVIVRCAIGLGPYSGKDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPL 103
           +CA +++  +  G YS         DF+  R+W+ IT  LPL+KWY      W LDYPP 
Sbjct: 35  ICATVLKVLLFPGYYST--------DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPF 86

Query: 104 TAFHSCLFGLIGTFFNPSWFALDKSRGFESPDN-GLKT--YMRSTVIISDILFYFPAVIY 160
            A+    F    + F P   A D         + GL T  + R TVI+S+++ Y      
Sbjct: 87  FAY----FEWFLSQFVPKSVAEDGCLDIVKVGSFGLPTIIFQRITVILSELVLYAA---- 138

Query: 161 FTKWLGRYRNQSPIGQS----IAAAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLD 216
               L  + N S I +     + A++I+  P L+++DH HFQYN  + G+   +I    +
Sbjct: 139 ----LQVFINTSDISEKSANFVVASSIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKN 194

Query: 217 EYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL-FPKFNIAR----LTVIAFATLA 271
           + Y + A  F +++CFK + LY AP +F +LL   +L F  F        ++++ ++ L 
Sbjct: 195 KRYILCAAFFSIALCFKHIFLYLAPAYFVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLL 254

Query: 272 TFSVILAPLYFLG--GGLRNIHQCIYRIFPFSRGIFEDKVA-NFWCVTNIFVKYKDRFTI 328
             + ++  ++ L     +    Q + R+FPFSRG+     A N W V +   K      +
Sbjct: 255 KLASVVMGIFSLAFLPFITTWQQLLARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVL 314

Query: 329 QQLQLYSLVATVIGFLP 345
           +   L  +++ V+  +P
Sbjct: 315 KLPYLQKILSIVLTSMP 331

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL KWY+     W LDYPP  A+   L       F P     D  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQ----FVPQRVQDDGC 99

Query: 129 RGFESPDN-GLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               +    GL T  + R TVI+S+IL +    +Y  K      ++S     + A++I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINK--SHISDRS--ANFVVASSIVL 155

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I     + Y +    F  ++CFK + LY AP FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 246 YLLSRSLL-FPKFNI------------ARLTVIAFATLATFSVILAPLYFLGGGLRNIHQ 292
           +LL   +L F  F                L  +    L+ F+V  AP  +       + Q
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPFIY------QLPQ 269

Query: 293 CIYRIFPFSRGIFEDKVA-NFWCV 315
            + R+FPFSRG+     A NFW +
Sbjct: 270 LMSRLFPFSRGLTHAYWAPNFWAL 293

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  110 bits (274), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+WM IT  LP+SKWY+ +   W LDYPP  A+    F    + F P     D  
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAY----FEWFLSQFVPKIVRDDGC 164

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    G  T  + R TVIIS+I  +     Y        R QS     + A++I+ 
Sbjct: 165 LDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVL 220

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  +++DH HFQYN+ +  +   +I     + Y   AV + +++CFK + LY AP +F 
Sbjct: 221 SPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFV 280

Query: 246 YLLSRSLL-FPKFNIA------------RLTVIAFATLATFSVILAPLYFLGGGLRNIHQ 292
           +LL   +L F  F               RL  +    L  F +  AP  F       + Q
Sbjct: 281 FLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIF------QMPQ 334

Query: 293 CIYRIFPFSRGIFEDKVA-NFWCV 315
            + R+FPFSRG+     A NFW +
Sbjct: 335 VLSRLFPFSRGLTHAYWAPNFWAI 358

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 122/265 (46%), Gaps = 33/265 (12%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+    F    + F PS+   D  
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAY----FEWFLSQFVPSYVKSDGC 91

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    G+ T  + R TVI S+IL +    +Y        R QS     + A++I  
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I    ++ Y      + +++CFK + LY AP +F 
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 246 YLLS--------------RSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIH 291
           +LL               R L+F       L  +    +ATF+V   P  F      ++ 
Sbjct: 208 FLLRAYVLNLKDFKFKSYRDLIF-IVKWRHLVKLGSVVIATFAVAFGPFIF------DLP 260

Query: 292 QCIYRIFPFSRGIFEDKVA-NFWCV 315
           Q + R+FPFSRG+     A NFW +
Sbjct: 261 QLLTRLFPFSRGLTHAYWAPNFWAI 285

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 123/264 (46%), Gaps = 31/264 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+    F    + F P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAY----FEWFLSQFVPKSVRDDGC 121

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    GL T  + R TVI S+IL +    IY        R+QS     + A++I+ 
Sbjct: 122 LDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVL 177

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I    ++ Y + AV +  +ICFK + LY AP +F 
Sbjct: 178 SPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFV 237

Query: 246 YLLSRSLL------FPKFNI-------ARLTVIAFATLATFSVILAPLYFLGGGLRNIHQ 292
           +LL   +L      F  +         A L  +A   +  F++   P          + Q
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF------AHQMPQ 291

Query: 293 CIYRIFPFSRGIFEDKVA-NFWCV 315
            + R+FPFSRG+     A NFW +
Sbjct: 292 VLSRLFPFSRGLTHAYWAPNFWAL 315

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 122/263 (46%), Gaps = 29/263 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LP+SKWY+     W LDYPP  A+    F    + F P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAY----FEWFLSQFVPKVVRDDGC 121

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    GL T  + R TVI SDIL +    +Y        R+QS     + A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVL 177

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P   +IDH HFQYN  +  +   +I     + Y + A+ +  +ICFK + LY AP +F 
Sbjct: 178 SPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFV 237

Query: 246 YLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIH------------QC 293
           +LL   +L    N+      ++     F +  A L+ LG  +  I             Q 
Sbjct: 238 FLLRAYVL----NVNNFKFKSYKDF-LFLIRWANLFKLGSIVIGIFTICFLPFAHQMPQV 292

Query: 294 IYRIFPFSRGIFEDKVA-NFWCV 315
           + R+FPFSRG+     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  107 bits (266), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 124/273 (45%), Gaps = 31/273 (11%)

Query: 66  LHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTA-FHSCLFGLIGTFFNPSWFA 124
           L  DF+  R+W+ IT  LPL +WY+ +   W LDYPP  A F   L  L+          
Sbjct: 41  LSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDG-C 99

Query: 125 LD--KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAA 182
           LD  K   F  P      + R TVI S+IL +    +Y  K     R+       + A++
Sbjct: 100 LDIVKVGQFGMPT---IVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASS 152

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I+  P  ++IDH HFQYN  +  +   +I    ++ Y +  + F ++ICFK + LY AP 
Sbjct: 153 IVLSPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPS 212

Query: 243 FFAYLLSRSLL-FPKFNIA------------RLTVIAFATLATFSVILAPLYFLGGGLRN 289
           FF +LL   +L F  F+               L  +    L  F V  AP       +  
Sbjct: 213 FFVFLLRVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF------ISQ 266

Query: 290 IHQCIYRIFPFSRGIFEDKVA-NFWCVTNIFVK 321
             Q + R+FPFSRG+     A NFW + ++  K
Sbjct: 267 WPQLLSRLFPFSRGLTHAYWAPNFWAMYSLLDK 299

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 123/263 (46%), Gaps = 29/263 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+    F    + F P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAY----FEWFLSQFVPKVVRDDGC 121

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    GL T  + R TVI S+IL Y    IY        R+QS     + A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVL 177

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I    ++ Y + A  +  +ICFK + LY AP +F 
Sbjct: 178 SPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFV 237

Query: 246 YLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIH------------QC 293
           +LL   +L    N+      ++     F +  A L+ LG  +  I             Q 
Sbjct: 238 FLLRAYVL----NVNNFKFKSYKDF-LFLIRWANLFKLGSIVIGIFTICFVPFAHQMPQV 292

Query: 294 IYRIFPFSRGIFEDKVA-NFWCV 315
           + R+FPFSRG+     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 128/266 (48%), Gaps = 23/266 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT +LPL +WY+     W LDYPP  A+    F    + F P    + + 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAY----FEWFLSQFVPG--TVKQD 98

Query: 129 RGFESPDNG-----LKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAI 183
              E  D G        + RSTVI+S+IL +    ++        R QS     + A++I
Sbjct: 99  GCLEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSI 154

Query: 184 LFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIF 243
           +  P+ +++DH HFQYN  +  +   +I       Y   A  + +++CFK + LY AP +
Sbjct: 155 VLSPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCY 214

Query: 244 FAYLLSRSLL-FPKFNIAR----LTVIAFATLATFSVILAPLYFLGGG--LRNIHQCIYR 296
           F +LL    L F  F        + ++ +  L     I+  ++ L  G  ++++ Q + R
Sbjct: 215 FVFLLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTR 274

Query: 297 IFPFSRGIFEDKVA-NFWCVTNIFVK 321
           +FPFSRG+     A NFW + +   K
Sbjct: 275 LFPFSRGLTHAYWAPNFWALYSFLDK 300

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  105 bits (261), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 125/259 (48%), Gaps = 21/259 (8%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A+    F    + F P     D  
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAY----FEWFLSQFVPKVVRDDGC 121

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    GL T  + R TVI S+IL +    IY        R+QS     + A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVL 177

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I    ++ Y   AV +  SICFK + LY AP +F 
Sbjct: 178 SPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFV 237

Query: 246 YLLSRSLLFP---KFNIAR--LTVIAFATLATFSVILAPLY---FLGGGLRNIHQCIYRI 297
           +LL   +L     KF   +  L +I +  L     I+  ++   FL      + Q + R+
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPFA-HQMPQVLSRL 296

Query: 298 FPFSRGIFEDKVA-NFWCV 315
           FPFSRG+     A NFW +
Sbjct: 297 FPFSRGLTHAYWAPNFWAL 315

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 138/293 (47%), Gaps = 21/293 (7%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  + L  WY+     W LDYPP  A+    F    +   PS+   D  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAY----FEWFISHLVPSFVRRDGC 119

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    G  T  + R TVI S+ L +    IY        R QS     I A++I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  +++DH HFQYN  +  +   +I    ++ Y + A+ + +++CFK + LY AP +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 246 YLLSRSLL-FPKFNIAR----LTVIAFATLATFSVILAPLYFLGGG--LRNIHQCIYRIF 298
           +LL   +L F  F        + +I +  L    +I+  ++ L  G  + ++ Q + R+F
Sbjct: 236 FLLRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRLF 295

Query: 299 PFSRGIFEDKVA-NFWCVTNIFVKYKDRFTIQQLQLYSLVATVIG--FLPAMI 348
           PFSRG+     A NFW + +   K    F ++   +++  A  I    LP+ I
Sbjct: 296 PFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSI 348

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 120/270 (44%), Gaps = 31/270 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY      W LDYPP  A+    F    + F P     D  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAY----FEWFLSQFVPKIVRDDGC 103

Query: 129 RGFESPDN-GLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
                  N G+ T  + R TVI+S++L +    I+  K     ++       I A++I+ 
Sbjct: 104 LDIVEVGNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSIVL 159

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  +++DH HFQYN  +  +   AI       Y +    F  ++CFK + LY AP FF 
Sbjct: 160 SPGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFV 219

Query: 246 YLLSRSLL-FPKFNIA------------RLTVIAFATLATFSVILAPLYFLGGGLRNIHQ 292
           +LL   +L F  F               R   +    L  F+V  AP       +  + Q
Sbjct: 220 FLLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF------ISEMPQ 273

Query: 293 CIYRIFPFSRGIFEDKVA-NFWCVTNIFVK 321
            + R+FPFSRG+     A NFW + ++  K
Sbjct: 274 LLERLFPFSRGLTHAYWAPNFWALYSLLDK 303

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 134/300 (44%), Gaps = 35/300 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ +T  LPL +WY+     W LDYPP  A+    F  I + F P     D  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAY----FEWIISQFVPQVVRDDGC 111

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQS-IAAAAIL 184
               E    G  T  + R +VI S+IL +        +W     N     QS I A +I+
Sbjct: 112 LDIVEIGKFGEPTVIFQRLSVITSEILLFV-----VLQWFINTSNVKERTQSFIVATSII 166

Query: 185 FQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFF 244
             P  +++DH HFQYN  +  +   +I     + Y + AV +  ++CFK + LY AP +F
Sbjct: 167 LSPGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYF 226

Query: 245 AYLLSRSLLFPK-------FNIARLTV------IAFATLATFSVILAPLYFLGGGLRNIH 291
            +LL   +L  K        ++ RL        +A   L+   V   P  F      ++ 
Sbjct: 227 VFLLRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPFIF------DMP 280

Query: 292 QCIYRIFPFSRGIFEDKVA-NFWCVTNIFVKYKDRFTIQQLQLYSLVATVIG--FLPAMI 348
           Q + R+FPFSRG+     A NFW + +   K      ++   +++L    I   F PA I
Sbjct: 281 QLLTRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATI 340

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 123/258 (47%), Gaps = 19/258 (7%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+   L       F P     D +
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQ----FVPKIVKEDGA 110

Query: 129 RGF-ESPDNGLKT--YMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
               E    G  T  + R TVI S++L +    ++        + +S     + A++I+ 
Sbjct: 111 LDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVL 166

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +      +I     + Y   A  + +++CFK + LY AP +F 
Sbjct: 167 SPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFV 226

Query: 246 YLLSRSLL-FPKFNIAR----LTVIAFATLATFSVILAPLYFLGGG--LRNIHQCIYRIF 298
           +LL   +L F  F        + ++ +  L   + ++  ++F+  G  L ++ Q + R+F
Sbjct: 227 FLLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTRLF 286

Query: 299 PFSRGIFEDKVA-NFWCV 315
           PFSRG+     A NFW +
Sbjct: 287 PFSRGLTHAYWAPNFWAI 304

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 131/301 (43%), Gaps = 37/301 (12%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLI--GTFFNPSWFALD 126
           DFE  R+W+ +T  LPL KWY      W +DYPPL A+       +  G         L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 127 KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQ 186
               +  P      + R TVI S++L Y    +Y +    + R  +     +   ++   
Sbjct: 119 AEGRYGWPT---VVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALS 171

Query: 187 PSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAY 246
           P+ +L+DH HFQYN  +  +   +I    +  Y +    F +++C K + LY AP +F +
Sbjct: 172 PAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVF 231

Query: 247 LLS--------------RSLLFPKF--NIARLTVIAFATLATFSVILAPLYFLGGGLRNI 290
           LL               R L+F     N+ RL  +  A +A   V  AP  F G     +
Sbjct: 232 LLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMA---VTFAP--FAG----VM 282

Query: 291 HQCIYRIFPFSRGIFEDKVA-NFWCVTNIFVKYKDRFTIQQLQLYSLVATVIG--FLPAM 347
            Q + R+FPFSRG+     A NFW + +   K      ++   +Y L  +++    +PA 
Sbjct: 283 PQLMARLFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLVQPPLIPAS 342

Query: 348 I 348
           I
Sbjct: 343 I 343

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 117/263 (44%), Gaps = 29/263 (11%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+    F    + F P     D  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAY----FEWFMSQFVPKVVRDDGC 109

Query: 129 RGFESPDN---GLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILF 185
                          + R++VIIS+IL +     +  K     R QS     I A +I+ 
Sbjct: 110 LDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIIL 165

Query: 186 QPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFA 245
            P  ++IDH HFQYN  +  +   +I     E Y +  + + +++CFK + LY AP +F 
Sbjct: 166 SPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFV 225

Query: 246 YLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIH------------QC 293
           +LL   +L    N+      ++  L    +    L+ LGG + +I             Q 
Sbjct: 226 FLLRAYVL----NVKNFKFKSYKDLILL-IQWNNLFKLGGIVLSIFGICFLPFIYHLPQV 280

Query: 294 IYRIFPFSRGIFEDKVA-NFWCV 315
             R+FPF RG+     A NFW +
Sbjct: 281 FTRLFPFGRGLTHAYWAPNFWAI 303

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 117/270 (43%), Gaps = 43/270 (15%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALD-- 126
           D E  R+W+ +T  LPL  WY      W LDYPP  A+    F  + + F P+    D  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAY----FEWVLSQFVPAVVRDDGC 148

Query: 127 ----KSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAA 182
               K   F  P      ++R TVI ++IL +    +    ++            I A++
Sbjct: 149 LDIVKEGKFGWPT---VVFLRLTVIGTEILLF----VVLQVFINTSDESERTVNFIIASS 201

Query: 183 ILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPI 242
           I   P  +++DH HFQYN  +  +   +I     E Y +    F   +CFK + LY AP 
Sbjct: 202 IALSPGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPA 261

Query: 243 FFAYLLS--------------RSLLFPK--FNIARLTVIAFATLATFSVILAPLYFLGGG 286
           +F +LL               R L+F    FN+ +L VI  + LA   V   P+      
Sbjct: 262 YFTFLLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV------ 315

Query: 287 LRNIHQCIYRIFPFSRGIFEDKVA-NFWCV 315
              + Q I R+FPFSRG+     A NFW V
Sbjct: 316 ---LPQLISRLFPFSRGLTHAYWAPNFWAV 342

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 97.8 bits (242), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 124/273 (45%), Gaps = 43/273 (15%)

Query: 69  DFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKS 128
           DF+  R+W+ IT  LPL +WY+     W LDYPP  A+    F  + + F P+  A+   
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAY----FEWVLSQFVPA--AVRAD 106

Query: 129 RGFESPDNGL-----KTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQS----IA 179
              +    G+       + R TVI S++L +    +Y         N SP  +     + 
Sbjct: 107 GCLDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYI--------NTSPPAEKTQSFVV 158

Query: 180 AAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239
           A++I+  P L+++DH HFQYN  +  +   +I       + + A  +  ++CFK + LY 
Sbjct: 159 ASSIVLSPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYL 218

Query: 240 APIFFAYLL-------------SRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGG 286
           AP +F +LL             S   LF   +  RL  +    L    V  AP       
Sbjct: 219 APCYFMFLLRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF------ 272

Query: 287 LRNIHQCIYRIFPFSRGIFEDKVA-NFWCVTNI 318
            R++ Q + R+FPFSRG+     A NFW + ++
Sbjct: 273 ARDMPQLLSRLFPFSRGLTHAYWAPNFWALYSL 305

>ZYRO0D01914g Chr4 complement(154320..155147) [828 bp, 275 aa] {ON}
           similar to uniprot|P47153 Saccharomyces cerevisiae
           YJR116W Hypothetical ORF
          Length = 275

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 110 LFGLIGTFFNPSWFALDKSRGFESPD--------NGLKTYMRSTVIISDILFYFPAVIYF 161
           LF     F N +WF    SRG   P         NGL   + +   I  IL+ F A++  
Sbjct: 163 LFEASTPFVNNNWFITQLSRGASKPPVPFWFNVLNGL--LLMAVFFIVRILWGFAAIVLL 220

Query: 162 TKWLGRYRNQSPIGQS 177
            + + + R+Q PI Q+
Sbjct: 221 VQQMWKVRDQLPIFQT 236

>TDEL0E01430 Chr5 complement(286064..287428) [1365 bp, 454 aa] {ON}
           Anc_4.229 YDL054C
          Length = 454

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 303 GIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYV 362
           G  E  VAN   ++N+      + + Q L +Y+L +T    L  ++  +L  KK    ++
Sbjct: 264 GPLEMFVANMGSLSNLISNDSAQLSNQMLSIYALSSTAARILTGLLTDVLSAKKISAKWI 323

Query: 363 LIA 365
           LIA
Sbjct: 324 LIA 326

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,816,493
Number of extensions: 2482803
Number of successful extensions: 6464
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6495
Number of HSP's successfully gapped: 48
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)