Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1626.25ON73473435710.0
Smik_15.1706.25ON77373428120.0
Suva_15.1766.25ON74573527960.0
YOR001W (RRP6)6.25ON73373427950.0
KAFR0G026606.25ON73573118770.0
NCAS0H008606.25ON75576418590.0
SAKL0E01452g6.25ON73774118190.0
KNAG0M012306.25ON73874518060.0
Kpol_1037.296.25ON74674817850.0
TPHA0J003706.25ON74375117290.0
CAGL0E02585g6.25ON73774417220.0
NDAI0D008506.25ON79077317200.0
TDEL0G044406.25ON73570317020.0
ZYRO0C07678g6.25ON74175517030.0
KLLA0D01309g6.25ON74475016890.0
TBLA0A071706.25ON77174716900.0
ACL001C6.25ON74575116530.0
Ecym_30306.25ON74775216180.0
Kwal_56.224476.25ON73550315580.0
KLTH0C11066g6.25ON73550714940.0
KLTH0D11616g8.691ON302120780.68
TPHA0H021906.311ON223471771.6
KAFR0G004208.860ON37473715.2
YNL119W (NCS2)2.154ON493105708.2
AER284W8.821ON1501123708.8
SAKL0E10472g2.172ON60878709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.162
         (734 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...  1380   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...  1087   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...  1081   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...  1081   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   727   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   720   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   705   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   700   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   692   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   670   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   667   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   667   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   660   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   660   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   655   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   655   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   641   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   627   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   604   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   580   0.0  
KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {O...    35   0.68 
TPHA0H02190 Chr8 complement(515628..522332) [6705 bp, 2234 aa] {...    34   1.6  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     32   5.2  
YNL119W Chr14 (401040..402521) [1482 bp, 493 aa] {ON}  NCS2Prote...    32   8.2  
AER284W Chr5 (1157531..1162036) [4506 bp, 1501 aa] {ON} Syntenic...    32   8.8  
SAKL0E10472g Chr5 (873925..875751) [1827 bp, 608 aa] {ON} highly...    32   9.9  

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score = 1380 bits (3571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/734 (92%), Positives = 680/734 (92%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
           KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKP            NNPSHYL
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
           IGVVSLTNGVTEHVRQNAKVLANLIENALGNI                PDGISLEVITIS
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600
           QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI
Sbjct: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600

Query: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLXX 660
           KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVL  
Sbjct: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLKK 660

Query: 661 XXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGXXXXXX 720
                       DMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEG      
Sbjct: 661 KKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKK 720

Query: 721 XXXXXXGKNMSFKR 734
                 GKNMSFKR
Sbjct: 721 KRPAPRGKNMSFKR 734

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/734 (73%), Positives = 592/734 (80%), Gaps = 1/734 (0%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M S+NPDVL SK+V V+RAASSLA QDVDFYKNL+REF  VLKSKSDKL DM NEIILSI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DEHHESFELK+++ISGLW DFGNIMDNLLEMSDHSLDKLN    SK +GA+LQYLGDFS 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
           K+    KR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKP            N PSHY 
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEIDHQEY S++LQI+KEIPSKSW+DSEPIWIDT  KL  MLE+LKN  EIAVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STRE+DYLVDT+ELR+ LHILNEVFTDP IVKVFHGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPM A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RPR PSSEVYSPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KE PWRVLMYQYNITSEKEELVKDLY WRD IARRDDESPRFVMPNQLLAALVAY PIDV
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
           IGV+SLTNG+TEHVRQNAKVL NLI+N+L +I                 + +SLE ITI 
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580

Query: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600
           QIRDIMERFS+LSNS V N R K G +T SILLG+ LP EE  I+Y   G PN+VK EDI
Sbjct: 581 QIRDIMERFSVLSNSNVSNCRAKNG-ATPSILLGRILPLEENDIAYKNNGLPNRVKFEDI 639

Query: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLXX 660
           +ARAQ FNSAL+ LE+ M E+EKP  +P +V+K E +  E  P+  +  E+ DDI+VL  
Sbjct: 640 RARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATIENPDDIVVLKK 699

Query: 661 XXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGXXXXXX 720
                       D   ++A+DYSK+P+VLSSK  QNR+QQ+KRR DP  NDS+G      
Sbjct: 700 KNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSDGPRAAKK 759

Query: 721 XXXXXXGKNMSFKR 734
                 G+N+SFKR
Sbjct: 760 KRPATRGRNVSFKR 773

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/735 (73%), Positives = 599/735 (81%), Gaps = 9/735 (1%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M SEN DVL SK+V V+RAASSLA+QDVDFY+NL+R+FS +L+SKS KLT+MVN I+LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DEHH+S ELKE+EIS LWKDFGNIMDNLLE SDHSLD LN T+NS  S A+LQYLGDFSG
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
           KDS  TKR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKP            N+P HY 
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEIDHQEY+ ++LQIK EIPSK WD SEPIWI++K  L  MLEDLKNA EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYG+VCLMQVSTRERDYLVDT+ELR+ LHILNEVFT+P IVKVFHGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPMTA
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RP TPSS+VYSP E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KENPWRVLMYQYNI  E+EELVKDLY WRD IARRDDESPRF+MPNQLLAALVAY PIDV
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
           IGVVSL+NGVT+HVRQNAK+LANLI++AL ++                    SLE IT+S
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFK--SASLEAITVS 556

Query: 541 QIRDIMERFSLLSNSGVINNRTKTGDST-SSILLGKTLPFEECGISYGKKGTPNKVKVED 599
           QIRDIM+RFS+ S++ V  +R+   DST SSIL GK LP+EE  I Y   G P+KVKVED
Sbjct: 557 QIRDIMDRFSVFSSNSVTEDRSM--DSTASSILFGKILPYEEGDIVYEDSGLPHKVKVED 614

Query: 600 IKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLX 659
           ++ RAQ+FNSAL GLE+I FE+EKPV    +VEK E V+IE+ PE P+K E  D+++VL 
Sbjct: 615 MRDRAQRFNSALVGLEDIKFEVEKPV----NVEKSEMVKIETTPEPPTKIEDPDEVVVLK 670

Query: 660 XXXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGXXXXX 719
                        D+  +EAVDYSK+P+VLSSKPGQN KQQRKRRFDPS NDSEG     
Sbjct: 671 KKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEGPRAPK 730

Query: 720 XXXXXXXGKNMSFKR 734
                  GKN+SFKR
Sbjct: 731 KKRPTTRGKNVSFKR 745

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/734 (72%), Positives = 596/734 (81%), Gaps = 1/734 (0%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M SENPDVL S+++ VVRAASSLASQDVDFYKNL+R FS  LKSK+DKL DM NEIILSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DEHHESFELKE++IS LW +FGNIMDNLLEMSDHSLDKLN   NSK  G++LQYLG+FSG
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
           K+   TKR+EKPQLKFK  IDNSESHPFIPLLKEKPNALKP            NNPSHY 
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEIDHQEYS ++LQI++EIPSKSWDDS PIW+DT T+L  MLEDLKN  EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STRERDYLVDT++LR+ LHILNEVFT+P IVKVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR RPLSKPMTA
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSK+RP TPSSEVYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KE+PW++LMYQYNI  E+E LV++LY WRD IARRDDESPRFVMPNQLLAALVAY P DV
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
           IGVVSLTNGVTEHVRQNAK+LANLI +AL NI                 DGI LE I++ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 541 QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDI 600
           QIRD+MERFS+L NS +  +R K   + SSILLGK LP EE  I+Y K G PNKVK EDI
Sbjct: 541 QIRDVMERFSVLCNSNISKSRAKPV-TNSSILLGKILPREEHDIAYSKDGLPNKVKTEDI 599

Query: 601 KARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFDDIIVLXX 660
           + RAQ F SALA LE+I+FE+EKP+ VP  +E+ + V+  SAP    + ++ DD++VL  
Sbjct: 600 RIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDNLDDLVVLKK 659

Query: 661 XXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGXXXXXX 720
                        +T K+AVDYSK+P++LS+KPGQN +QQ+KRRFDPSS+DS G      
Sbjct: 660 KNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSNGPRAAKK 719

Query: 721 XXXXXXGKNMSFKR 734
                 GKN+SFKR
Sbjct: 720 RRPAAKGKNLSFKR 733

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/731 (50%), Positives = 486/731 (66%), Gaps = 10/731 (1%)

Query: 9   LFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFE 68
           L S +V  VRA+S+LA+QDVDFY++L+ E S+ +   +D+L DMVN IILSIDE++E+ +
Sbjct: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68

Query: 69  LKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKR 128
             ++E++  WK   NI+DNL E SD SLD L   A  K +    +Y  + +  +++  KR
Sbjct: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128

Query: 129 LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPYAYEID 188
           + KPQLKF   IDNSESHPFIPLLKEKPNALK             N P HY HPY YEID
Sbjct: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188

Query: 189 HQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYY 248
           +Q Y+  +LQ+++ IPSKSW ++E +W+D    L  ML D+K  +EIA+DLEHHDYR+YY
Sbjct: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248

Query: 249 GIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYV 308
           GIVCLMQ+STRE DYLVDTI LR+ L +LNEVFTDP +VKV HGAFMDIIWLQRDLGLY+
Sbjct: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHF 368
           V LFDT+HAS+A+G PRHSLAYLLE FANFKTSKKYQLADWR RPLSK MTAYARADTHF
Sbjct: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368

Query: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVL 428
           LLNIYDQLRN+L+E+NKL GVL ESRNVAKRRFEYSK RPR PS  VYS +EKE+PWR L
Sbjct: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428

Query: 429 MYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTN 488
           M+QYNI SE+E+L+K L+ WRD IARRDDESPR++MPNQL+  LVAY P D  GV+S + 
Sbjct: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488

Query: 489 GVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITISQIRDIMER 548
            VT++VR N+K++ANLI+NAL                       S + +T+SQI++    
Sbjct: 489 VVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETASV 548

Query: 549 FSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVEDIKARAQKF 607
           F  ++   G  NN  +   S +      +L  +   I Y K G  + VK + + +R   +
Sbjct: 549 FIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEY-KNGEKHSVKQQQLVSRFNTY 607

Query: 608 NSALAGLENIMFELEKPV-TVPASVEKGEAVEIES---APELPSKAE-SFDDIIVLXXXX 662
              +  L N+ +EL  PV   P  ++K +  E++    A  +P+K E   D+++VL    
Sbjct: 608 TKQVNELTNVRYEL--PVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVVLKKVN 665

Query: 663 XXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGXXXXXXXX 722
                     +  + + +DYSK   +L     + +++ +KR+FDP +  +EG        
Sbjct: 666 RQPNKTKLEENEKI-DFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASNEGPKAARKRK 724

Query: 723 XXXXGKNMSFK 733
               G+N+S+K
Sbjct: 725 SGTRGRNLSYK 735

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/764 (49%), Positives = 497/764 (65%), Gaps = 48/764 (6%)

Query: 4   ENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEH 63
           E    L  K+V  VRAAS+LA+QDVDFY++++++ ++ L+  S+++ DM+N ++LSIDE+
Sbjct: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66

Query: 64  HESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDS 123
            E  +  ++ +  +WKDFGN+MDNL E SD S+D +          + +QY+ +FSG+D 
Sbjct: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDL 126

Query: 124 LSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPY 183
              K++ KPQLKF   IDN+ESHPFIPLLKEKP ALKP             +P HY  PY
Sbjct: 127 TPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPY 186

Query: 184 AYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHD 243
            YEIDHQEY+  +LQ K  IPS SW D+EPIW+DT ++L  ++ DL+ ++EIAVDLEHHD
Sbjct: 187 EYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHD 246

Query: 244 YRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRD 303
           YR+YYGI CLMQ+STR+ DYL+DT+ LR+ L ILN VF +P+I KVFHGAFMDIIWLQRD
Sbjct: 247 YRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRD 306

Query: 304 LGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYAR 363
           LGLYVVGLFDT+HAS+A+GLP+HSLAYLLE FA FKTSKKYQLADWR RPLSK M AYAR
Sbjct: 307 LGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYAR 366

Query: 364 ADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSE--VYSPIEK 421
           ADTHFLLNI+DQ+RN LIE NKLAGVL ESRNVAKRRFEYS  RP+   +   VYSPIEK
Sbjct: 367 ADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEK 426

Query: 422 ENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVI 481
           ++PW+ +M+QYNI  +KE L+K+LY WRD IARRDDESPRFVMPNQLL +LVAY PID  
Sbjct: 427 DDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAP 486

Query: 482 GVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISL------- 534
           GVVS++N VT++VR N+K+LANLI+N L  +                 +GIS+       
Sbjct: 487 GVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAE-----EGISVVPETGHD 541

Query: 535 --EVITISQIRDIMERFSLLSNSGVINNRTKTGDST-SSILLGKTLPF-EECGISYGKKG 590
             + +TI Q++++  +F LLS+    NN  KT  S    + L   + F ++  I Y   G
Sbjct: 542 LSQKLTIHQLQNLKSKFQLLSDK--FNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADG 599

Query: 591 TPNKVKVEDIKARAQKFNSALAGLENIMFELE--------------KPVTVPASVEKGEA 636
              +   E  K R+++F+ A+  LE + + +                P+TV  + E G+ 
Sbjct: 600 KI-QTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAE-GQV 657

Query: 637 VEIESAPELPSKAESFDDIIVLXXXXXXXXXXXXXXDMTVK--EAVDYSKMPSVLS---- 690
            E+   P      E  D++IVL              +      E +DY K   VL+    
Sbjct: 658 NEMIEKP------EDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKN 711

Query: 691 SKPGQNRKQQRKRRFDPSSNDSEGXXXXXXXXXXXXGKNMSFKR 734
           S+ G+N    +++RFDP S  +EG            GKN+SFKR
Sbjct: 712 SRGGRNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/741 (49%), Positives = 495/741 (66%), Gaps = 13/741 (1%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M S+ PD L S +V  VRAAS+L++QD+DF+K+L+   S  ++  S KL +++NE++LSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DE++++ E  +D     WKD G+IMDNL E SDH+ D L   + ++   + +QYL D S 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQ-GNSNVQYLDDSSR 119

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            +   +KR+EKPQL FK  IDN+ESHPF PLL+ KP+AL+P            N PSHY 
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEID QEY+  +LQI+  IPS+ W+D++P+W+DTK  L  +L +L++A EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STRERD+LVDTI LR+ LH+LNE+FTDP ++KVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWR RPL+KPM A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+  RP+  S++V+SPIE
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           K+ PWR LMYQYNI   +E L++ LY WRD IARRDDESPR+VMPNQLL +LVA AP D 
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
            GV+S++N +T++VR N+K+L+NLI+  L ++                   +S +V++IS
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLS-QVLSIS 538

Query: 541 QIRDIMERF-SLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599
           QI+++  +F SL S     N+ T +    S +  G  +   +  + Y K     K+ +++
Sbjct: 539 QIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNS---KIVIDE 595

Query: 600 --IKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAV----EIESAPELPSKAESFD 653
             ++ R  + +  L  ++   F L   VT   + E  + V    ++  A E      + D
Sbjct: 596 NQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKD 655

Query: 654 DIIVLXXXXXXX-XXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDS 712
           +IIVL               + T  E +DY     +L +    ++++  KRRFDP ++++
Sbjct: 656 EIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSEN 715

Query: 713 EGXXXXXXXXXXXXGKNMSFK 733
            G            GKNMSFK
Sbjct: 716 VGPQSAKKRKKPTPGKNMSFK 736

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/745 (49%), Positives = 485/745 (65%), Gaps = 18/745 (2%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M SE    L SK V  VRA+SSL  QDV F+ NL+   ++ +K   +++ +M+N+I+ SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNH-TANSKVSGAELQYLGDFS 119
           DE+ + F    +++   W+DF N+ DNL E SD S+D +   T  +  +G+E+QYL D  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 120 GKDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHY 179
           G DS S KR+ KPQL F + +DNSES PF PLL EKPNALKP            N PSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 180 LHPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDL 239
            +PY YEI +QEY++D+L+ +  IPS  W +SEP+W+D+   L  +L+DLK   E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 240 EHHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIW 299
           EHHDYRSYYGIVCLMQ+STR+ DYLVDTI LRD LHILN+VFTDP++ KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMT 359
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWR RPLSKPM+
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPI 419
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK RP+    +V++PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 420 EKENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPID 479
           EKE+PWR LM+QYN+T EKEELVK LY WRD IARRDDESPR++MPNQLL +L AY P D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 480 VIGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITI 539
            + +VS+ + VT+ VR N+KVLANLI+    +                  +  +  V+T+
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIK----SFVESSKLGPQSSYTPNTENTSTPFVLTL 536

Query: 540 SQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYG-KKGTPNKVKVE 598
           SQI+DI  RF+ L+ +   ++  K      S   G  L   +  +SY   K TP    V 
Sbjct: 537 SQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTPVSQSV- 594

Query: 599 DIKARAQKFNSALAGLENIMFELE---KPVT---VPASVEKGEAVEIESAPELPSK-AES 651
            +++R+++FN  +    +I +++    +PV    +P+     E+ + ++  + P    E 
Sbjct: 595 -LESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKED 653

Query: 652 FDDIIVLXXXXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKP--GQNRKQQRKRRFDPSS 709
            D+I+VL              +   +E VDYSK   VL  +    + +    K+RFDP S
Sbjct: 654 MDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFS 713

Query: 710 NDSEGXXXXXXXXXXXXGKNMSFKR 734
             SEG            GKN SFKR
Sbjct: 714 AISEGPKAPKKRKAVTKGKNASFKR 738

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/748 (49%), Positives = 483/748 (64%), Gaps = 32/748 (4%)

Query: 9   LFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFE 68
           L S +V  VRAASSLA+QDVDFY+NL++E S  L   S ++T+M+N ++LSI+E++E  E
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 69  LKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKR 128
             ++ +   WKDF N+MDNL E SD SLD +  +  S  + +E QYL D +  DS  +KR
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 129 LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPYAYEID 188
           + KPQL+F + +DNSES PF+PLL +KP+++K               PSHY HPY  EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 189 HQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYY 248
            QEY++ VLQ+ + + S+ W+ SE  W+DT   L  ML+ LK  +EIAVDLEHHDYRSYY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 249 GIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYV 308
           GIVCLMQ+STR+ D+LVDT+ LRD LHILNEVF DP I+KV HGAFMDIIWLQRDLGLYV
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHF 368
           V LFDTYHAS+A+G PRHSLAYLLE +ANFKTSKKYQLADWR RPLSKPM AYARADTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVL 428
           LLNIYDQ+RN+LI  NKLA VL+ESRNVAKRRFEYS+ RP+ PS  V++PIEKE PWR L
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 429 MYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTN 488
           +YQYN+ S K EL+K ++ WRD IARRDDESPR++MPNQL+ +LV Y PID  GV+S++N
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 489 GVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDG--ISLEVITISQIRDIM 546
            +T+HVR N+KV+ANLI+ +L ++                  G   + + +TISQI+++ 
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMT 547

Query: 547 ERF-SLLSNSGVI-NNRTKTGDST--SSILLGKTLPFEECGISYGKKGTPNKVKVEDIKA 602
             F  + SN  +I  + +K  D    S+I L K    E     + K+     V  E +  
Sbjct: 548 ALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKN---EIVLYDHDKRHV---VTNEQLAG 601

Query: 603 RAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVE-----------IESAPELPSKA-E 650
           RA++    +    N    +    +    VE+ EA E           +E+A    +   E
Sbjct: 602 RAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFE 661

Query: 651 SFDDIIVLXXXXXXXXXX--XXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDP- 707
             +DIIVL                 M  KE +DYSK+ ++LS    + R+  +KR+ DP 
Sbjct: 662 DMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSK---EKRENSKKRKGDPF 718

Query: 708 -SSNDSEGXXXXXXXXXXXXGKNMSFKR 734
              N  EG            GKN+SFKR
Sbjct: 719 GEENGLEGPKAAKKRKQINRGKNVSFKR 746

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/751 (47%), Positives = 478/751 (63%), Gaps = 30/751 (3%)

Query: 5   NPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHH 64
           N D L   +V  VRAAS+LA+QDVDFY++L++E ++ L + S K+TDM+N II S+DE+ 
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 65  ESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSL 124
           E     ++ +   WKD GN++D+L E++DHS+D L+  +    +  +++YL D    +S 
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 125 STKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPYA 184
           +  RL KPQL F   +DNSE+HPF PLL +KPNA+ P            + P HY  PY 
Sbjct: 122 NVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYE 181

Query: 185 YEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDY 244
            EID QEY+  VLQ    IPSK W+++E IW+D +  L  ML +LK A+E+AVDLEHHD+
Sbjct: 182 TEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDF 241

Query: 245 RSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDL 304
           RSYYGI CLMQ+STR  DYLVDTI LRD L +LN VFTDP I K+ HGAFMDIIWLQRDL
Sbjct: 242 RSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDL 301

Query: 305 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARA 364
           GLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSK+YQLADWR RPLSK M AYARA
Sbjct: 302 GLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARA 361

Query: 365 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENP 424
           DTHFLLNI+DQLRN LI+ +KLA +L+ESR VAKRRFEYSK++P  PSS V+SP E + P
Sbjct: 362 DTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMP 421

Query: 425 WRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVV 484
           WR ++YQYNI S+K ELVK L+ WRD IARRDDESPR++MPNQL+A+LV Y P +  GV+
Sbjct: 422 WRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVI 481

Query: 485 SLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVIT------ 538
           S+   +T+ VR NAK +ANLI++ L ++                 +  S ++ T      
Sbjct: 482 SVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFI 541

Query: 539 ISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVE 598
           +SQ  +I+E++S  SN+  +N+ T + +   S++  K     +  I+Y  KGT + +  +
Sbjct: 542 VSQFENILEKYS--SNNSNLNDVT-SKEGKDSLVFSKIFNSRDDIITYD-KGTKHLITEQ 597

Query: 599 DIKARAQKFNSALAGLENIMFELEKPVTVPASVEK--GEAVEIESAPELPS-----KAES 651
            +  R ++ ++A+   E I F +E   T   S+++   E  E+ S   LP+     + E 
Sbjct: 598 QLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQED 657

Query: 652 FDDIIVLXXXXXXXXXX------XXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRF 705
            D+IIVL                    D TV   +DYSK   +LS      R+   KR++
Sbjct: 658 LDEIIVLKDTKDRRNRQHRGRGRSADSDHTV---IDYSKGDKILSQ--DNRRRTPNKRKY 712

Query: 706 DPSS--NDSEGXXXXXXXXXXXXGKNMSFKR 734
           DP S  N+                +N+SFKR
Sbjct: 713 DPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/744 (47%), Positives = 486/744 (65%), Gaps = 17/744 (2%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M S++ D +  K+++ VRA+++LASQDV+F+K+++   +N L+     +  ++N I+LSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           D ++E  +   + +  + K+F N+MD L E +D SLD LN  +++  +   +Q+L D + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            ++  ++R+ KPQL FK  +DNSESHPF PLL EKPNALK             + P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
            PY YEI +QEY++D+L+ K+ IPS SW D+  IW+D    L  M+++LK +SEIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQ+STR +DY+VDTI LRD L +LNEVFT+PLI KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSK++P+ P + +++P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KE+PWR LMYQYNI  +KE L+++LY WRD +ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGI-----SLE 535
           I VVS+++ VT+HVR+N+K LANLI+  L  I                P  +      L+
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEI----KLGEVKSINNRLPSSLDVSQDELQ 536

Query: 536 VITISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKV 595
            +   +I  +   F  + N      ++K    TSS++L + L   E  + Y   G+   V
Sbjct: 537 FLPSHKIELMTGAFKEIENQLTQATKSKQA-MTSSVVLSEILLHPEHAVKYH-NGSACSV 594

Query: 596 KVEDIKARAQKFNSA--LAGLENIMFELEKPVT-VPASVEKGEAVEIESAPELPSKAESF 652
           +  ++K R   +  A  LA  +NI   LE   +  P   E+    + +    +P K E  
Sbjct: 595 EESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM 654

Query: 653 DDIIVLXXXXXXXXXXXXXXD--MTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSN 710
           D+I+VL              D    V+E VDYSK  ++L+S   + +K+ +KR FDP S+
Sbjct: 655 DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSS 713

Query: 711 DSEGXXXXXXXXXXXXGKNMSFKR 734
             EG            GK +SFK+
Sbjct: 714 TGEGPKAAKKRRLVTKGKKISFKK 737

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/773 (46%), Positives = 487/773 (63%), Gaps = 53/773 (6%)

Query: 7   DVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHES 66
           D L  ++V+ VRA+ +LA+QDVDFY+++++  +  LK  + +L DM+N ++L++DE+ E+
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 67  FELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLST 126
            +  ++ +   WKDF N+MDNLLE SD S+D L  + N+  + + +QYL ++SG+D  S+
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 127 KR--LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPYA 184
           KR  + KPQL+F   +DN+E+HPFIPLLK KPNALK             N P HY  PY 
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 185 YEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDY 244
           YEID+Q Y+  +LQ+   IPS+ W ++  IW+DT   L  M++DL N +E AVDLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 245 RSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDL 304
           R+YYGIVCLMQ+STR +DY+VDT++LR  L  LNE FT+P I KV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 305 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARA 364
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWR RPLSK M +YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 365 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENP 424
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY K+RP   SS VYSPIEK +P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 425 WRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVV 484
           W+ LMYQYNI   KE L+K+LY WRD IARRDDESPR++MPNQLL +LVAYAP++  GVV
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 485 SLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISL--------EV 536
           S++N VT+HVR N+K+LANLI+N L  I                  G S         E 
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 537 ITISQIRDIMERF-SLLSN----SGVINNRTKTGDSTSSILLGKTLPF-EECGISYGKKG 590
           ++I Q+  +  +F SL S      GV NN        S +L    + F +E G ++ K  
Sbjct: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625

Query: 591 TP----NKVKVEDIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELP 646
                 +K+  E++  R + F+ A+  L+ + + +  P        + E V +ES  + P
Sbjct: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIP--------ENEIVVVESEQQEP 677

Query: 647 S---------------KAESFDDIIVLXXXXXXXXXXXXXX-----DMTVKEAVDYSKMP 686
           S               K E  D+IIVL                   D    E +DYSKM 
Sbjct: 678 SIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKME 737

Query: 687 SVLSSK-----PGQNRKQQRKRRFDPSSNDSEGXXXXXXXXXXXXGKNMSFKR 734
            VL +        +N    +++RFDP + ++EG            GKN+SFKR
Sbjct: 738 KVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/703 (50%), Positives = 451/703 (64%), Gaps = 25/703 (3%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           MP    D L  K+V  +RA+S+LA+QDVDF+++L R     L   S ++  ++N ++ SI
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           D++ E     ++ ++  WKDF N+MDNL E+SD S D L     S+  G +L++L + S 
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            DS+ +KR+ KPQL FK  ++N+E  PF+PLLKEKP AL+P              P HY 
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIVPGNDAV--PEHYA 178

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
            PY YEI+HQEY   V+   + IPSK W+ +E +W+D    L  M+ DLK+ +EIAVDLE
Sbjct: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+STRERDYL+DTI LRD L ILNEVF +P I+KVFHGAFMDIIWL
Sbjct: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVV LFDT+HAS+AIGLPRHSLAYLLE FANFKTSKKYQLADWR RPLSK M A
Sbjct: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRN LIE NKLAGVL ESRNVAKRRFEYSK RP  PS  VY PI+
Sbjct: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           K +PW+VLM+QY+I+  +EELVK LY WRD IARRDDESPR+VMPNQLL  L   AP + 
Sbjct: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
           I V+S+ + VT+HVR N+ VLA+LI+N L +                  D  SL  +T+ 
Sbjct: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLAS-SDKESDKGTFEADNNSTDAASL--LTVP 535

Query: 541 QIRDIMERFSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599
           QI+ +   F+ +S +  ++ N  K G S+S  +    L  E+  ++Y      +  K E 
Sbjct: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSS--IFTDILTSEDDAVNYVGNNMDHITKKE- 592

Query: 600 IKARAQKFNSALAGLENI---------MFELEKPVTVPASVEKGEAVEIESAPELPSKAE 650
           +  RA K   AL  +E           + E+ K       +      E++ +P  P   E
Sbjct: 593 LGKRAAK---ALQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPK--E 647

Query: 651 SFDDIIVLXXXXXXXXXXXXXXDMTVKE--AVDYSKMPSVLSS 691
             D+II L               ++ +E  AVDY+K   VL++
Sbjct: 648 DMDEIITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLAT 690

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/755 (49%), Positives = 480/755 (63%), Gaps = 35/755 (4%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M  E+ + L  K+V  VRAA++LA+QDVDFY++L++  +  L   S++L  M+N  +L I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           D++    E  ++++    KDF N+MDNL E SD SLD L   A  +  GA L YL D + 
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDR-KGAALMYLDDAAR 119

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            D +  KR+ KPQ++F++ IDN+E+HPF PLL+ KP+AL+P            + P HY 
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
            PY YEI++QEY+  +L+I + IPSK WD SEP+W+D K  L  ML+DLK ++EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQVSTR+ DYLVDT+ LRD L +LNEVF +PLIVKVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLY+V LFDTYHAS+A+G PRHSLAYLLE FA+FKTSKKYQLADWR RPLSK M+A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNIYDQLRNKLI  NKLAGVL ESRNVAKR F+YSK+RP+ P+S VYSP++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           + + W+VLM QYNI  EKE LVK+LY WRD IARRDDESPR+VMPNQLLA LV Y P+D 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
            GV+S++  VT+HVR NAK LANLI  +L  I                   +S +V+T+ 
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLS-QVLTVG 538

Query: 541 QIRDIMERFSLLSNS-GVINNRTKTGDSTSSILLGKTLPFEECG-ISYGKKGTPNKVKVE 598
           QI   + +F  LS +   ++  T + +S+SSI+ G  L    CG + YG +     V  +
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNIL-HAPCGFVGYG-RSLKKPVTDK 596

Query: 599 DIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESFD----- 653
            I+ R  + + AL        + E   T+    E+    E+   P    K    D     
Sbjct: 597 QIEKRKLELSEALE-----FIDAETATTIQ---EEDRGSELTHEPADDKKVSENDESKKE 648

Query: 654 ------------DIIVLXXXXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNRKQQR 701
                       +II L              +   +E +DY K   +L ++  +  K  +
Sbjct: 649 EAKETEPEEDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETE--KKSKSTK 706

Query: 702 KRRFDP--SSNDSEGXXXXXXXXXXXXGKNMSFKR 734
           KR FDP  +SND+              GK+ SFKR
Sbjct: 707 KRAFDPYAASNDAGNAPKPKKKRRMARGKSASFKR 741

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/750 (46%), Positives = 472/750 (62%), Gaps = 22/750 (2%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M SE+ D L S +V+ VR++S+LA+QD+DFYK+L+   +  L+  S  +  ++N+++LSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           D +++  +  +D     WK   NIMDNL E SDH+LD +         G  L+YL D   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            ++  +KR+EKPQL FK  +DN+E HPF PLL+ KP++L+P            + PSHY 
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEIDHQ+Y+  +L   + IPSK WD++E IW+DT   L  M ++L  A+E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+S RE D++VDTI LR+ L+ILN++FTDP + KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLY+VGLFDTYHAS+ +G P+HSLAYLLE FANFKTSKKYQLADWR RPL+KPM A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YARADTHFLLNI+D+LRN L+E NK++ VL+ESR VAKRRFEYS  RP+ PSS V+SPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           K+ PW+ +M+QYNI + KE L++ LY WRD IARRDDESPR+VMPNQLL +LVA AP + 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISL-EVITI 539
           I V+S+++ V+EH+R N+KV+ANLI+  L ++                 +G  L  +IT 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 540 SQIRDIMERFSLLS---NSGVINNRTKTGDSTSSILLGKTLPFE-ECGISYGKKGTPNKV 595
           SQI+ I   F  L+   NS  +NN     +S  S+L       +    + Y  K T   +
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNE---QNSEKSVLFNGISNLDVNTAVRYTPK-TRTLI 596

Query: 596 KVEDIKARAQKFNSALA------GLENIMF---ELEKPVTVPASVEKGEAVEIESAPELP 646
              ++  R  +    L         ++I+    E E P  V     + E   I S P   
Sbjct: 597 PQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEV--ITSDPSQE 654

Query: 647 SKAESFDDIIVLXXXXXXXXXXXXXXDMTVK-EAVDYSKMPSVL-SSKPGQNRKQQRKRR 704
              E+ D++I L                    E +DY+    +L S+K   N ++ +KRR
Sbjct: 655 EIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRR 714

Query: 705 FDPSSNDSEGXXXXXXXXXXXXGKNMSFKR 734
           FDP S +  G            GKN+SFKR
Sbjct: 715 FDPYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/747 (48%), Positives = 464/747 (62%), Gaps = 14/747 (1%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M  +N + L   IV VVRA+++LA+QDVDFYK+L+++ S+ L   ++   D+ N ++LSI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DE+    E  +D I   W  F NIMDNL+E SDH +D L+   N      E  +L + S 
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            +S  +KR+EKPQL F K +DN++S PF PLL EKPNALKP              P+HYL
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
            PY YEID+QEY+ +V++I+   P K W+ +  IWIDTK  L  +L DL+  SEIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHD RSYYGI CLMQ+STRE+DY+VDTI LRD L +LNE+FT+P I KVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K RP  P   +Y+ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
           KE PW+ L+ QYNI  EKE LV+ L+ WRD IARRDDESPR++MP Q+L +L++Y P D 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXX-XXXXXXXXXXXXXPDGISLEVITI 539
            GV+S++N VTEHVR N+  LANLI+ AL +                   D     +I+I
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 540 SQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599
           ++I +I  +F+ LS     +    +G   SS+L    +        Y K  T    K ED
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT-TSFKSED 624

Query: 600 IKARAQKFNSALAGLE-NIMFELEKPVTVPASVEKGE-----AVEIESAPELPSKA--ES 651
           + AR  + +  L GL  N  F  + PV    S+E         +E +S  +  +K   E 
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINED 684

Query: 652 FDDIIVLXXXXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQ-NRKQQRKRRFDPSSN 710
            ++IIVL              D      VDYSK   +   K    N   ++++ FDP +N
Sbjct: 685 NEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYNN 744

Query: 711 DSEGXX---XXXXXXXXXXGKNMSFKR 734
           D +                GKN+S+KR
Sbjct: 745 DGDTDKVPRALKKRQTNTRGKNISYKR 771

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/751 (45%), Positives = 458/751 (60%), Gaps = 24/751 (3%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M S + D LF +IV  +RAA++L++QD+DFY++L       L   S  +  ++NE++LS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120
           DE++   +   D     WK+  N+MDN+ E SDH+ D + H ++S+  G  +QYL D S 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYL 180
            DS  +KR+EKPQL FK  +DN+E HPF PLLKEKP+ALKP            N P+HY 
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240
           HPY YEID Q Y+  VL++++ I  + W+ +EPIW+D    L  ML++LK   E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300
           HHDYRSYYGIVCLMQ+S+R +D+LVDTI LRD LH+LN +  DP +VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR RPL KP+  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+  RPR P S VYSPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480
              PWR LMYQYN+   KE L+K LY WRD +ARRDDES R+VMPNQLL +LV+ +P + 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVITIS 540
            GV+S++  VT++VR NA+ LANLI+  L  I                   +S    T+S
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSER---ALSNPAATLS 537

Query: 541 --QIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISY--GKKGTPNKVK 596
              I+++ + F  L       + +     +SS+L    L      + Y  G+K       
Sbjct: 538 LHMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNV 597

Query: 597 VEDIK-ARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEI------ESAPELPSKA 649
           ++  K A  QKF S    +E +  ++E P    +S     + +I      ES  E+    
Sbjct: 598 LQTRKHALLQKFTS--QPVEPVT-DIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDE 654

Query: 650 ESFD--DIIVLXXXXXXXXXXXXXXDMTVKEAVDYSKMPSVL-----SSKPGQNRKQQRK 702
             F+  +I+VL                +  E VDYS    VL     S+    ++ + RK
Sbjct: 655 PDFEKSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRK 714

Query: 703 RRFDPSSNDSEGXXXXXXXXXXXXGKNMSFK 733
           R+FDP   D+              GK++SFK
Sbjct: 715 RKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/752 (46%), Positives = 462/752 (61%), Gaps = 23/752 (3%)

Query: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60
           M S+N D L +KI+  VRAASSLA+QD+DF ++L+     +L   S  +  ++NE+ILS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLD--KLNHTANSKVSGAELQYLGDF 118
            + +   E+ +D +   WKD  NI+DNL E SDHSLD  +   +++S      +QYL   
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 SGKDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSH 178
           S +D   ++R+ KPQL+FK  +DNSE HPF PLLK KP+ALKP              P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 YLHPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVD 238
           Y HPY YEID+Q Y   VL IK+ I   +WD++EPIW+D  T L  ML  LKN  EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDII 298
           LEHHDYRSYYG+VCLMQ+STRE D+LVDTI LR  L +LNE+FTDP I+KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPM 358
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWR RPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSP 418
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+  RP+  S  V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 IEKENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPI 478
           IEK++PWR LM QYN+   KE L++ LY WRD +AR+DDES R+VMPNQLL +LV  AP 
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 DVIGVVSLTNGVTEHVRQNAKVLANLIENALGNIXXXXXXXXXXXXXXXXPDGISLEVIT 538
           D  G++++ + + +HVR NA+VL N+I   +  I                        ++
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 539 ISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEEC-GISY---GKKGTPNK 594
           +S I+ +   F  L +  V ++  +        LL K   F++   ++Y   GK+   ++
Sbjct: 541 VSLIKTMDRHFKFLLDE-VQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599

Query: 595 VKVEDIKARAQKFNSAL--AGLENIMFELEKPVTVPASVEKGEAVEIESAPELPSKAESF 652
             ++     +QKF+     AG+  I   +EK ++  + +       +ES  +  SK  S 
Sbjct: 600 ELLDRKSDLSQKFSKVFKAAGIA-IGSHIEK-LSSNSELPADTTSNVESPSKEESKNNSD 657

Query: 653 D------DIIVLXXXXXXXXXXXXXXDMTVKEAVDYSKMPSVLSSKPGQNR----KQQRK 702
           D      +IIVL                  KE VDY+ + S+L +   Q++    +   K
Sbjct: 658 DLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDK 717

Query: 703 RRFDPSSNDSEGXXXXXXXXXXXXGKNMSFKR 734
           R+F      S G            GK +S+K+
Sbjct: 718 RKFHSDLQGSIG--AAAIKKPRSKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/503 (55%), Positives = 365/503 (72%), Gaps = 1/503 (0%)

Query: 9   LFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFE 68
           + +++V  +RA+S++++QDVDFYK+L+   S  L   S KL  ++N++++SID++++  E
Sbjct: 12  ILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIE 71

Query: 69  LKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKR 128
                +   W + G +MD L E S+H+L  +     S + G  LQYL D       +  +
Sbjct: 72  PGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKG-SNIIGNNLQYLDDSQPLTDTTLTK 130

Query: 129 LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHPYAYEID 188
           + KPQ  F + +DN+ESHPF PLL +KPNAL+P              P+HY HPY YEID
Sbjct: 131 ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEID 190

Query: 189 HQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYY 248
           HQEY   VL+I+  IPSK W++++  W+D    L  M+ +L  A E+A+DLEHHDYR+YY
Sbjct: 191 HQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYY 250

Query: 249 GIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYV 308
           GI CLMQ+STRE D+LVDTI LRD L +LNE+FT+P ++KVFHGAFMD+IWLQRDLGLY+
Sbjct: 251 GITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYL 310

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHF 368
           V LFDT+HAS+ +G P+HSLAYLLE +A+FKTSKKYQLADWR RPLSKP+ AYARADTHF
Sbjct: 311 VSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHF 370

Query: 369 LLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVL 428
           LLNIYDQ+RN LIE  KLA  L+ SR VAKRRFEY+K RP   +SEVYSP+E+E+PWR L
Sbjct: 371 LLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSL 430

Query: 429 MYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTN 488
           ++ YNI   K  L+K LY WRD IARRDDESPR+VMPNQLL ALV  AP D  G++S+T+
Sbjct: 431 IFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTS 490

Query: 489 GVTEHVRQNAKVLANLIENALGN 511
            VTEHVR NAK L+ LI+  L +
Sbjct: 491 FVTEHVRSNAKSLSQLIKKTLAS 513

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/507 (55%), Positives = 370/507 (72%), Gaps = 2/507 (0%)

Query: 3   SENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDE 62
           SE+  VL ++++  +RA+S++ +QDV FYKNL+   +  + + S +L  ++N+I+LS+DE
Sbjct: 7   SEDGSVL-NQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDE 65

Query: 63  HHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKD 122
           +++  E   + +   W + G +MD L E S+H+L       N ++S   +QYL D     
Sbjct: 66  NNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSPSLH 124

Query: 123 SLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPXXXXXXXXXXXXNNPSHYLHP 182
             + K++ KPQL FK+ IDNSESHPF PLLK+KP+AL+             + P+HY  P
Sbjct: 125 DGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQP 184

Query: 183 YAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHH 242
           Y YEIDHQEY+  VLQI + +PS  WD++E  W+D    L LML +L  A+EIA+DLEHH
Sbjct: 185 YEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHH 244

Query: 243 DYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQR 302
           DYR+YYGI CLMQ+STRE+D+L+DTI LRD L ILNEVFTDP I KV HGAFMDIIWLQR
Sbjct: 245 DYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQR 304

Query: 303 DLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYA 362
           DLGLY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR RPL K + AYA
Sbjct: 305 DLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYA 364

Query: 363 RADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKE 422
           RADTHFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++  RP+  +S V+SPIE+E
Sbjct: 365 RADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERE 424

Query: 423 NPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIG 482
           +PWR LM+QYNI   K  LV+ LY WRD +ARRDDESPR+V+PNQLL +L   AP     
Sbjct: 425 DPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPAL 484

Query: 483 VVSLTNGVTEHVRQNAKVLANLIENAL 509
           +++ +  VTEH+RQNAK LA LI+ +L
Sbjct: 485 IMATSTFVTEHIRQNAKSLALLIKKSL 511

>KLTH0D11616g Chr4 complement(951182..952090) [909 bp, 302 aa] {ON}
           similar to uniprot|Q08686 Saccharomyces cerevisiae
           YOR251C catalyzes transfer of the sulfane atom of
           thiosulfate to cyanide to form sulfite and thiocyanate
          Length = 302

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 23/120 (19%)

Query: 309 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPL-SKPMTAYA----- 362
           VG F     +  + +  H L YLL NF  +K             PL + P T+++     
Sbjct: 99  VGNFSAPRCAWTLAVFGHELVYLLNNFPAYKA---------EGFPLDTTPRTSFSELEPS 149

Query: 363 --RADTHFL---LNIYDQLRNKLIESNKLAGV--LYESRNVAKRRFEYSKHRPRTPSSEV 415
             ++D  F    +  Y+++ +KL+E  KLA V  ++++R + +   E S+ RP  PS  +
Sbjct: 150 DYKSDADFTKQEVVSYEEI-HKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHI 208

>TPHA0H02190 Chr8 complement(515628..522332) [6705 bp, 2234 aa] {ON}
           Anc_6.311 YMR207C
          Length = 2234

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 9/71 (12%)

Query: 576 TLPFEECGISYGKKGTPNKVKVEDIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGE 635
            LPFE     +G   +P+   +E  KA A KFNS +A LENI+   +  VT+ +S++   
Sbjct: 778 ALPFEGMLPEFG---SPD---IEGTKA-AHKFNSLVATLENILKGYDNQVTMNSSLQL-- 828

Query: 636 AVEIESAPELP 646
            +E+   PELP
Sbjct: 829 LIEVLRNPELP 839

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360
           +RD  +Y+  L       K        L  L     NF  + +YQ+A W+ R  ++  + 
Sbjct: 96  RRDSNIYLYWLLQNSPLVKG------DLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSC 149

Query: 361 YARADTHFLLNIY 373
           +   D HF  NI+
Sbjct: 150 FGLNDIHFCRNIF 162

>YNL119W Chr14 (401040..402521) [1482 bp, 493 aa] {ON}  NCS2Protein
           required for thiolation of the uridine at the wobble
           position of Lys(UUU) and Glu(UUC) tRNAs; has a role in
           urmylation and in invasive and pseudohyphal growth;
           inhibits replication of Brome mosaic virus in S.
           cerevisiae
          Length = 493

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 22/105 (20%)

Query: 175 NPSHYLH------PYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLED 228
           NPS++L+      PY  E   ++Y             K W DS+     + T    +L +
Sbjct: 376 NPSNWLNRITVTSPYPVETTEEKY-----------LFKQWQDSK--LGQSHTHYVELLNE 422

Query: 229 LKNASEIAVDLEHHDYRSYYGIVCLMQVSTRERDYL---VDTIEL 270
           +K  +  ++D+E  D +  YG + L+  S ++++ +   VDT+++
Sbjct: 423 IKQGASNSLDVEDGDVKLCYGCLILLNTSIKDKNLVWPKVDTMDI 467

>AER284W Chr5 (1157531..1162036) [4506 bp, 1501 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML103C (NUP188)
          Length = 1501

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 26  QDVDFYKNLEREFSNVLKSKSDKLTD--MVNEIILSIDEHHESFELKEDEISGLWKDFGN 83
           QD    KN+   FS++++ K D ++   +   I+   D  HE+ E+    I  + K    
Sbjct: 792 QDYRVLKNIYSFFSSIMEGKQDGMSILFLTGNIVTFDDSKHENKEVGSKSILTILKRNAL 851

Query: 84  IMDNLLE-MSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLS--TKRLEKPQLKFKKSI 140
            +D + E +  H LD +++  NS  S     Y  D   KD ++   KRLE     F+ ++
Sbjct: 852 NLDRMPEDLGSHLLDAISYAFNSWTSAR--NYAAD---KDFITALVKRLE----AFEPNV 902

Query: 141 DNS 143
           DN+
Sbjct: 903 DNT 905

>SAKL0E10472g Chr5 (873925..875751) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P06208 Saccharomyces cerevisiae
           YNL104C LEU4 Alpha-isopropylmalate synthase (2-
           isopropylmalate synthase) the main isozyme responsible
           for the first step in the leucine biosynthesis pathway
          Length = 608

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 18/78 (23%)

Query: 23  LASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFELKEDEISGLWKDFG 82
           L S  +D  +N++ EFS +++SK+D +                  ELK DEI+ L+KD  
Sbjct: 423 LRSLGLDLPRNMQIEFSTLVQSKADSV----------------GRELKGDEITNLFKDTY 466

Query: 83  NIMDN--LLEMSDHSLDK 98
           N  +    +E+ D+ + K
Sbjct: 467 NYNNQYKTIELVDYEISK 484

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,024,658
Number of extensions: 3257466
Number of successful extensions: 11275
Number of sequences better than 10.0: 55
Number of HSP's gapped: 11637
Number of HSP's successfully gapped: 56
Length of query: 734
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 617
Effective length of database: 40,065,477
Effective search space: 24720399309
Effective search space used: 24720399309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)