Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1616.26ON29329315630.0
Smik_15.1696.26ON29129313590.0
YOL001W (PHO80)6.26ON29329313230.0
Suva_15.1746.26ON29529513090.0
TDEL0G044306.26ON3472497541e-98
ZYRO0C07634g6.26ON3822437465e-97
Kpol_1037.306.26ON3672727402e-96
Kwal_56.224436.26ON2802537115e-93
ACR001C6.26ON3462737141e-92
TPHA0J003806.26ON3562487116e-92
CAGL0E02541g6.26ON3422757089e-92
SAKL0E01408g6.26ON3072407005e-91
Ecym_30296.26ON3512306863e-88
KLTH0C11110g6.26ON2802296742e-87
KNAG0I017506.26ON3242516747e-87
KLLA0D01287g6.26ON3452456498e-83
TBLA0A071606.26ON2682466411e-82
NCAS0D021506.26ON3692466049e-76
NDAI0C026406.26ON4272325421e-65
YIL050W (PCL7)7.240ON2852081837e-15
Smik_9.1407.240ON2851731828e-15
Skud_9.1197.240ON2851761765e-14
Suva_9.1497.240ON2861591757e-14
KAFR0I018407.240ON3251191625e-12
Ecym_43367.240ON3851101601e-11
KNAG0D016307.240ON4381731556e-11
Kwal_23.58077.240ON4651361557e-11
SAKL0F08602g7.240ON4741151531e-10
KLTH0A04268g7.240ON5801261531e-10
ADL075W7.240ON2071101462e-10
NCAS0E032207.240ON3411851458e-10
NCAS0A134807.240ON4481201469e-10
KAFR0L008807.240ON3131211422e-09
CAGL0M12342g7.240ON4571191423e-09
KLLA0C08305g7.240ON4091331413e-09
KNAG0L014707.240ON3541371371e-08
TPHA0C010907.240ON3851901352e-08
NDAI0A025607.240ON5031131343e-08
TDEL0H020207.240ON3631361307e-08
TBLA0D040707.240ON661601292e-07
ZYRO0C08118g7.240ON405601245e-07
Kpol_1033.137.240ON250761225e-07
NDAI0E047707.240ON303761211e-06
Suva_5.1677.240ON424601192e-06
Smik_5.1897.240ON415601182e-06
YER059W (PCL6)7.240ON420651183e-06
Kpol_2000.147.289ON3101091164e-06
Skud_5.1737.240ON420601174e-06
YDL179W (PCL9)7.289ON3041051111e-05
TBLA0C048507.289ON3681331112e-05
TDEL0H015507.289ON3091461093e-05
NCAS0A137707.289ON3121421067e-05
Kpol_1020.163.70ON2821701059e-05
Kwal_23.60067.289ON3041091032e-04
Suva_14.503.70ON279961022e-04
Suva_4.687.289ON3051061022e-04
TBLA0J006507.289ON3631011022e-04
SAKL0C12100g3.70ON3141221013e-04
TPHA0P008107.289ON24798994e-04
ZYRO0C09284g7.289ON311116996e-04
Smik_4.607.289ON305155986e-04
Smik_4.1107.289ON308113988e-04
SAKL0F09856g7.289ON335109970.001
Smik_14.423.70ON279106970.001
Skud_14.483.70ON27998960.001
AFR159C7.289ON308109960.001
Ecym_35353.70ON370105970.001
YNL289W (PCL1)3.70ON27996960.001
YDL127W (PCL2)7.289ON308113960.001
Suva_4.1187.289ON309115960.001
CAGL0E02233g3.70ON26698950.001
KLTH0A05346g7.289ON301109950.002
TBLA0A078903.70ON361112940.002
KNAG0A014903.70ON262128930.002
NDAI0A022707.289ON330137920.004
KNAG0B029307.289ON312102920.004
KLLA0E13223g3.70ON282104920.004
CAGL0J09328g7.289ON297101910.005
Skud_4.797.289ON30997910.005
Ecym_80387.289ON314111910.005
Skud_4.1287.289ON308103890.010
TPHA0A005803.70ON289106890.010
ZYRO0C02068g3.70ON330105880.012
Kpol_1020.87.289ON296103870.018
TDEL0E007903.70ON25496840.033
NCAS0A098703.70ON29487820.064
TBLA0B084403.70ON268105820.073
NDAI0A060503.70ON28696810.083
YPL219W (PCL8)6.236ON492175800.17
AEL195W3.70ON237108780.18
Kwal_23.52313.70ON25687780.19
KLLA0F05654g7.289ON31199780.20
TPHA0A032507.289ON28955770.32
ZYRO0B14410g4.333ON57468770.36
KLTH0A01584g3.70ON28187740.67
KAFR0C015603.70ON26787730.82
KAFR0A082803.70ON24194730.89
NDAI0C019805.347ON226111701.9
KLLA0B02024g6.236ON527134693.5
CAGL0J06336g7.289ON314117683.7
NDAI0C043005.347ON240107674.9
CAGL0J10846g5.347ON229110656.8
NCAS0D016405.117ON68658668.3
SAKL0A03938g6.236ON50188668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.161
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   606   0.0  
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   528   0.0  
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   514   0.0  
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   508   0.0  
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   295   1e-98
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   291   5e-97
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   289   2e-96
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   278   5e-93
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   279   1e-92
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   278   6e-92
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   277   9e-92
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   274   5e-91
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   268   3e-88
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   264   2e-87
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   264   7e-87
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   254   8e-83
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   251   1e-82
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     237   9e-76
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   213   1e-65
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    75   7e-15
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    75   8e-15
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    72   5e-14
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    72   7e-14
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    67   5e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    66   1e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    64   6e-11
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    64   7e-11
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    64   1e-10
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    64   1e-10
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    61   2e-10
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    60   8e-10
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    61   9e-10
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    59   2e-09
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    59   3e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    59   3e-09
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    57   1e-08
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    57   2e-08
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    56   3e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    55   7e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    54   2e-07
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    52   5e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    52   5e-07
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    51   1e-06
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    50   2e-06
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    50   2e-06
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    50   3e-06
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    49   4e-06
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    50   4e-06
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    47   1e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    47   2e-05
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    47   3e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    45   7e-05
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    45   9e-05
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   2e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    44   2e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    44   2e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    44   2e-04
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    44   3e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    43   4e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    43   6e-04
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    42   6e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    42   8e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    42   0.001
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    42   0.001
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    42   0.001
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    42   0.001
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    42   0.001
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    42   0.001
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    41   0.001
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    41   0.002
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    41   0.002
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    40   0.002
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      40   0.004
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.004
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    40   0.004
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    40   0.005
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    40   0.005
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    40   0.005
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    39   0.010
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    39   0.010
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.012
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    38   0.018
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.033
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.064
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    36   0.073
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    36   0.083
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    35   0.17 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    35   0.18 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    35   0.19 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    35   0.20 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    34   0.32 
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    34   0.36 
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    33   0.67 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    33   0.82 
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    33   0.89 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    32   1.9  
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    31   3.5  
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    31   3.7  
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                30   4.9  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    30   6.8  
NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.1...    30   8.3  
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    30   8.4  

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60
           METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD
Sbjct: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60

Query: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK
Sbjct: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293
           VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD
Sbjct: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/293 (87%), Positives = 271/293 (92%), Gaps = 2/293 (0%)

Query: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60
           ME++V + SE +HE QGI KVILP +F KCSRTDLVVLISRMLVSLIAINENS +K P++
Sbjct: 1   MESTVGDLSENMHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPEN 60

Query: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATT+A KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNI LC
Sbjct: 121 RFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLC 180

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFV DKNA GSFDLDSYSY  RPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK
Sbjct: 181 SIEQKQKKFVIDKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240

Query: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293
           +DYVLPSNIDKD ESGPQI +Q+G+L PN HYSQKRNSEAKD N Y KRSKPD
Sbjct: 241 IDYVLPSNIDKDNESGPQINEQRGSL-PN-HYSQKRNSEAKDANTYHKRSKPD 291

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/293 (88%), Positives = 268/293 (91%)

Query: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60
           ME++  E SE IHE QGIPKVILPA+F KCSRTDLVVLISRMLVSLIAINENS TKK DD
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDD 60

Query: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQT YPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVA KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQKKFV DKNA GS DLDSYSYV+RPKSGYNVLDKYYRRIVQLVGSFNASPDKS+K
Sbjct: 181 SIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRK 240

Query: 241 VDYVLPSNIDKDTESGPQIQQQKGTLSPNSHYSQKRNSEAKDTNIYRKRSKPD 293
           VDYVLP NID  +ESG Q  Q KG+ SPNSH SQKR SEAKD +IY KRSKPD
Sbjct: 241 VDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD 293

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/295 (83%), Positives = 265/295 (89%), Gaps = 2/295 (0%)

Query: 1   METSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDD 60
           ME+  REHSE   E Q IPK+ILP+EF KCSRTDLVVLISRMLVSLIAINENS+TK+PDD
Sbjct: 1   MESPAREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDD 60

Query: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
           QITLTRYHSK+PPNISIFNYFIRLTKFSSLEHCVL+TSLYYIDLLQTAYPDFTLNSLTAH
Sbjct: 61  QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAH 120

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLLTATTVAAKGLCDSFSTNAHY+KVGGVRCHELNILENDFLKRVNYRI+PRDHNITLC
Sbjct: 121 RFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLC 180

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
           SIEQKQK FV DKNA GS DL SYSY +R KSGYNVLDKYY+RIVQLVGSF+ASPDKS++
Sbjct: 181 SIEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRR 240

Query: 241 VDYVLPSNIDKDTESGPQIQQQKGT--LSPNSHYSQKRNSEAKDTNIYRKRSKPD 293
           V+Y LPSN D+D E   ++QQ K    +SP SHYSQKR SEAKDTN Y KRSKPD
Sbjct: 241 VNYALPSNFDEDNEGSARLQQPKAATEVSPKSHYSQKRISEAKDTNKYHKRSKPD 295

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  295 bits (754), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 183/249 (73%), Gaps = 16/249 (6%)

Query: 10  EGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHS 69
           EG  E   I  + LP +F KCSRTDL VLISRML  LI IN++    KP++   LTR+HS
Sbjct: 25  EGTDE---ISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHS 81

Query: 70  KVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129
           +VPP IS++NY IRLTK+SSLEHCVL+T++YYIDLL + YP FTL+SLT HRFLLTATTV
Sbjct: 82  RVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTV 141

Query: 130 AAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKF 189
           A+KGLCDSF TN HYAKVGGV   ELNILE +FLKRVNYRI+PRD NI  C +E K +KF
Sbjct: 142 ASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKF 201

Query: 190 VADKNAPGSFDLDSYSYVSRPK-----SGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYV 244
                    ++       SRP+     SGYNVLD Y+R+IVQLVGS+ +SPDKSK V+YV
Sbjct: 202 TL-------YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYV 254

Query: 245 L-PSNIDKD 252
           L PS+  KD
Sbjct: 255 LRPSSPIKD 263

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  291 bits (746), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 16/243 (6%)

Query: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISI 77
           +P VILP  F +CSRTDLV+LISRML  LI +N++S+T   D    LT++HSKVPP IS+
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137
           +NY +RLTK+SSL+HCVLM ++YYIDL+ + YP FTLNSLT HRFLLTATTVA+KGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPG 197
           F TN HYAKVGGV C ELN+LE + L+R+NYRIIPRD NI  C++E + + FV D     
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQ--- 218

Query: 198 SFDLDSYSYV------SRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL-----P 246
             D D ++ +      +R  SGYNVLD YY +IVQLVGS  ++ DKSK V+Y       P
Sbjct: 219 --DGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKP 276

Query: 247 SNI 249
           +NI
Sbjct: 277 TNI 279

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  289 bits (740), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 191/272 (70%), Gaps = 20/272 (7%)

Query: 14  EHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENS------TTKKPDDQ--ITLT 65
           E + I  + LP +F  CSR+DLV LI+RML  LI +N+N         ++P+++  + LT
Sbjct: 39  EIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLT 98

Query: 66  RYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLT 125
           R+HS+VPPNIS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT HRFLLT
Sbjct: 99  RFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLT 158

Query: 126 ATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK 185
           ATT+A+KGLCDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC IE +
Sbjct: 159 ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQ 218

Query: 186 QKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL 245
           Q KF  D +      +   S  +   SG+N+LD YY +IVQLVGSF+AS DKS+K +Y L
Sbjct: 219 QNKFTMDFSDLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276

Query: 246 ----------PSNIDKDTESGPQIQQQKGTLS 267
                      SN  K+  +G  I + +  +S
Sbjct: 277 LLSGNNMEKEVSNNIKENSNGQNIGESEQAIS 308

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  278 bits (711), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 185/253 (73%), Gaps = 17/253 (6%)

Query: 14  EHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPP 73
           E   +P+V LP +F +CSRTDLV+LISRML  L  IN++      DD   LTR+HS+VPP
Sbjct: 25  EEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPK---DDAKELTRFHSRVPP 81

Query: 74  NISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKG 133
            IS+++Y +RLT++SSLE  VL+ S+YYIDLL   YP F+LNSLT HRFLLTATTVA+KG
Sbjct: 82  QISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKG 141

Query: 134 LCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADK 193
           LCDSF TN+HYAKVGGV+C EL++LE++FLK+VNYRI+PRD NI+ C  E+K   FV   
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVT-- 199

Query: 194 NAPGSFDLDSYSYVSR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNIDKD 252
                    +YS   R P +G+NVLD YYR+I+++VGSF++SPDK+K+  YV+   I+ +
Sbjct: 200 --------PTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM---INSN 248

Query: 253 TESGPQIQQQKGT 265
           T    ++ Q+K T
Sbjct: 249 TRKDVELLQKKRT 261

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  279 bits (714), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 184/273 (67%), Gaps = 31/273 (11%)

Query: 16  QGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTK-KPDDQITLTRYHSKVPPN 74
           + + ++ LP +F  CSRT LVVLISRML SLI +N+    K KP   I LTR+HS+VPP 
Sbjct: 11  ESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKP---IKLTRFHSRVPPA 67

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATTVA+KGL
Sbjct: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKN 194
           CDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E++++ F +  N
Sbjct: 128 CDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF-SYSN 186

Query: 195 APGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL--------- 245
            P    +D    +    +G+ VL+KYY R++ L+G FN SPDKS  + + L         
Sbjct: 187 IP----MDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSIQ 242

Query: 246 -------------PSNIDKDTESGPQIQQQKGT 265
                        P NID  ++S P I    G+
Sbjct: 243 KTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGS 275

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  278 bits (711), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 177/248 (71%), Gaps = 19/248 (7%)

Query: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAIN-------ENSTTKKPDD---------- 60
           I  ++LP  F KCSR+DLVVLISRML  LI IN       EN++   P            
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 61  QITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAH 120
            I LTR+HS+VPPNIS+ NY IRLTK++SLEH VL++SLYYIDLL + YP+F +NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 121 RFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           RFLL ATTVA+KGL DSF TN+HYAKVGGVRC ELNILE DFL+R+NYRIIPRD NI LC
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKK 240
            +E+K  +F  D     + ++     ++ P SGYNVL+ YYR++VQ+VG    S DKSKK
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQ--PELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKK 269

Query: 241 VDYVLPSN 248
           V+Y++ +N
Sbjct: 270 VNYIIQTN 277

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  277 bits (708), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 142/275 (51%), Positives = 195/275 (70%), Gaps = 17/275 (6%)

Query: 12  IHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKV 71
           I+  + IP + LP +F KC + DLV+LI+RML  +I IN+ S  K+ + +  LTR+HSK+
Sbjct: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKI 66

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAA 131
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATT+A+
Sbjct: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVA 191
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NIT C +E ++  F+ 
Sbjct: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFI- 185

Query: 192 DKNAPGSFDLD-----SYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLP 246
               P S + D        Y S   +GYNVL +YY +I+++VG +++SPDK+KKV+Y   
Sbjct: 186 ---LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY--- 239

Query: 247 SNIDKDTESGPQIQQQ---KGTLSPNSHYSQKRNS 278
            +ID   ++  + QQ    K   + NS+Y    N+
Sbjct: 240 -DIDMPAKTLHEHQQNDAVKNCSNNNSNYQTASNN 273

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  274 bits (700), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 174/240 (72%), Gaps = 20/240 (8%)

Query: 20  KVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISIFN 79
           +++LP EF KCSRT LVVLISRML SLI +N++      D  + LTR+HS+VPP IS++N
Sbjct: 46  QIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPGISVYN 102

Query: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFS 139
           Y IRL K+SSLE  VL+ ++YYIDLL + YP FTLNSLT HRFLLTATTVA+KGL DSF 
Sbjct: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFC 162

Query: 140 TNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFV----ADKNA 195
           TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    ADK  
Sbjct: 163 TNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADK-- 220

Query: 196 PGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNIDKDTES 255
                      +  P +G+NVLD YY++++QLVG  N+SPDK+ KV YVL  +  +++++
Sbjct: 221 -----------IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQESQT 269

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  268 bits (686), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 131/230 (56%), Positives = 173/230 (75%), Gaps = 8/230 (3%)

Query: 16  QGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNI 75
           Q +P+  LP +F  CSRT LVVLISRML SLI +N+  T     + + LTR+HS+VPP+I
Sbjct: 18  QPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTES---NTLQLTRFHSRVPPSI 74

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATTVA+KGLC
Sbjct: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134

Query: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNA 195
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F +  N 
Sbjct: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTF-SFANI 193

Query: 196 PGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL 245
           P   + D  S  +R    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  264 bits (674), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 173/229 (75%), Gaps = 14/229 (6%)

Query: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISI 77
           +P+V LP +F +C RTDLV+LISRML  LI IN++      D+   LTR+HS+VPP IS+
Sbjct: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK---DNSSELTRFHSRVPPQISV 85

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137
           ++Y +RLT++SSLE  VL+ S+YYIDLL   Y  F+LNSLT HRFLLTATTV +KGLCDS
Sbjct: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145

Query: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPG 197
           F TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI  C  E+++  FV       
Sbjct: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVT------ 199

Query: 198 SFDLDSYSYVSR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL 245
                +Y+  +R P +G+NVLD YY++I+++VGS+++SPDK+K+  YV+
Sbjct: 200 ----ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  264 bits (674), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 171/251 (68%), Gaps = 30/251 (11%)

Query: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKP------------------D 59
           I  V LP+ F  CSR DL+ LISRMLV LI IN+++  KK                    
Sbjct: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80

Query: 60  DQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA 119
            +  LTR+HS VPP IS++NY IRLTK+S+LE  VL+TS+YYIDLL + YP FT+NSLT 
Sbjct: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140

Query: 120 HRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179
           HRFLLTATTVA+KGLCDSF TNAHYAKVGGV+  ELNILE++FLK++NYR++PRD NIT 
Sbjct: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200

Query: 180 CSIEQKQKKFVADKNAPGSFDLDSYSYVSRP-----KSGYNVLDKYYRRIVQLVGSFNAS 234
           C  E +  +F         ++  + + VS+P      SGYNVL  YY +I+QLVG F++S
Sbjct: 201 CKYEHRAHEFTI-------YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSS 253

Query: 235 PDKSKKVDYVL 245
            DKSKK +YV 
Sbjct: 254 LDKSKKANYVF 264

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  254 bits (649), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 169/245 (68%), Gaps = 22/245 (8%)

Query: 10  EGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHS 69
           +G +  Q IP   LP E+ +CSRT LVV+ISRML  LI IN+ +     +  + LTR+HS
Sbjct: 11  KGSNIGQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQINDANNAG--NQTMELTRFHS 65

Query: 70  KVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTV 129
           K  P+I+++ Y IRLTK+SSLEH VL++++YYIDLL   YP+FTLNSLT HRFLLTATT+
Sbjct: 66  KAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTI 125

Query: 130 AAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK--QK 187
           A+KGLCDSF TN HY+KVGGV+C ELNILEN+FL+RV YRIIPRD NI  C IEQK    
Sbjct: 126 ASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSN 185

Query: 188 KFVADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKS-----KKVD 242
             +  KNA              P +G+NVL  YYR+IVQLVG+   SPDK+     K VD
Sbjct: 186 MLIPMKNASQ----------RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVD 235

Query: 243 YVLPS 247
            + P 
Sbjct: 236 PMNPG 240

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  251 bits (641), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 171/246 (69%), Gaps = 12/246 (4%)

Query: 21  VILPAEFYKCSRTDLVVLISRMLVSLIAINEN-----STTKKPDDQITLTRYHSKVPPNI 75
           V+L   F KCS+ DL+ LISRML   I IN++     + T      + LTR+HSKVPPNI
Sbjct: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135
           SIF+Y IRLTK+SSLE  VL+TS+YYIDLL   YP+F+LNSLT HR+LLTATT+A+KGLC
Sbjct: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131

Query: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNA 195
           DSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+ I LC +E K    + D N 
Sbjct: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSP-IEDINN 190

Query: 196 PGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNIDKDTES 255
                 D +       SGYNVL  YY ++VQLVG+  +S +  + V+Y+   N D+   S
Sbjct: 191 ------DIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIYNS 244

Query: 256 GPQIQQ 261
            P++++
Sbjct: 245 MPELEK 250

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  237 bits (604), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 164/246 (66%), Gaps = 8/246 (3%)

Query: 23  LPAEFYKCSRTDLVVLISRMLVSLIAINE---NSTTKKPDDQITLTRYHSKVPPNISIFN 79
           +P E+ KCSR+DLVVL+SRMLV LI  N+   N++    D  + LTR+HS++PPNISIFN
Sbjct: 31  VPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRIPPNISIFN 90

Query: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFS 139
           Y  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHRFLLTA TVA KGLCDSF 
Sbjct: 91  YLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFC 150

Query: 140 TNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPGSF 199
           T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+TL  +E+  + F  D       
Sbjct: 151 TTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHLDMKDP 210

Query: 200 DLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSN---IDKDTESG 256
            L   SY   P +GY+VL+ YY+ IV++ G+  +S    K+V Y  P+N     K     
Sbjct: 211 KLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNNSALTQKLNNLP 268

Query: 257 PQIQQQ 262
           PQI+ Q
Sbjct: 269 PQIRAQ 274

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  213 bits (542), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 118/232 (50%), Positives = 151/232 (65%), Gaps = 11/232 (4%)

Query: 20  KVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQIT---LTRYHSKVPPNIS 76
           K+ LP +F +C R DLVVLISRMLV+LI IN+   TK  D+ +     TR+HS+V P IS
Sbjct: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKIND---TKANDNNLPSNYATRFHSRVIPGIS 112

Query: 77  IFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCD 136
           I NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  VA+K LCD
Sbjct: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCD 172

Query: 137 SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAP 196
           S  +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  LCS+E     F  +    
Sbjct: 173 SCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQI 232

Query: 197 GSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKVDYVL 245
                 S+SY   P SGYNVL  YYRRI+ ++G     + SPD +  VDY L
Sbjct: 233 KESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD-AVTVDYFL 282

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 102/208 (49%), Gaps = 33/208 (15%)

Query: 1   METSVREHS--EGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENST---- 54
           +E+  + HS  E  +E   + K++  A+F      +L+++IS +L  +I  N+ +T    
Sbjct: 78  LESEAKTHSLDEETNEQTDV-KILNIADF---PTDELILMISALLNRIITANDETTDVSQ 133

Query: 55  --TKKPDDQIT--LTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP 110
             + + +D++   +  ++ K  P I++  Y  R+ K+    + + ++ L Y D +   Y 
Sbjct: 134 QVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYG 193

Query: 111 D-----------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILE 159
                       F ++S   HR L+T  T+  K L D F +N+ YAKVGG+   ELN LE
Sbjct: 194 HSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLE 253

Query: 160 NDFLKRVNYRIIPRDHNITLCSIEQKQK 187
             FL   ++++        L S+E+ QK
Sbjct: 254 LQFLILCDFKL--------LVSVEEMQK 273

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 85/173 (49%), Gaps = 27/173 (15%)

Query: 34  DLVVLISRMLVSLIAINENST---TKKPDDQ-----ITLTRYHSKVPPNISIFNYFIRLT 85
           +L++++S +L  +I +N+ +T    + P D        +  ++ K  P I +  Y  R+ 
Sbjct: 109 ELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQ 168

Query: 86  KFSSLEHCVLMTSLYYIDLLQTAY---PD--------FTLNSLTAHRFLLTATTVAAKGL 134
           K+    + + ++ L Y D +   Y   P+        F ++S   HR L+T  T+  K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFL 228

Query: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQK 187
            D F +N+ YAKVGG+   ELN LE  FL   ++++        L S+E+ QK
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKL--------LVSVEEMQK 273

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 84/176 (47%), Gaps = 27/176 (15%)

Query: 31  SRTDLVVLISRMLVSLIAINE------NSTTKKPDDQIT--LTRYHSKVPPNISIFNYFI 82
           S  +L+ +IS +L  ++  N+         +K   D++   +  ++ K  P IS+  Y  
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 83  RLTKFSSLEHCVLMTSLYYIDLLQTAYPDFT-----------LNSLTAHRFLLTATTVAA 131
           R+ K+    + + ++ L Y D +   Y  F+           ++S   HR L+T  T+  
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQK 187
           K L D F +N+ YAKVGG+   ELN LE  FL   ++++        L S+E+ QK
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKL--------LVSVEEMQK 273

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 23/159 (14%)

Query: 34  DLVVLISRMLVSLIAINENSTTKKPDDQIT----------LTRYHSKVPPNISIFNYFIR 83
           +L++++S +L  ++  N+ +T   P  Q+           +  ++ K  P I++  Y  R
Sbjct: 110 ELILMVSALLNKIVKANDETT--DPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLER 167

Query: 84  LTKFSSLEHCVLMTSLYYIDLLQTAY---PD--------FTLNSLTAHRFLLTATTVAAK 132
           + K+    + + ++ L Y D +   Y   PD        F ++S   HR L+T  T+  K
Sbjct: 168 IQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTK 227

Query: 133 GLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            + D F +N+ YAKVGG+   ELN LE  FL   +++++
Sbjct: 228 FMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query: 63  TLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------QTAYPDF 112
           +L  +H K  P+I+I  YF R+ K+    + V +  L   D +            +   F
Sbjct: 177 SLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLF 236

Query: 113 TLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HRF++   TV  K L D F +N+ YAKVGG+  HE+N LE  FL   ++++I
Sbjct: 237 VMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTAYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 122 FLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A TV+ K   D F +N+ YA+VGG+  HELN LE  F    ++ +I
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 32/173 (18%)

Query: 34  DLVVLISRMLVSLIAINENSTTKKP-----------DDQITLTRYHSKVPPNISIFNYFI 82
           D++ +++ +L  +++ N+      P           D    +T ++ K  P I+I  Y +
Sbjct: 242 DILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLL 301

Query: 83  RLTKFSSLEHCVLMTSLYYIDLL--------------------QTAYPDFTLNSLTAHRF 122
           R+ K+    + + ++ L + D +                    Q  +  F ++S   HR 
Sbjct: 302 RIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRL 361

Query: 123 LLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYR-IIPRD 174
           L+   TV+ K   D F +NA YA+VGG+   E+N LE  FL   +++ +IP D
Sbjct: 362 LIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIPID 414

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 57  KPDDQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD----- 111
           +P+    +  +  K  P I++  YF R+ K+    + V ++ L Y D +           
Sbjct: 314 RPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQL 373

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR +++A TV+ K   D F +N+ YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 374 FVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

Query: 172 PRDHNITLCSIEQKQK 187
                    S+E+ QK
Sbjct: 434 --------ISVEELQK 441

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 10/115 (8%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------QTAYPDFTLNS 116
           +  K  P IS+  YF R+ K+    + V ++ L Y D +          +     F ++S
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 117 LTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
              HR ++ A TV+ K   D F +N+ YA+VGG+   ELN LE  FL   ++ +I
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL-----QTAYPDFTLNSLTAHR 121
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 122 FLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCS 181
            +++A TV+ K   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 546

Query: 182 IEQKQK 187
           +E+ QK
Sbjct: 547 VEELQK 552

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 5/110 (4%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTAYPD-FTLNSLTAHR 121
           +  K  P I++ +YF R+ K+  + + V ++ L Y D +        P  F ++S   HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 122 FLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++ A TV+ K   D F +N+ YA+VGG+   ELN LE  F    ++ +I
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 78/185 (42%), Gaps = 42/185 (22%)

Query: 29  KCSRTDLVVLISRMLVSLIAIN-------ENSTTKKPDD----QITLTR----YHSKVPP 73
           K S   L+ +IS +L  LI  N       E S   + DD    +  L R    +  K  P
Sbjct: 131 KLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIP 190

Query: 74  NISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY---------PD------------- 111
            I +  YF R+ K+    + VL+  L Y D +             P+             
Sbjct: 191 PIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDC 250

Query: 112 -----FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRV 166
                F L+S   HR +++A TV+ K   D F +N+ YAKVGG+   E+N LE  FL   
Sbjct: 251 KIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLIS 310

Query: 167 NYRII 171
           N+ +I
Sbjct: 311 NFDLI 315

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 15/120 (12%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ-------TAYPD-------- 111
           +  K  P IS+  YF R+ K+    + V ++ L Y D +        T+  D        
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV  K   D F +N+ YA+VGGV   ELN LE  FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 63  TLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----QTAYPD------- 111
            +  +  K  P I++  YF R+ K+    + V ++ L Y D +     + + +       
Sbjct: 171 AMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQ 230

Query: 112 -FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRI 170
            F ++S   HR ++   TV+ K L D F +N+ YAKVGG+   ELN LE  FL   ++ +
Sbjct: 231 IFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNL 290

Query: 171 I 171
           +
Sbjct: 291 L 291

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ------------TAYPD--F 112
           +  K  P I+++ YF R+ K+    + V ++ L Y D +             T+  D  F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 113 TLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            ++S   HR ++   TV  K   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ--------------TAYPD- 111
           +  K  P I++  YF R+ K+    + VL++ L + D +                + PD 
Sbjct: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299

Query: 112 -------------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNIL 158
                        F ++S   HR ++ A TV+ K + D F +N+ YA+VGG+   ELN L
Sbjct: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359

Query: 159 ENDFLKRVNYRII 171
           E  FL   ++R+I
Sbjct: 360 ELQFLILCDFRLI 372

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 24/137 (17%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLL----------------QTAYP 110
           +  K  P I++  YF R+ K+    + V ++ L Y D +                Q    
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 111 DFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRI 170
            F +NS   HR ++    V+ K   D F +NA YAKVGG+   E+N LE  FL   ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 171 IPRDHNITLCSIEQKQK 187
                   L S+E+ ++
Sbjct: 331 --------LISVEEMER 339

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 82/190 (43%), Gaps = 43/190 (22%)

Query: 25  AEFYKCSRTDLV-VLISRMLVSLIAINENSTTKKPDDQIT------LTRYHSKVPPNISI 77
           AEF      D++  L+ ++++S   ++ N+     D+ I       ++ +  K  P IS+
Sbjct: 159 AEFQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDEHIDSTIIKPVSCFRGKHVPQISL 218

Query: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD-------------------------- 111
             YF R+ K+  + + V ++ L Y D +     +                          
Sbjct: 219 EQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNVKQMKDE 278

Query: 112 ----------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILEND 161
                     F ++S   HR ++TA TV+ K   D F +N+ YA+VGG+   ELN LE  
Sbjct: 279 NNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELNHLELQ 338

Query: 162 FLKRVNYRII 171
           FL   +++++
Sbjct: 339 FLILCDFQLM 348

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 14/113 (12%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ---TAYPD-----------FTLNSLT 118
           P I++  YF R+ K+    + V ++ L Y D +     + P            F ++S  
Sbjct: 358 PQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMFVMDSYN 417

Query: 119 AHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
            HR ++   TV  K   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 418 IHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 31/136 (22%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID-----------------LLQTAY 109
           +  K  P IS+ +YF R+ K+    + V ++ L Y D                  LQ   
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 110 PD--------------FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHEL 155
           P               F ++S   HR L+   TV+ K   D F +N+ YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 156 NILENDFLKRVNYRII 171
           N LE  FL   ++ ++
Sbjct: 316 NHLELQFLVLCDFELL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TVA K   D F +NA YAKVGG+   ELN LE  FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++  TTV+ K   D F +N+ YA+VGG+   ELN LE  FL   ++ ++
Sbjct: 320 FVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+ K   D F +N+ YA+VGG+   ELN LE  FL   ++ + 
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHL- 221

Query: 172 PRDHNITLCSIEQKQK 187
                  L S+E+ Q+
Sbjct: 222 -------LISVEELQR 230

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 114 LNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIP- 172
           +NS T HR +L   TV++K L D   +N  YA+  G+   ELN LE  FL+  N+ +   
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNLSVS 286

Query: 173 ----RDHNITLCSIEQ 184
                D+   LCS  Q
Sbjct: 287 LNELEDYGTALCSCSQ 302

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+ K L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+ K L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 108 AYPD-FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRV 166
           A+P  F ++S   HR ++   TV+ K L D F +N+ Y++VGG+   ELN LE  FL   
Sbjct: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384

Query: 167 NYRII 171
           ++ ++
Sbjct: 385 DFELL 389

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTVAAKG 133
           SIF +   L K S+++   LM S  Y+  L++  P   + + S T HR  L    +AAK 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+ K   G +   ++N +E + L  +N+  I +  ++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query: 112 FTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
           F ++S   HR ++   TV+ K L D F +N+ Y++VGG+   ELN LE  FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 11/105 (10%)

Query: 72  PPNISIF--NYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--FTLNSLTAHRFLLTAT 127
           PP++SIF  N  I+    S+++   LM +  Y++ L++  P   + +N+ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 128 TVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            +AAK L DS   N H+     G +R  E+N +E + L+ +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 34  DLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHC 93
           +++  +S    S I I   S +   ++ I      S +PP   ++ +   L   S+++  
Sbjct: 19  EMIQFLSNCAASAIQIRPTSDSNLTNESI------SNIPP---LYTFIKNLVAHSNVQTP 69

Query: 94  VLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSFSTNAHYAKV--GGV 150
            LMT++ Y+  L+   P        T HR  L    +AAK L DS   N H+AK   G +
Sbjct: 70  TLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLL 129

Query: 151 RCHELNILENDFL 163
           +  E+N +E + L
Sbjct: 130 QLREVNTIEREIL 142

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 15/146 (10%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAA 131
           P  S+ N+   L   S+++   LM +  Y+  L++  P        T HR  L    +AA
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAA 104

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLCS-------- 181
           K L DS   N H+A    G +  HE+N +E + L+  ++ +     ++  C         
Sbjct: 105 KTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPIK 164

Query: 182 ---IEQKQKKFVADKNAPGSFDLDSY 204
              I QKQ+ ++   NAP   +L  Y
Sbjct: 165 EQFIRQKQQNYLL-FNAPMQGNLREY 189

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 13/142 (9%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGL 134
           ++ N+   L K S+++   LM +  Y+  L++  P        T HR  L    +AAK L
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTL 108

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC-------SIEQK 185
            DS   N H+A+   G ++  E+N +E + L+  ++ +  +  ++ +C        IEQ 
Sbjct: 109 NDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIICLSPLLQPIIEQS 168

Query: 186 QKKFVADK---NAPGSFDLDSY 204
            +K   D    NAP    + +Y
Sbjct: 169 LRKNQMDLLLFNAPTPGKVRNY 190

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 76/170 (44%), Gaps = 31/170 (18%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  +L +++++    L+T+  Y+  LQ   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITL------------C 180
            DS   N H+A+   G     ++N++E   L  +N+ +   ++++ L             
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDLILDLRHLLEPIMRDL 173

Query: 181 SIEQKQKKFVADKNAPGSFDLDSYSYVSRPKS------GYNVLDKYYRRI 224
            I  ++KK +  K+       + + Y+ RP S       YN   K+YR++
Sbjct: 174 EISYQRKKILKSKS-------EQHQYIQRPVSPISPTKSYN---KFYRQV 213

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKG 133
           +S+ N+   L   S+++   LM++  Y+  L++  P   L    T HR  L    +AAK 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+A    G +   E+N +E + L+  ++ +      + +C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+AK   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 68  HSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTA 126
           H   PP +SIF    ++   S+++   LM +  Y++ L++  P        T HR  L  
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIETTRHRIFLGC 98

Query: 127 TTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             +AAK L DS   N H+     G ++  E+N +E + L+  N+ +
Sbjct: 99  LILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 5/101 (4%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAA 131
           P++++F    RL   S+++   LM++L Y+  L+   P D      T HR  +    +AA
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           K L DS   N H+ +   G  +  E+N +E + L+  N+ +
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  +L +++++    L+T++ Y+  L+T  P D T    T HR  L    ++AK  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRDHNITLCSIEQKQ 186
            DS   NAH+++   G     ++N++E   L+      R+N   + +D    L  I++  
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWLLLPIKEDL 174

Query: 187 KK 188
           K+
Sbjct: 175 KR 176

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTVAAKGL 134
           S+ ++   + K+S ++   LM S  +++ L+   P +     TA HR  L    +A+K L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+ K   G +   E+N +E + L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 8/116 (6%)

Query: 69  SKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--FTLNSLTAHRFLLTA 126
           S  PP   +  +   L  +S+++   LM +  Y+  L++  P   F + + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 127 TTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
             +AAK L DS   N H+A    G +   E+N +E + L+  ++ +      +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 21/155 (13%)

Query: 72  PPNISIF--NYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATT 128
           PP++S F  N  I+    S+++   LM +  Y++ L+   P        T HR  L    
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLI 102

Query: 129 VAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNIT------LC 180
           +AAK L DS   N H+     G +R  E+N +E + L+  N+ +    H++       L 
Sbjct: 103 LAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDVRITTHDLVDALSYFLV 162

Query: 181 SIE-----QKQKKFVADKNAPGSFDLDSYSYVSRP 210
            I+     QK+++ +   NAP    L  Y    RP
Sbjct: 163 PIKEQLFRQKRQELLL-FNAPSPGQLKEYINHRRP 196

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 71  VPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTV 129
            PP     N   RL K S+++   LM +  Y+  L++  P        T HR  L    +
Sbjct: 46  APPLTEFIN---RLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLIL 102

Query: 130 AAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           AAK L DS   N H+A+   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKG 133
           +S+ ++   L   S+++   LM+++ Y+  L++  P        T HR  L    +AAK 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+++   G +   E+N +E + L+  ++++     ++  C
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 66  RYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLL 124
           ++ +++P   S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L
Sbjct: 47  KHMARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFL 103

Query: 125 TATTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
               ++AK   DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+A+   G     ++N++E   L+ +N+ +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA-HRFLLTATTVAAKG 133
           +S+ ++   L K S+++   LM+++ Y+  L++  P       T+ HR  L    +AAK 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+ +   G +   E+N +E + L+  N+ +   + ++  C
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  ++ +++++    L+T++ Y++ L+   P D T    T+HR  L    ++AK  
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSAKFH 174

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNI 177
            DS   N H+ +   G     ++N++E   LK  ++ I   +H++
Sbjct: 175 NDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDL 219

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
            DS   N H+A+   G     ++N++E   L+ +N+
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 71  VPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTV 129
            PP     N   RL K S+++   LM +  Y+  L++  P        T HR  L    +
Sbjct: 46  APPLTKFIN---RLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 130 AAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           AAK L DS   N H+A+   G +   E+N +E + L+  ++ +     ++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query: 71  VPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTV 129
            PP +   N   RL K S+++   LM +  Y+  L++  P        T HR  L    +
Sbjct: 46  APPLVKFIN---RLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 130 AAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI-IPRDHNITLCS 181
           AAK L DS   N H+A+   G +   E+N +E + L   ++ + I  D  IT  S
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLITSLS 157

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+ ++ Y++ L+   P D T    T HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            DS   N H+A+   G     ++N++E   L+ +N+ I
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKG 133
           +S+ ++   L   S+++   LM++  Y+  L++  P +      T HR  L    +AAK 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           L DS   N H+A    G +   E+N +E + L+  ++ +     ++  C
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 71  VPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTV 129
           +P   S+  +  R+ ++++++   L+ ++ Y++ L+   P D      T HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 130 AAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRIIPRDHNITL 179
           +AK   DS   N H+A    G     ++N++E   L  +++ +   +H I L
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNLQLTEHEIIL 166

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 3/128 (2%)

Query: 44  VSLIAINENSTTKKPDDQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYID 103
           V+L  +      + P    + T    K P   S+  +  +L +++++    L+T++ Y++
Sbjct: 27  VTLKVLPNTPAQQYPSPPSSPTELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLN 86

Query: 104 LLQTAYP-DFTLNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILEN 160
            L+   P D      T HR  L    ++AK   DS   N H+AK   G     ++N++E 
Sbjct: 87  KLKRILPKDAKGLPSTIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMER 146

Query: 161 DFLKRVNY 168
             L  +N+
Sbjct: 147 QLLNLLNW 154

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 39  ISRMLVSLIAINENSTTK-KPDDQITLTRYHSKVPPNISIFNYFIR-LTKFSSLEHCVLM 96
           +S  +V  +A N  S  + K  + I  T   + +P  I   + FI+ L   S+++   LM
Sbjct: 15  VSHEMVHFLATNTASIIQVKKGNNIVTTE--NGIPIEIPPLSNFIKNLVMHSNVQTPTLM 72

Query: 97  TSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSFSTNAHYAKV--GGVRCH 153
            +  Y+  L+   P        T HR  L    +AAK L DS   N H+ K   G +   
Sbjct: 73  ATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAAKTLNDSSPLNKHWTKYTDGLLHIR 132

Query: 154 ELNILENDFLKRVNYRI 170
           E+N +E + L+   + +
Sbjct: 133 EVNTIERELLEYFEWNV 149

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVA 130
           PP  ++  +   L   S +    LM S  Y+  L+   P   +    T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 131 AKGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNYRI 170
           AK L D+   N H++K     +   E+NI+E + L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 68  HSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTA 126
           H+ VP   S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 127 TTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNY 168
             ++AK   DS   N H+ K   G     ++N++E   L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAA 131
           P + +F    +L K+S+++   LM +  ++  L++  P        T HR  L    ++A
Sbjct: 47  PKLELF--IKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLILSA 104

Query: 132 KGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           K L DS   N H+A+   G +   E+N +E + L+  ++ +
Sbjct: 105 KTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 77  IFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLC 135
           +F +  ++   S+++   LM +  Y++ L+   P        T HR  L    +AAK L 
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLN 107

Query: 136 DSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           DS   N H++    G ++  E+N +E + L+  N+ +
Sbjct: 108 DSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 73  PNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAA 131
           P +S+ ++   L   S+++   LM+++ Y+  L++  P +      T HR  L    +A+
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 132 KGLCDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNYRIIPRDHNITLC 180
           K L DS   N H+ +     +   E+N +E + L+  N+ ++  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 6/103 (5%)

Query: 71  VPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTV 129
            PP     N  I   K S+++   LM +  Y+  L++  P        T HR  L    +
Sbjct: 46  APPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 130 AAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           AAK L DS   N H+A+   G +   E+N +E + L+  ++ +
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDV 145

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 69  SKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSL--TAHRFLLTA 126
           SK+P   S+  +  +L +++++    L+T+  Y+  LQ   P    N L  T HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 127 TTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             ++AK   DS   N H+A+   G     ++N++E   L  +N+ I
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDI 154

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 69  SKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTAT 127
           SK+P   S+ ++  RL + +++    L+ +  Y++ L+   P D +    T HR  L   
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACL 139

Query: 128 TVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
            ++AK   DS   N H+AK   G     ++N++E   ++ +N+ +
Sbjct: 140 ILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDL 184

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 8/103 (7%)

Query: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPD--FTLNSLTAHRFLLTATTV 129
           PP   +  +   L   S+++   LM +  Y+  L+   P   + + S T HR  L    +
Sbjct: 47  PP---LVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLIL 102

Query: 130 AAKGLCDSFSTNAHYAK--VGGVRCHELNILENDFLKRVNYRI 170
           A+K L DS   N H+A+   G ++  E+N +E + L+  ++ I
Sbjct: 103 ASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNI 145

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+ ++  RL + +++    L+T+  Y++ L+   P D +    T HR  L    ++AK  
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLILSAKFH 110

Query: 135 CDSFSTNAHYAKVGG--VRCHELNILENDFLKRVNY 168
            DS   N H+AK         ++N++E   ++ +N+
Sbjct: 111 NDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D T    T HR  L    ++AK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL  ++++    L+T+  Y++ L+   P + +    T HR  L    ++AK  
Sbjct: 46  SLQTFITRLVNYTNVPSGTLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYN 105

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILENDFLKRVNYRIIPRDHNI 177
            DS   N H+      + C +++N++E   LK +N+ +   +H++
Sbjct: 106 NDSSPLNIHWMNHTNDLFCLNDINLMERQLLKLLNWDLSITEHDL 150

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLT 125
           Y  ++P   S+  +   L +++++    L+T++ Y++ L+   P D T    T HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 126 ATTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILE 159
              ++AK   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 69/175 (39%), Gaps = 8/175 (4%)

Query: 2   ETSVREHSEGIHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQ 61
           E  +R  S  +  ++ IPK+   ++    S+    + +   L   I  N N+     +D 
Sbjct: 291 EKELRRISLLLDHYESIPKIPELSDDEALSKFRENIELILQLSKKINDNANTLAISSEDP 350

Query: 62  ITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDF--------T 113
                +  K PP++S  ++  R+         V + + Y + L+     +          
Sbjct: 351 QKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAK 410

Query: 114 LNSLTAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNY 168
           L    AHR +++   +A K L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 411 LQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 465

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMT-SLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134
           SI  +  RL +++++    L+T ++Y   L      D T    TAHR  L    ++AK  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILENDFLK------RVNYRIIPRD 174
            DS   N H+ K   G     ++N++E   L+      RV +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D      T+HR  L    ++AK  
Sbjct: 59  SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTSHRIFLACLILSAKFH 118

Query: 135 CDSFSTNAHYAK-VGGVRCHE-LNILE 159
            DS   N H+A    G+ C E +N++E
Sbjct: 119 NDSSPQNKHWAAYTDGLFCLEDVNLME 145

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKG 133
           +S+ ++   L + S+++   LM +  Y+  L++  P D      T HR  +    +AAK 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 134 LCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
           L DS   N H+     G     ++N +E + L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 118 TAHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCH--ELNILENDFLKRVNYRI 170
           T HR  L    ++AK L DS   N H+AK      H  E+N +E + L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 118 TAHRFLLTAT---TVAAKGLCDSF-----STNAHYAKVGGVRCHELNILENDFLKRVNYR 169
           T   FLL AT   TV     C  F     + N    ++ G    + N+++NDF +R N +
Sbjct: 41  TKQPFLLPATELSTVQWSRGCRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNVQ 100

Query: 170 IIPRDHNI 177
           + P++H++
Sbjct: 101 VEPKEHSL 108

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T+  Y++ L+   P D      T HR  L    ++AK  
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYH 146

Query: 135 CDSFSTNAHYAK-VGGVRC-HELNILE 159
            DS   N H+A    G+ C  ++N++E
Sbjct: 147 NDSSPQNKHWAAYTDGLFCLDDVNLME 173

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYP-DFTLNSLTAHRFLLTATTVAAKGL 134
           S+  +  RL +++++    L+T++ Y++ L+   P D      T HR  L    ++AK  
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLIISAKFH 118

Query: 135 CDSFSTNAHYAKV--GGVRCHELNILE 159
            DS   N H+ +   G     ++N++E
Sbjct: 119 NDSSPLNKHWTRYTDGLFSLEDINLME 145

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN-SLTAHRFLLTATTVAAKGLCDSF 138
           +  +L +++ +    L+ ++ Y++ L+   P        T HR  L    ++AK   DS 
Sbjct: 59  FICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNHNDSS 118

Query: 139 STNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             N H+ K   G     ++N++E   L  +N+ +
Sbjct: 119 PLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 13/111 (11%)

Query: 70  KVP-PNISIFNYFIRLTKFS-SLEHCVLMTSLYY------IDLLQTAYPDFTLNSLTAHR 121
           KVP    SI  Y + + K S S  + V++ S Y+      + L Q   P+F      + R
Sbjct: 80  KVPNEKSSIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVH---CSKR 136

Query: 122 FLLTATTVAAKGLCD-SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171
             L+   ++ K L D +FS  A ++ + G+   +L+ILE   L R+NY ++
Sbjct: 137 IFLSCLILSHKFLNDKTFSMKA-WSLISGISKRDLSILERWCLMRLNYHLV 186

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 15/134 (11%)

Query: 67  YHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLY----YIDL-LQTAYPDFTL-NSLT-- 118
           +  K  P +SI  Y  R+    S    + +T+ +    Y D+   T    F L N +T  
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 119 -AHRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNI 177
             HR L+    +AAK L D   ++++++KV G+    L+ LE      +N  +I +D   
Sbjct: 452 MTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLE------LNLVLILQDTQD 505

Query: 178 TLCSIEQKQKKFVA 191
            L   E   K  +A
Sbjct: 506 GLLITELSIKTVLA 519

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 5/117 (4%)

Query: 57  KPDDQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLN- 115
           K +  I + + +S  P  +S+F     L   S ++   LM +  Y+D L    P      
Sbjct: 37  KTNSMIKIKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGI 94

Query: 116 SLTAHRFLLTATTVAAKGLCDSFSTNAHYAKV--GGVRCHELNILENDFLKRVNYRI 170
             T HR  L    +++K L DS   N H+ K   G +   E+N +E + L   N+ I
Sbjct: 95  ETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY--------PDFTLNSLTAHRFLLTAT 127
           S+ ++   +TK S  +  +L+ + YY   L T+         P+F   +  A R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 128 TVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRD 174
            +A K L DS  +   ++ + G+    L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAY------PDFTLNSLTAHRFLLTATTV 129
           SI N+   +TK + +   +L+ +  Y D L  ++      P+F   +    R LL    +
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEF---AYCGKRLLLVCIIL 128

Query: 130 AAKGLCD-SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIT 178
           A K   D +FS    + +V G+    + I+E   LK++NY +   +  +T
Sbjct: 129 AHKFSNDITFSMRV-WTQVSGLPTRSIAIMERWCLKQLNYGLTVTNEAMT 177

>NCAS0D01640 Chr4 (309081..311141) [2061 bp, 686 aa] {ON} Anc_5.117
           YLR047C
          Length = 686

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 148 GGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPGSFDLDSYS 205
           G VR   + I+EN+FLKR  +++IP  H  T+ S+       +  +N  G+F L S S
Sbjct: 306 GHVR---IQIVENNFLKRWFHKLIPLQHPYTISSLPTDDTVKLIIRN--GNFPLKSNS 358

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 70  KVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYI-DLLQTAYPD------FTLNSLTAHRF 122
           K  P++S   Y  R+         V +T+ Y + +L  T   D      F L     HR 
Sbjct: 371 KSSPSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRI 430

Query: 123 LLTATTVAAKGLCDSFSTNAHYAKVGGV 150
           ++ +  +AAK L D   ++A+++KV GV
Sbjct: 431 IIASIRLAAKLLEDFVHSHAYFSKVCGV 458

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,644,356
Number of extensions: 1459109
Number of successful extensions: 4658
Number of sequences better than 10.0: 120
Number of HSP's gapped: 4755
Number of HSP's successfully gapped: 122
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)