Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1606.27ON32732717320.0
Smik_15.1686.27ON32732716430.0
YOL002C (IZH2)6.27ON31731715900.0
Suva_15.1736.27ON32732714970.0
SAKL0E01474g6.27ON31127910441e-142
KNAG0M012406.27ON31427710251e-139
NCAS0H015106.27ON31328910041e-136
TDEL0G044206.27ON3223169921e-134
CAGL0E02519g6.27ON3152789901e-134
KAFR0G026506.27ON3213179741e-132
TBLA0E030606.27ON3193179541e-129
NDAI0F017406.27ON3133109511e-128
Ecym_30316.27ON3283119271e-124
KLTH0C11044g6.27ON3153099211e-124
ZYRO0C07612g6.27ON3192759191e-123
Kwal_56.224546.27ON3153089111e-122
TPHA0M002906.27ON3273099021e-121
Kpol_1032.96.27ON3182758941e-119
KLLA0D01331g6.27ON3083098881e-119
ACL002C6.27ON3292738711e-116
SAKL0C09218g3.90ON3143027045e-91
YDR492W (IZH1)3.90ON3163096961e-89
TDEL0D053403.90ON3163146932e-89
KLTH0C09504g3.90ON3193086932e-89
Skud_4.7663.90ON3163096933e-89
CAGL0G04631g3.90ON3163106899e-89
Suva_2.6683.90ON3153126863e-88
TPHA0A006403.90ON3273116856e-88
Smik_4.7693.90ON3162876821e-87
NDAI0A071603.90ON3303166831e-87
ZYRO0B06556g3.90ON3183076794e-87
NCAS0I025703.90ON3143146663e-85
Kwal_56.227043.90ON3202996673e-85
AFR337W3.90ON3173006584e-84
Ecym_35883.90ON3052776532e-83
KLLA0C12441g3.90ON3153106507e-83
Kpol_1053.263.90ON3243186491e-82
KAFR0A081303.90ON3193086264e-79
TBLA0B022903.90ON3263106186e-78
KNAG0K021603.90ON3233175882e-73
TBLA0B082553.90ON2962843731e-41
NCAS0C049203.90ON3263233192e-33
NDAI0G043003.90ON3183022893e-29
CAGL0I07491g3.90ON3012952069e-18
Suva_15.643.90ON3123111892e-15
Skud_12.915.197ON5422381833e-14
NDAI0I023305.197ON5782401823e-14
KLLA0F15510g5.197ON6222851824e-14
NCAS0D026005.197ON5432371727e-13
KAFR0J006705.197ON5092911728e-13
Smik_12.865.197ON5422341728e-13
Suva_10.1045.197ON5412381701e-12
Skud_15.533.90ON3123181635e-12
KNAG0B051005.197ON5382451621e-11
YLR023C (IZH3)5.197ON5432341612e-11
TPHA0E031205.197ON5692421612e-11
AAL153C5.197ON4193421584e-11
Smik_15.563.90ON3123161547e-11
ZYRO0B10538g5.197ON5312391504e-10
YOL101C (IZH4)3.90ON3122101451e-09
Kpol_2002.945.197ON5772381433e-09
Kwal_33.151225.197ON5662471372e-08
KLTH0B03498g5.197ON5462781362e-08
TDEL0E043205.197ON4502431292e-07
Ecym_71095.197ON5682391273e-07
SAKL0G12980g5.197ON5632521264e-07
TBLA0C060505.197ON4372441247e-07
CAGL0D03322g5.197ON5452381212e-06
KNAG0K006703.90ON3212071023e-04
KLTH0D09174g2.171ON1117108750.92
Kwal_56.228363.154ON613124722.0
CAGL0H10516g2.319ON88034702.9
KLLA0B02541g4.288ON510106703.1
TDEL0G024902.319ON85034686.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.160
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   671   0.0  
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   637   0.0  
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   617   0.0  
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   581   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   406   e-142
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   399   e-139
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   391   e-136
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   386   e-134
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   385   e-134
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   379   e-132
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   372   e-129
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      370   e-128
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   361   e-124
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   359   e-124
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   358   e-123
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   355   e-122
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   352   e-121
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   348   e-119
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   346   e-119
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   340   e-116
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   275   5e-91
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   272   1e-89
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   271   2e-89
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   271   2e-89
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   271   3e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   270   9e-89
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   268   3e-88
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   268   6e-88
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   267   1e-87
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   267   1e-87
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   266   4e-87
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   261   3e-85
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   261   3e-85
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   258   4e-84
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   256   2e-83
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   254   7e-83
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   254   1e-82
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   245   4e-79
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   242   6e-78
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   231   2e-73
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             148   1e-41
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   127   2e-33
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    115   3e-29
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    84   9e-18
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    77   2e-15
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    75   3e-14
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     75   3e-14
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    75   4e-14
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    71   7e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    71   8e-13
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    71   8e-13
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    70   1e-12
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    67   5e-12
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    67   1e-11
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    67   2e-11
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    67   2e-11
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    65   4e-11
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    64   7e-11
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    62   4e-10
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    60   1e-09
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    60   3e-09
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    57   2e-08
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    57   2e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    54   2e-07
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    54   3e-07
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    53   4e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    52   7e-07
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    51   2e-06
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    44   3e-04
KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} simil...    33   0.92 
Kwal_56.22836 s56 (296883..298724) [1842 bp, 613 aa] {ON} YOL066...    32   2.0  
CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]...    32   2.9  
KLLA0B02541g Chr2 complement(221104..222636) [1533 bp, 510 aa] {...    32   3.1  
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    31   6.5  

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR
Sbjct: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120
           DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT
Sbjct: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180
           TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY
Sbjct: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180

Query: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV
Sbjct: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327
           IASFCHLRGLLNSYELVHLKMEGKIVS
Sbjct: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/327 (93%), Positives = 318/327 (97%)

Query: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           MM + KE FQMSTLLERTKSVQELKKRAAGKT ANPAEVAEAKKVLKRLYSWDEIPEWQR
Sbjct: 1   MMHVRKESFQMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQR 60

Query: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120
           DND+ILHGYVRET SF+ETFKSLFY+HNESVNIYSHL+PALGFFTVLLLDKSTIKVFETT
Sbjct: 61  DNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETT 120

Query: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180
           TWKDH++IDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSM SIL+
Sbjct: 121 TWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILF 180

Query: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYYEKFSLFCLFALITVSFG+ACSIV+LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LYCY+FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV
Sbjct: 241 LYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300

Query: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327
           IAS CHLRGLLNSYELVH+KME  I+S
Sbjct: 301 IASLCHLRGLLNSYELVHIKMESGIIS 327

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/317 (93%), Positives = 309/317 (97%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           MSTLLERTKSVQELKKRAAGKT ANPAEVA+AKKVL+RLYSWDEIPEWQRDND+ILHGYV
Sbjct: 1   MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV 60

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDL 130
           +ET SF+ETFKSLFY+HNESVNIYSHLIPALGFFTVLLLDKSTIKVF TTTW DHM+IDL
Sbjct: 61  KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL 120

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190
           FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSM SILYYGY+EKFSLF
Sbjct: 121 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF 180

Query: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250
           CLFALITVSFGIACSIV+LKDKFRKREWRPYRAGLFVCFGLSSI+PIFSGLYCY+FSEIW
Sbjct: 181 CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW 240

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310
           TQIQLFWVLLGGVLYIIGAVLYGMRFPEK+CPGKFDIWGHSHQLFHFLVVIA+ CHLRGL
Sbjct: 241 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL 300

Query: 311 LNSYELVHLKMEGKIVS 327
           LNSYELVH+KME  IVS
Sbjct: 301 LNSYELVHIKMENGIVS 317

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/327 (87%), Positives = 306/327 (93%)

Query: 1   MMLIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQR 60
           M+ I KE F+MSTLLERT SVQELKKRAAG T ANPAEVA+AKKVLKR+YSWDEIPEWQR
Sbjct: 1   MIHIRKEAFEMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQR 60

Query: 61  DNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETT 120
           DNDYILHGYV+ET SFV+TFKSLFYMHNESVNIYSHLIPA+GF TVLLLDK+TI VFETT
Sbjct: 61  DNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETT 120

Query: 121 TWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILY 180
           TW DHM+IDLF++GAFACLILSSSFHC KSHSL+IATLGNKLDYLGICILIVTSM SILY
Sbjct: 121 TWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILY 180

Query: 181 YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240
           YGYY+KF  FCLFALITVSFGIACSIV+LKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG
Sbjct: 181 YGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSG 240

Query: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           LY Y+FSEIW QIQLFWVLLGG LYIIGAVLYGMRFPEKV PG+FDIWGHSHQLFHFLVV
Sbjct: 241 LYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVV 300

Query: 301 IASFCHLRGLLNSYELVHLKMEGKIVS 327
           IAS CH+RG+LNSYELVH+KM+  IVS
Sbjct: 301 IASLCHMRGVLNSYELVHIKMQNGIVS 327

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  406 bits (1044), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 231/279 (82%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALG 102
           KK ++RLYSW+EIP+WQ+DN++I HGYVRET SF+  F SLFYMHNESVNIY+HL+P L 
Sbjct: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89

Query: 103 FFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162
           FF V+L DK  IKVF+TTT+ D++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149

Query: 163 DYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222
           DYLGI  LIV+SM SI+YYG+++    F  F+ +T+ FGIAC+I +L D FR REWRPYR
Sbjct: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209

Query: 223 AGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE++ P
Sbjct: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269

Query: 283 GKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321
           GKFDIWGHSHQ+FH LVVIA+ CHL+ +LNSYELVH K+
Sbjct: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  399 bits (1025), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 229/277 (82%)

Query: 42  AKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPAL 101
            KK+ KR+Y+W+EIPEWQ+DN++I+ GYVRET SF++   SLFY+HNESVN+YSHLIPAL
Sbjct: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88

Query: 102 GFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 161
            FF+VL L+K  +K FETT+  D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148

Query: 162 LDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPY 221
           LDYLGI +LIVTSM SILYYG+Y+   +F  F+ +T+SFG AC +V+LKD FR REWRPY
Sbjct: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208

Query: 222 RAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC 281
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268

Query: 282 PGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
           PGK+DIWGHSHQ+FH LVV+A+ CHL+GL+ SYELVH
Sbjct: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  391 bits (1004), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/289 (62%), Positives = 228/289 (78%), Gaps = 2/289 (0%)

Query: 35  NPAEVAEAKKV--LKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVN 92
           +   +   KK   +++LY+WDEIPEWQ+DN++I+ GYVRET SF   F SLFY+HNE+ N
Sbjct: 25  DNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGN 84

Query: 93  IYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHS 152
           +YSHL+P + FF  +L DK  I  FETTT+ D++II+LF+ GAF CLILSS+FHC KSHS
Sbjct: 85  VYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHS 144

Query: 153 LRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDK 212
           L+IAT GNKLDYLGI +LIVTSM SIL+YG+Y+    F  F+L+T+SFG AC+IV+LKDK
Sbjct: 145 LKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDK 204

Query: 213 FRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLY 272
           FR REWRPYRAGLFV FGLS+++PI +G+  Y   E WT+IQL WV+L GV YI GA LY
Sbjct: 205 FRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLY 264

Query: 273 GMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321
           G+RFPEK   G FDIWGHSHQ+FH LVV+A+FCHL+ LL SYELVH+ +
Sbjct: 265 GIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  386 bits (992), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 236/316 (74%), Gaps = 4/316 (1%)

Query: 6   KEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYI 65
           K+  Q S   ++T +V   K+  +G       +    KK  ++LY+WDEIP WQRDN++I
Sbjct: 6   KKRSQCSLTTDQTSTVT--KEETSGPVKGQKTDKMSKKK--RKLYTWDEIPHWQRDNEHI 61

Query: 66  LHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDH 125
           L GYV ET S  + F SLFY+HNESVNIY+HL+P + F  VL  DK  +  FETTT  D+
Sbjct: 62  LSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDY 121

Query: 126 MIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYE 185
           ++IDLF   +F CL LSS FHCLK+HS  +AT GNKLDYLGI +L+VTSM SI+YYG++E
Sbjct: 122 VMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFE 181

Query: 186 KFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYT 245
             +LF LF+ IT +FG AC++V+LK+ FR REWRPYRA +FV FGLS+++PI +G++ Y 
Sbjct: 182 TPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYG 241

Query: 246 FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFC 305
           FSEI+ +IQ+ WVLLGG+ YI GAVLYG+RFPEK  PGK+DIWGHSHQLFH LVV+A+ C
Sbjct: 242 FSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALC 301

Query: 306 HLRGLLNSYELVHLKM 321
           HL GL+ SY LVHLKM
Sbjct: 302 HLYGLIKSYNLVHLKM 317

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 174/278 (62%), Positives = 224/278 (80%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALG 102
           K V+++LY+W+EIPEWQ+DN++I  GYVRET S +E  +SLFY+HNE+VNIYSHLIPA+ 
Sbjct: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91

Query: 103 FFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162
           FF+ +  +K  +  + TTT  D++IID+F+ GAF+CLILSS+FHCLKSHSLR+A  GNKL
Sbjct: 92  FFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKL 151

Query: 163 DYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222
           DYLGI  LIV SM SILYYG++     F +F+LIT++FG AC++V+LKD FR REWRPYR
Sbjct: 152 DYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211

Query: 223 AGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282
           A LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+ P
Sbjct: 212 AALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSP 271

Query: 283 GKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLK 320
           G FD+WGHSHQ+FH LVV+A+ CHL+ LL SY LVH +
Sbjct: 272 GSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 183/317 (57%), Positives = 238/317 (75%), Gaps = 7/317 (2%)

Query: 3   LIAKEPFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDN 62
           +I+  P + +  +    + Q++ ++  G+T      +   +K+++ LY+W+EIP+WQ+DN
Sbjct: 1   MISSRPKRSTRKVTIDTAFQDVVEQNKGET------IRSLEKIIQ-LYNWNEIPDWQKDN 53

Query: 63  DYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTW 122
           ++I+ GYV+ET SF    +SLFY+HNESVN+YSHLIPA+ F    LL+K+ +  F TTT 
Sbjct: 54  EHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTV 113

Query: 123 KDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYG 182
            D++ IDLF+ GAF CLILSS+FHC KSHSLRIAT GNKLDYLGI +LI TSM S+LYYG
Sbjct: 114 LDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYG 173

Query: 183 YYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLY 242
           +Y+  SLF +FA IT+SFG+AC+ V+LKDKFR RE R YRA LFVCFGLS+++P+  GLY
Sbjct: 174 FYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLY 233

Query: 243 CYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIA 302
            Y F   W +IQL WVLL GV YI GA LYG+RFPEK  PGK+DIWGHSHQLFH LVVIA
Sbjct: 234 HYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIA 293

Query: 303 SFCHLRGLLNSYELVHL 319
           + CH + L+ SYE VH+
Sbjct: 294 ALCHFKALMCSYEHVHM 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 229/317 (72%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           M T ++R K     ++        N  ++  +    KRLY+WDEIP WQ DN+YI  GYV
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYV 60

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDL 130
           RET S  E+F SLFY+HNESVNIY+HLIPA  F ++LL +   +K   TTT+ D++ IDL
Sbjct: 61  RETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDL 120

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190
           F+ GAF CL LSS+FHC KSHSL+I+  GNKLDYLGI ILI TS+ S+LY+GY++   +F
Sbjct: 121 FFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIF 180

Query: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250
            +F+ IT+ FGIAC I +LKDKFR REWRPYRA LFV FGLS ++PI +G+  Y   E++
Sbjct: 181 YIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVF 240

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310
            ++QL W++  GVLYI GA LYG RFPEK  PGK DIWG SHQ+FH LVVIA+ CHLRGL
Sbjct: 241 ERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGL 300

Query: 311 LNSYELVHLKMEGKIVS 327
           + SYELVH K++ ++ S
Sbjct: 301 IGSYELVHQKLDAQLQS 317

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  370 bits (951), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/310 (56%), Positives = 228/310 (73%), Gaps = 1/310 (0%)

Query: 13  TLLERTKSVQELKKRAAGKTPANPAEVAEAK-KVLKRLYSWDEIPEWQRDNDYILHGYVR 71
           T+ +R  +              N   + + K KV+ +LY WDEIPEWQ+DN++I+ GYVR
Sbjct: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63

Query: 72  ETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLF 131
           ET SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I ++ TT+  D+++IDLF
Sbjct: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123

Query: 132 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFC 191
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM SI+Y+G+++    F 
Sbjct: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFY 183

Query: 192 LFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWT 251
            F+ +T  FG AC+ V+LKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 184 FFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243

Query: 252 QIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLL 311
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+FCHLRGLL
Sbjct: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303

Query: 312 NSYELVHLKM 321
           +SYE+VH ++
Sbjct: 304 SSYEIVHSRL 313

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/311 (54%), Positives = 220/311 (70%), Gaps = 11/311 (3%)

Query: 15  LERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETC 74
           LE +   ++L +  A   P  PA          +L+SW EIPEWQRDN++IL GYV+ET 
Sbjct: 25  LETSVIFEDLNQ--ATTIPLKPAS---------KLFSWHEIPEWQRDNEHILGGYVKETN 73

Query: 75  SFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSG 134
           SF ET  SL Y+HNESVNIY+HLIP + FF VL L+K  I  F+TTTWKD+ IID F+ G
Sbjct: 74  SFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVG 133

Query: 135 AFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFA 194
           AFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+LYYG+Y    +F  F+
Sbjct: 134 AFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFS 193

Query: 195 LITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQ 254
            +T+  G  C++VTL  +FR R WRPYRA +FV FGLSSI+PI + +  Y   E W  +Q
Sbjct: 194 GVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQ 253

Query: 255 LFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSY 314
           L W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIA+ CH + +  SY
Sbjct: 254 LGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSY 313

Query: 315 ELVHLKMEGKI 325
           ELVH ++   +
Sbjct: 314 ELVHFRLNEAV 324

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/309 (54%), Positives = 224/309 (72%)

Query: 10  QMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGY 69
           +   L +R     EL  R   +  +   +    ++  +RLY+WDEIPEWQRDN++I+ GY
Sbjct: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61

Query: 70  VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIID 129
           + ET S  E  KSL Y+HNESVNIY+HL+P   F  V + ++  I+ FETT   D+++ID
Sbjct: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           LF+ G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+ SIL+YG+++    
Sbjct: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F LF+ +T++FG+AC+ V+L +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E 
Sbjct: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
           WT+IQL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+ CHLR 
Sbjct: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301

Query: 310 LLNSYELVH 318
           LL +Y+L H
Sbjct: 302 LLGAYKLFH 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/275 (59%), Positives = 206/275 (74%)

Query: 47  KRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTV 106
           K LY+W+EIP+WQ+DN++I+ GYVRET S  E  +SL Y+HNES+NIY+H +P L F   
Sbjct: 40  KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLAT 99

Query: 107 LLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLG 166
            + DK  IK F+TTTW D+M ID F+ GAF+CLILSS+FHC KSHS R++  GNKLDYLG
Sbjct: 100 CIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLG 159

Query: 167 ICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF 226
           I ILIV SM SILYY +++   LF  F LI   FG++C+I +  D FR REWRPYRAGLF
Sbjct: 160 IVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLF 219

Query: 227 VCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFD 286
           V FGLS+++PI  G+  Y F E WT+IQ+ WV+L G+ YI GA LY +RFPE++ PG FD
Sbjct: 220 VAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFD 279

Query: 287 IWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321
             GHSHQ+FH LVVIA+ CHL  L+NSYELVH  +
Sbjct: 280 FVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 222/308 (72%), Gaps = 13/308 (4%)

Query: 25  KKRAAGKTPA-----------NPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRET 73
           K++A G  P            N + + E  +  +RLY WDEIPEWQ+DN++IL+GY+ ET
Sbjct: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTR--RRLYKWDEIPEWQKDNEHILNGYILET 65

Query: 74  CSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYS 133
            S     KSL Y+HNESVNIY+HLIP   F  + L ++  I+ +ETT   D+++IDLF+ 
Sbjct: 66  KSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFL 125

Query: 134 GAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLF 193
           G F CL++SS+FHC K HSL +A LGNKLDYLGI  L+VTSM SIL+YG+++    F +F
Sbjct: 126 GGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVF 185

Query: 194 ALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQI 253
           + +T+ FG+AC+IV+L DKFR R+WRPYRA LFV FGLS++ P+ +G+  Y F   WT+I
Sbjct: 186 SGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRI 245

Query: 254 QLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNS 313
           QL WV L GV YI+GA+LYG+RFPE+V PG FDIWG SHQLFH LVVIA+ CHLR LL +
Sbjct: 246 QLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGA 305

Query: 314 YELVHLKM 321
           Y+ VH +M
Sbjct: 306 YKWVHSQM 313

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 223/309 (72%), Gaps = 3/309 (0%)

Query: 13  TLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYS---WDEIPEWQRDNDYILHGY 69
           T++  +   +E    A     +N   V    +  ++L +   WD++P+WQ+DN++I  GY
Sbjct: 14  TIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGY 73

Query: 70  VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIID 129
           V+ET SF+  F+SLF++HNESVNIYSH++P L    +LL+D + IK F TTT+ D+ +ID
Sbjct: 74  VKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMID 133

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           LF +GAF+CLILSS+FH LKSHSL +A  GNKLDYLGI ILIVTSM SILYYG+Y+    
Sbjct: 134 LFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYF 193

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F LF+ IT+ FGIAC  V+L +KFR REWRPYRA LFVCFGLS++ P+ +G++ Y   + 
Sbjct: 194 FHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDT 253

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
           + +IQL W++  G  YI GA LY MR+PE++CPG FD+WGHSHQ+FH  VVIA++ H  G
Sbjct: 254 FKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHG 313

Query: 310 LLNSYELVH 318
           LL++YE  H
Sbjct: 314 LLSAYEYAH 322

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  348 bits (894), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 215/275 (78%)

Query: 48  RLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVL 107
           +L +W+ +P+WQ+DN++IL GYV+ET S      SL ++HNESVNI+SHL+PA  F T +
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 108 LLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
           + DK  ++ + TTT KD++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227
            +LIV+SM+SILYYG+Y+   L+  F+ IT +FG++C++V+L ++FR REWRPYRA +FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 228 CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDI 287
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 288 WGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKME 322
           WGHSHQLFH LVV+A+ CHLRGLL SY +VH ++ 
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 219/309 (70%), Gaps = 7/309 (2%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           MST   R +SV   +     +TP     V   +   +R+YSWDEIP+WQ+DN++ILHGYV
Sbjct: 1   MST---RKRSVVTEETALIEETPGTKKTV---RVYERRVYSWDEIPDWQKDNEHILHGYV 54

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALG-FFTVLLLDKSTIKVFETTTWKDHMIID 129
           RET S+ E F SLFY+HNESVNIY+HLIPA+  FF +L      I  + TT+  D+ +I+
Sbjct: 55  RETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMIN 114

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           LF+ G   CL +SS FH +K HSL IAT GNKLDYLGI +LI TSM SIL+YG+++   L
Sbjct: 115 LFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLL 174

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F  FA +T  FG+ C  ++LKDKFR REWRPYRA +FV FGLS++ PI +G   Y   E 
Sbjct: 175 FYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDET 234

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
           W ++QL WV+  GVLYI GA LYG+RFPE++ PGKFDIWGHSHQLFH LVV+A+ CHL+ 
Sbjct: 235 WKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKA 294

Query: 310 LLNSYELVH 318
           L+ SY LVH
Sbjct: 295 LVVSYGLVH 303

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 206/273 (75%)

Query: 46  LKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFT 105
           +  L SWD++P+WQ+DN++IL GYVRET S+ +TF+SLFY+HNESVNIYSHLIP + F  
Sbjct: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108

Query: 106 VLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYL 165
           + L +K  +  + TTTWKD+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+
Sbjct: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168

Query: 166 GICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGL 225
           GI  LI  SM S +YYG+Y+  ++F LF+ +T+S  +AC++V+L   FR REWR YRA +
Sbjct: 169 GIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAI 228

Query: 226 FVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKF 285
           F  FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG F
Sbjct: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288

Query: 286 DIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
           DIWGHSHQLFH LVVIA+ CHLR LL+ Y+ VH
Sbjct: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  275 bits (704), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 193/302 (63%), Gaps = 3/302 (0%)

Query: 19  KSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVE 78
            S   +++R      A+   +A AK   KRL +++E+P+WQ+DN+ IL GYVRET S  E
Sbjct: 2   SSTTTVRQRRKTTQKASAESIATAKG-RKRLCTFEELPDWQKDNELILDGYVRETRSVSE 60

Query: 79  TFKSLFYMHNESVNIYSHLIPALGFFTVL--LLDKSTIKVFETTTWKDHMIIDLFYSGAF 136
            FKSL Y HNE+VNIY+HL+P + +  +L  L D   I  F ++T  D++II+ F  GAF
Sbjct: 61  CFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAF 120

Query: 137 ACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALI 196
            CL+ SS FHCLK HS   + + +K+DY+GI +LI  SM SILYYG+++    F +F ++
Sbjct: 121 VCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVV 180

Query: 197 TVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLF 256
           TV  G  C+   L D+F  + +R +RA  FV FG S +VPI  GL  +  SE   ++QL 
Sbjct: 181 TVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLK 240

Query: 257 WVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYEL 316
           +V L  V YI GAV YG R PE   PGKFD+ GHSHQ+FH +VV+ S CHLR ++ SY  
Sbjct: 241 YVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIF 300

Query: 317 VH 318
           +H
Sbjct: 301 MH 302

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  272 bits (696), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 200/309 (64%), Gaps = 4/309 (1%)

Query: 12  STLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVR 71
           +T      SV     RA+ K  A   +    K+  K L+++DE+PEWQ+DND IL GYVR
Sbjct: 5   TTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQ--KLLHNFDELPEWQKDNDKILTGYVR 62

Query: 72  ETCSFVETFKSLFYMHNESVNIYSHLIPALGFF--TVLLLDKSTIKVFETTTWKDHMIID 129
           ET S+ +   SLFY +NE+VNIY+HL+PA+ +F   + L +   I VF +T+W D+ +I+
Sbjct: 63  ETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           +F  GAF+CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM  I+Y+GY++  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISY 182

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F LF ++T+     C++  L DKF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
             +I++ +V    + YI GAV+YG R PE + PGKFD +G SHQ+FH +VV+ S CHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKA 302

Query: 310 LLNSYELVH 318
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  271 bits (693), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 138/314 (43%), Positives = 200/314 (63%), Gaps = 12/314 (3%)

Query: 12  STLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVR 71
           +T+ +R  +VQE +K          A  ++   + K+LY ++E+PEWQ+DND IL GYVR
Sbjct: 5   TTIRQRKTTVQETQK----------ARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVR 54

Query: 72  ETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHMIID 129
           ET S +    SL Y +NESVNIY+HL+ A+ +F +LL   D   I  F +TT  D++II+
Sbjct: 55  ETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIIN 114

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
            +  GAF CL+ SS FHC K HS   +   +K+DY+GI  LI  S+ S+LYYGY++    
Sbjct: 115 FYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFY 174

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F LF++ITV   +ACS+  L D+F   + RP RA  F+ F  SS++PI +G++ + ++E+
Sbjct: 175 FKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEV 234

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
           + ++QL +V      Y+ GA+LYG R PE + PGKFD  G SHQLFH LVV+ SFCHLR 
Sbjct: 235 FHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRA 294

Query: 310 LLNSYELVHLKMEG 323
           ++ SY  +H  +  
Sbjct: 295 VMGSYMFMHAHINA 308

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  271 bits (693), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 187/308 (60%), Gaps = 10/308 (3%)

Query: 13  TLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRE 72
           TL +R +     K +A       P +          L  ++E+P+WQRDND IL GYVRE
Sbjct: 6   TLRQRRQQCAPNKGKAGTSGATAPGK--------NGLCCFEELPDWQRDNDKILAGYVRE 57

Query: 73  TCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHMIIDL 130
           T S  + F+SL Y HNE+VNIY+HLIP+  +  +L+   D   I  F TTT  D+++I+ 
Sbjct: 58  TNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINF 117

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190
           F  GAF CL+ S+ FHCLK HS   + + +K+DY+GI +LI  S  S+LYYG+Y+    F
Sbjct: 118 FLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHF 177

Query: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250
            +F +  V  G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E  
Sbjct: 178 KMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESS 237

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310
            ++QL +VLL  + YI GAV+YG R PE + PGKFD  GHSHQ+FH LVV+ S CH R L
Sbjct: 238 KRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRAL 297

Query: 311 LNSYELVH 318
           L SY  +H
Sbjct: 298 LGSYFFMH 305

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  271 bits (693), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 200/309 (64%), Gaps = 4/309 (1%)

Query: 12  STLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVR 71
           +T     +SV      A+ K  A  ++ A  K+  K L+++DE+PEWQ+DND IL GYVR
Sbjct: 5   TTRRRNQESVCCKATTASIKVEAVQSKTASEKE--KLLHNFDELPEWQKDNDKILTGYVR 62

Query: 72  ETCSFVETFKSLFYMHNESVNIYSHLIPALGFF--TVLLLDKSTIKVFETTTWKDHMIID 129
           ET S+ +  +SLFY +NE+VNIY+HL+PA+ +F   + L +   I VF +T+W D+ +I+
Sbjct: 63  ETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVIN 122

Query: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           +F  GAF+CL+ SS FHCLK HS   +   +KLDYLGI  LI  SM  I+Y+GY++  S 
Sbjct: 123 IFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSY 182

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249
           F LF  +T+     C++  L +KF    +RP+RA  F+ FG S ++P+ +G + +    +
Sbjct: 183 FSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGV 242

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309
             +I++ +V    + YI GAV+YG R PE + PGKFD  G SHQ+FH +VV+ S CHL+ 
Sbjct: 243 LNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKA 302

Query: 310 LLNSYELVH 318
           +++SY+L+H
Sbjct: 303 IIDSYKLMH 311

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  270 bits (689), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 198/310 (63%), Gaps = 8/310 (2%)

Query: 12  STLLER-TKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           +TL +R +KSV E   R  G   A+  E +E     K L+ ++E+PEWQ+DND IL GYV
Sbjct: 5   TTLRKRASKSVGESGGRNDGSIHAHGEEKSE-----KLLWHFNELPEWQKDNDKILRGYV 59

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGF--FTVLLLDKSTIKVFETTTWKDHMII 128
           RET SF    +SL Y++NESVNIY+HLIPA+ +   ++ L +   I V+ +T+  D++II
Sbjct: 60  RETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVII 119

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFS 188
           ++F+ GAF CL+ SS FHC+K HS     + +KLDYLGI  LI  S   ++YYGY++  S
Sbjct: 120 NVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHIS 179

Query: 189 LFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSE 248
            F +F  IT+   I CS+  L DKF   E+RP RA  F  FG S I+P+ +G   +    
Sbjct: 180 EFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEG 239

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLR 308
           +  +I L ++ L  + YI GA++YG RFPE + PGKFD +G SHQ+FH +VV+ S CHL 
Sbjct: 240 VLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLF 299

Query: 309 GLLNSYELVH 318
            ++ SY L+H
Sbjct: 300 AMVESYHLIH 309

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  268 bits (686), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 6/312 (1%)

Query: 11  MSTLLERTKSVQEL--KKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHG 68
           MS    R ++ + +  K   + K  A  ++V   K+  K L+ + E+P+WQRDND IL G
Sbjct: 1   MSITATRRRNQENVCCKTSTSIKVEALKSKVTLRKE--KLLHDFHELPDWQRDNDKILTG 58

Query: 69  YVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFETTTWKDHM 126
           YVRET S+ +   SLFY +NE+VNIY+HL+PA+ +F   V L +   I VF +TTW D+ 
Sbjct: 59  YVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYT 118

Query: 127 IIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEK 186
           +I++F  GAF CL+ SS FHC+K HS + +   +KLDYLGI  LI  SM  I+Y+GY++ 
Sbjct: 119 VINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDH 178

Query: 187 FSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTF 246
            S F LF ++T+     C+I  L DKF    +RP+RA  F+ FG S ++P+ +GL+ +  
Sbjct: 179 ASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGL 238

Query: 247 SEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCH 306
             +  +I++ +V    + YI GA++YG R PE + PGKFD +G SHQ+FH +VV+ S CH
Sbjct: 239 QGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCH 298

Query: 307 LRGLLNSYELVH 318
           L+ +++SY+L+H
Sbjct: 299 LKAIIDSYKLMH 310

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  268 bits (685), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 195/311 (62%), Gaps = 9/311 (2%)

Query: 10  QMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGY 69
           Q S L  R  SV +      G       E+ E     K+LYS+ E+PEWQ+DN+ I+ GY
Sbjct: 13  QSSKLSRRRFSVSK-----NGTVLLESTEIVETYS--KKLYSFHELPEWQKDNELIIQGY 65

Query: 70  VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHMI 127
           VRET S+ + F SL Y HNES+NIY+HLIP L +F +LL   D   +  F +TT  D+++
Sbjct: 66  VRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIV 125

Query: 128 IDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKF 187
           ID +  GAF CL+ SS FHCLK HS   +   +K+DY+GI  LI  S+ S+LYYGY++ F
Sbjct: 126 IDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHF 185

Query: 188 SLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFS 247
             F +F LIT+     C++  L ++F  + +RP RAG FV F  S+++PI +GL  + + 
Sbjct: 186 IYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYV 245

Query: 248 EIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHL 307
           E+  +IQL +V      Y++GA+LYG R PE   PG+FD+ G SHQ+FH +VVI S  HL
Sbjct: 246 EVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHL 305

Query: 308 RGLLNSYELVH 318
           + ++ SYE +H
Sbjct: 306 KAVIGSYEFMH 316

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  267 bits (682), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 192/287 (66%), Gaps = 5/287 (1%)

Query: 34  ANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNI 93
            +   V+E KK+L   +++DE+PEWQ+DND IL GYVRET S+ +   SLFY +NE+VNI
Sbjct: 28  VSSTTVSEKKKLL---HNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNI 84

Query: 94  YSHLIPALGFF--TVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSH 151
           Y+HL+PA+ +F   + L +   I VF +T+W D+ +I++F  GAF+CL+ SS FHC+K H
Sbjct: 85  YTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQH 144

Query: 152 SLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKD 211
           S + +   +KLDYLGI  LI  SM  I+Y+GY++  S F LF ++T+     C++  L +
Sbjct: 145 SEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHE 204

Query: 212 KFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVL 271
           KF    +RP+RA  F+ FG S ++P+ +G + +    +  +I++ +V    + YI GAV+
Sbjct: 205 KFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVI 264

Query: 272 YGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
           YG R PE + PGKFD  G SHQ+FH +VV+ S CHL+ ++ SY+L+H
Sbjct: 265 YGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  267 bits (683), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 202/316 (63%), Gaps = 11/316 (3%)

Query: 12  STLLERTKS-----VQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYIL 66
           +T L R++S     + E        T   P      +K+   L  +DE+PEWQ+DND IL
Sbjct: 13  TTCLLRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKI--HLSKFDELPEWQKDNDKIL 70

Query: 67  HGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFF----TVLLLDKSTIKVFETTTW 122
            GYVRET SF+  F+SLFY++NE++NIY+HLIP++ +     T + ++   I  F TT+ 
Sbjct: 71  TGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSV 130

Query: 123 KDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYG 182
            D+++I++F  GAF CL+LSS FHCLK HS +  TL +KLDY+GI ILI  S+  ILY+G
Sbjct: 131 IDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFG 190

Query: 183 YYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLY 242
           Y+++ S F  F ++T SF I CSI+ L +KF    +RP RAGLF+ F  + ++P+ +G Y
Sbjct: 191 YFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFY 250

Query: 243 CYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIA 302
            + +  +  +I L +VLL  + YIIG +LYG R PE   PG FD++G SHQ+FH  VV+ 
Sbjct: 251 IFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLG 310

Query: 303 SFCHLRGLLNSYELVH 318
           S CH   ++ SY L+H
Sbjct: 311 SICHFGAVIKSYCLMH 326

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  266 bits (679), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 195/307 (63%), Gaps = 2/307 (0%)

Query: 19  KSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVE 78
            S+ E+K+R       N   + +     K LY + E+PEWQ+DND IL GY+RET S ++
Sbjct: 2   SSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLK 61

Query: 79  TFKSLFYMHNESVNIYSHLIPALGFFTVLL--LDKSTIKVFETTTWKDHMIIDLFYSGAF 136
             +SLF  +NE+VNIY+HL+ A+ +F ++L   D   +  F T+T+ D+ +I+ +  GAF
Sbjct: 62  CVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAF 121

Query: 137 ACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALI 196
            CL+ SS FH  K HS   +   +K+DY+GI +LI  SM S++YYG+++    F LF ++
Sbjct: 122 GCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVL 181

Query: 197 TVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLF 256
           T++   AC++  L DKF  +++RP RAG F+ FGLS + P+ +G+  +       ++QL 
Sbjct: 182 TLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLK 241

Query: 257 WVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYEL 316
           ++ L  + YI GA++YG R PE + PG+FD WGHSHQ+FH LVVIASF HL+ ++ SY  
Sbjct: 242 YLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIF 301

Query: 317 VHLKMEG 323
            H  + G
Sbjct: 302 KHSHLNG 308

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  261 bits (666), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 194/314 (61%), Gaps = 2/314 (0%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           MS +    +   +++  A G +  +       +   +RL++++E+PEWQRDND IL GYV
Sbjct: 1   MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYV 60

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFETTTWKDHMII 128
           RET SF +  +SL Y +NE++NIY+HLIPAL + T  V L++   +  F TT+  D+ +I
Sbjct: 61  RETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVI 120

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFS 188
           ++F  GAF CLILSS FHCLK HS R  TL +KLDY+GI ILI  S+  ++Y+GY++   
Sbjct: 121 NVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLY 180

Query: 189 LFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSE 248
               F ++T SF   CSI  L +KF    +RP+RA +F+ F  S  +PI +G Y + F  
Sbjct: 181 YVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHG 240

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLR 308
           ++ ++ L +V    + YI GA LYG R PE   PG FD  G SHQ+FH LVV+ S CH R
Sbjct: 241 VFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFR 300

Query: 309 GLLNSYELVHLKME 322
            ++ SY L+H  M 
Sbjct: 301 AVIKSYILMHSSMN 314

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  261 bits (667), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 190/299 (63%), Gaps = 6/299 (2%)

Query: 25  KKRAAGKTPANPAEVAEAKKVLKR--LYSWDEIPEWQRDNDYILHGYVRETCSFVETFKS 82
           ++R+A K      + +++ +  K+  L  ++E+PEWQRDN+ IL GYVRET S  +  +S
Sbjct: 9   QRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLES 68

Query: 83  LFYMHNESVNIYSHLIPALGFFTVLLL---DKSTIKVFETTTWKDHMIIDLFYSGAFACL 139
           L Y HNE++NIY+HLIP+ G + VLL+   D   I  F +TT  D+++I+ +  GAF CL
Sbjct: 69  LTYFHNETLNIYTHLIPS-GTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCL 127

Query: 140 ILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVS 199
           + S+ FHCLK HS   + + +K+DY+GI +LI  S  S+LYYG+++    F +F +  V 
Sbjct: 128 LCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVV 187

Query: 200 FGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVL 259
            G  C+   L D+F  + WR  RAG FV FG S IVPI  GL  +  +E   ++QL +VL
Sbjct: 188 LGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVL 247

Query: 260 LGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
           L    YI GA++YG R PE + PGKFD  GHSHQ+FH LVV+ S CH R L+ SY  +H
Sbjct: 248 LEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMH 306

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  258 bits (658), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 186/300 (62%), Gaps = 8/300 (2%)

Query: 17  RTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSF 76
           + +++ E+ +  A  T          KK +++LY++DE+P WQ+DN+ IL GYVRET S 
Sbjct: 8   KEQTISEMAQEMAHTTSEG------LKKRIRKLYTFDELPAWQKDNELILSGYVRETNSV 61

Query: 77  VETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHMIIDLFYSG 134
            E  +++ Y +NES+NIY+HLIP + +  + L+  D    ++       +H ++  +  G
Sbjct: 62  KECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLG 121

Query: 135 AFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFA 194
           AF CL  SS FHCLK HS   + L +K+DYLGI   I  S  S+LYYGY+   S F  F+
Sbjct: 122 AFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFS 181

Query: 195 LITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQ 254
            +TV+   AC+++ L D F    +RP RA LF+ FGLS ++P+ +G Y + F+E   +IQ
Sbjct: 182 TLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQ 241

Query: 255 LFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSY 314
           L +VL   V YI GA++YG R PE+  PGKFD+ GHSHQ+FH LVV+ + CH R +  SY
Sbjct: 242 LKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  256 bits (653), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 181/277 (65%), Gaps = 2/277 (0%)

Query: 40  AEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIP 99
              K   +RLYS+DE+PEWQ+DN+ I  GYVRET SF+E  KS+ Y +NESVNIY+HL+P
Sbjct: 13  GHKKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVP 72

Query: 100 ALGFF--TVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIAT 157
           ++ +F   +L +D     +F  TT +++++ID +  G F CL+ S+ FHCLK HS     
Sbjct: 73  SVTYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNR 132

Query: 158 LGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKRE 217
           + +K+DY+GI + I +S+ SILYYG+Y+  S     +++T++ G+ C    L D+F   +
Sbjct: 133 IWSKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAID 192

Query: 218 WRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFP 277
           +R  RA  F  FG S +VP+  G+Y +   E   +IQL +VL G + YI GA++YG R P
Sbjct: 193 YRLLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIP 252

Query: 278 EKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSY 314
           E + PGKFD  GHSHQ+FH LVV+ S CH R ++ SY
Sbjct: 253 EALAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  254 bits (650), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 188/310 (60%), Gaps = 5/310 (1%)

Query: 15  LERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETC 74
           +  T +++  +  +       P  ++     +KRLY + E+PEWQ+DND I+ GY+RET 
Sbjct: 1   MSATTTIRHRRSISEKLEQLTPVAISST---IKRLYRYSELPEWQQDNDKIITGYIRETK 57

Query: 75  SFVETFKSLFYMHNESVNIYSHLIPALGFFTVL--LLDKSTIKVFETTTWKDHMIIDLFY 132
           S  E  KSLF  HNES+NIYSHL+P + +  +L  L D   +  F  +T    ++I  F 
Sbjct: 58  SVKECVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFL 117

Query: 133 SGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCL 192
            G+  CL  SS FHCLK HS     + +K+DY+GI I+I  S+ S+LYYG+++    F  
Sbjct: 118 LGSVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKC 177

Query: 193 FALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQ 252
           F + TV  G  C++  L DKF  + +RP+RA  +V FGLS IVPI +G + +   E   +
Sbjct: 178 FTVFTVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRR 237

Query: 253 IQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLN 312
           +QL +VLL  + YI GAV+YG RFPE + PGKFD  GHSHQ+FH +VV+ S CH R +L 
Sbjct: 238 VQLKYVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILG 297

Query: 313 SYELVHLKME 322
           SY  +H  M 
Sbjct: 298 SYVFMHTGMH 307

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  254 bits (649), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 195/318 (61%), Gaps = 4/318 (1%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLK--RLYSWDEIPEWQRDNDYILHG 68
           M+ +    +    + KR   K+      +   ++  +  +L  + E+P+WQ+DN++IL G
Sbjct: 1   MAHIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTG 60

Query: 69  YVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHM 126
           YVRET S  +  +SL   +NES+NIYSHLI A+ +F VLL   D   I  F +TT+ D+M
Sbjct: 61  YVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYM 120

Query: 127 IIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEK 186
           +IDL+  GAF CLI SS FHC+K HS   + + +K+DY+GI  LI  S+ S+LYYGY + 
Sbjct: 121 VIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDH 180

Query: 187 FSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTF 246
           F  F +F +IT+     C+I  L  +F  + +RP RAG F+ F +S+++PI +G   + F
Sbjct: 181 FIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGF 240

Query: 247 SEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCH 306
           +E+  +IQL +V      Y++GA+LYG R PE + PG FD+ G SHQ+FH +V++ S  H
Sbjct: 241 TEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFH 300

Query: 307 LRGLLNSYELVHLKMEGK 324
           L+ +L SY  +H  +   
Sbjct: 301 LKAVLGSYTFMHSNISSN 318

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  245 bits (626), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 189/308 (61%), Gaps = 7/308 (2%)

Query: 18  TKSVQELKKRAAGKTPANPAEVAEAKKVLKR-LYSWDEIPEWQRDNDYILHGYVRETCSF 76
           T++ +  K   + K+         + K+ KR LY + E+P WQ+DND IL GYVRET SF
Sbjct: 7   TRTRKRSKSFRSAKSTITRTRSDSSIKIEKRILYHFHELPTWQQDNDKILGGYVRETNSF 66

Query: 77  VETFKSLFYMHNESVNIYSHLIPALGFFTV---LLLDKS---TIKVFETTTWKDHMIIDL 130
            +  +SLFY++NES+NIYSHLIP+L + T+   LL++      I ++ TTT  D + I++
Sbjct: 67  TKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINI 126

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLF 190
           F  GAF CL+ S  FH LK HS       +++DY+GI +LI  SM  +LYYG+++   LF
Sbjct: 127 FLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLF 186

Query: 191 CLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIW 250
             F  +T++F   CSI+ + + F   ++R  RA +F  FG S ++P+  G   +  S ++
Sbjct: 187 YCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVF 246

Query: 251 TQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310
            +I L ++    V Y++GA LYG R PE + PGKFD++G SHQLFH  VVI S  H + +
Sbjct: 247 QRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAV 306

Query: 311 LNSYELVH 318
           + SY L+H
Sbjct: 307 IESYILMH 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  242 bits (618), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 186/310 (60%), Gaps = 19/310 (6%)

Query: 16  ERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCS 75
            R+KS+  +  +AA        E  + K     LY+++E+P WQ+DN+ IL GY+RET S
Sbjct: 18  HRSKSISSILSQAA--------EDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRETNS 69

Query: 76  FVETFKSLFYMHNESVNIYSHLIPA-------LGFFTVLLLDKSTIKVFETTTWKDHMII 128
           +    +SL + HNE++NIYSH I A       + FFT L+   S    F TTT  D++++
Sbjct: 70  WKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPS----FPTTTLHDYLVL 125

Query: 129 DLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFS 188
           D++  GA  CL LSS FHCLK HS   + + +K+DY+GI  LI  S  S+LY+GY + F+
Sbjct: 126 DIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFN 185

Query: 189 LFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSE 248
            F  FA+ T    I C++    +KF  R+W+  RA  F+ F  S ++P+ +G+  + F E
Sbjct: 186 YFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPE 245

Query: 249 IWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLR 308
           +W ++QL  + L  + Y+IGA+LYG R PE   PGKFD  G+SHQ FH  VV+ S  HLR
Sbjct: 246 VWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLR 305

Query: 309 GLLNSYELVH 318
            L+ SY  +H
Sbjct: 306 ALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  231 bits (588), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 183/317 (57%), Gaps = 20/317 (6%)

Query: 22  QELKKRAA--GKTPANPAEVAEAKK---------------VLKRLYSWDEIPEWQRDNDY 64
            EL+KRA   G+T    A V+   +                  RL  ++E+P WQ+DND 
Sbjct: 3   SELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDNDC 62

Query: 65  ILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFT--VLLLDKSTIKVFETTTW 122
           I  GYVRET S      SL Y +NESVN+YSHL+PA+ +     L L +  +  F TTTW
Sbjct: 63  IRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTW 122

Query: 123 KDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYG 182
            D++II+ F  GA ACL+ SS FHCLK HS R     +++DY+GI +LI  S   ++Y+G
Sbjct: 123 SDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFG 182

Query: 183 YYEKFSLFCLFALITVSFGIACSIVTLKDK-FRKREWRPYRAGLFVCFGLSSIVPIFSGL 241
           Y++      LF  +TV+ G+ACS V L +K F    ++  RA  F+ F  + ++P+ +G 
Sbjct: 183 YFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGF 242

Query: 242 YCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVI 301
             +    +  +I L +V    V YI GA+LYG R PE   PGK D+WG+SHQ+FH +VV 
Sbjct: 243 VKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVF 302

Query: 302 ASFCHLRGLLNSYELVH 318
            S CHL+ +L SY L+H
Sbjct: 303 GSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  148 bits (373), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 144/284 (50%), Gaps = 28/284 (9%)

Query: 48  RLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVL 107
           +L +++++P+WQ+DN  I++ YVRET S  ++  S+F  H+ES+NI++HLIPAL      
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL------ 60

Query: 108 LLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
           L  K T     T     + I+  +      C +LSS FH  K  S++      KLDY+GI
Sbjct: 61  LYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREW--------- 218
            +LI  ++ S+   G+ E          +T +  +   ++ L  K   ++          
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 219 ------------RPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYI 266
                       +  RA LF   GLS ++P+ +GLY Y    ++ +I +  V+   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 267 IGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGL 310
           +G ++Y  + PEK  PG+FD+ G SHQLFH  +V  + CH   +
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  127 bits (319), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 161/323 (49%), Gaps = 15/323 (4%)

Query: 11  MSTLLERTK-----SVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRD--ND 63
           M+TL   TK      +Q+  K      P          KVL  L    E+P+WQ+   N 
Sbjct: 1   MATLTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPIL---KELPQWQKQYSNS 57

Query: 64  YILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTT 121
            I++GYVRET S ++   ++ Y +N++VNI  + + +  +FT+LL   D   I     TT
Sbjct: 58  KIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATT 117

Query: 122 WKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYY 181
             D+++++ +  GAF    L+S F+ L+SHSL    L  KL +L     I TS+ + LYY
Sbjct: 118 MSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYY 177

Query: 182 GYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLS-SIVPIFSG 240
            +++    F    + T+      +I TL ++F ++  R  R  + + F +S  I+P  S 
Sbjct: 178 TFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKN-RSQRNMVSITFIVSLLILPTASL 236

Query: 241 LYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV 300
           ++ +    I  +++   +LL   LY+    L  ++ PE+     FD  G+S  ++H  ++
Sbjct: 237 MFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFIGNSENIYHICII 295

Query: 301 IASFCHLRGLLNSYELVHLKMEG 323
           + S  H + LLNSY  +H  ++ 
Sbjct: 296 LGSLLHFKMLLNSYFFMHSGLDA 318

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  115 bits (289), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 152/302 (50%), Gaps = 14/302 (4%)

Query: 28  AAGKTPANPAEVAEAKKVLKRL-----YSWDEIPEWQR--DNDYILHGYVRETCSFVETF 80
             G  P +    ++   V+ +L     Y   E+PEWQR  ++  ++ G+++ET SF +  
Sbjct: 7   TKGGCPNDNYPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCL 66

Query: 81  KSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTTWKDHMIIDLFYSGAFAC 138
            S  Y HN S+NI  + I A  +F +L    D   I  F +TT  D+++++L+   A   
Sbjct: 67  WSTMYWHNSSINISLNGIAATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQN 126

Query: 139 LILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITV 198
            ++ + F+ +KSHS + A L  KL+ +G+   I +S+ ++LYY Y++    F  F ++T+
Sbjct: 127 FMVGTIFYIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTL 186

Query: 199 SF--GIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLF 256
                  CSI++  D F K         L     L +++P    +  +  +++  +I L 
Sbjct: 187 LLITLFTCSIIS--DSFNKMTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLN 244

Query: 257 WVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYEL 316
            ++L   +Y  G  +   + PE+     FD  G+S  ++   +++ SF H + L+NSY L
Sbjct: 245 LIILEIFIYAFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCL 303

Query: 317 VH 318
           +H
Sbjct: 304 MH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 139/295 (47%), Gaps = 24/295 (8%)

Query: 41  EAKKVLKRLYSWDEIPEWQR--DNDYILHGYVRET-CSFVETFKSLFYMHNESVNIYSHL 97
           E K V  ++ + +++P W R   N  I  GY   T  +++   + L   +N+S++IY +L
Sbjct: 2   EKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNL 61

Query: 98  IPAL--GFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGA---FACLILSSSFHCLKSHS 152
           +  L  G   +   D   I    +TT  D++II+LF       FA + L      LK HS
Sbjct: 62  VCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLG---QLLKGHS 118

Query: 153 LRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDK 212
                L N+   L + +L+  S+ ++LYY +++   LF LF + T       SIV + D+
Sbjct: 119 EYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQ 178

Query: 213 FRKREWRPYRAGLFVCFGLSSI-VPIFSGLYCYTFSEIWTQIQLFWVLLGG--VLYIIGA 269
           +++ +    +    V FG+ SI +PI   +  +   + + + ++ + +L    VLY + A
Sbjct: 179 YKRVQ----KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSA 234

Query: 270 VLYGMRFPEKVCPGK------FDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
           +L   R PE             D  G+S Q+   + + A   H   ++ +YE+VH
Sbjct: 235 MLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 141/311 (45%), Gaps = 37/311 (11%)

Query: 19  KSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVE 78
           K+  E    A G   +N A+V E K+  K+ + + ++ +WQ+          +   S  E
Sbjct: 15  KTATEKYSDATGAVTSN-ADV-ETKET-KKGFPFHDLAKWQKQ--------YKNKSSRSE 63

Query: 79  TFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFAC 138
           +  +L Y+   S++ +  LI    F+ + L          TTT  D+++ + +    F  
Sbjct: 64  SLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLLNVFVF 115

Query: 139 LILSSSFHCLKSHSLRI-ATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALIT 197
            ++   +H +K+ SL+    +  K  YL    L+++S  +ILYY +Y+    F +F L+ 
Sbjct: 116 CMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLM 175

Query: 198 VSFGIACSIVTLKDKFRKREWRPYRAGLF------VCFGLSSIVPI--FSGLYCYTFSEI 249
              G+A   V L DK     ++ +   +F      VC  L  +  I  F GL       +
Sbjct: 176 TFIGLAAYFVILTDKL--NSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGL-----ENL 228

Query: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIWGHSHQLFHFLVVIASFCHL 307
             +I+L  +    V  ++ +++Y  RFPE +C    K + W HS   FH L+   +F H 
Sbjct: 229 KDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHF 288

Query: 308 RGLLNSYELVH 318
             L+ SY L+H
Sbjct: 289 FILIQSYILMH 299

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 113/238 (47%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETF-KSLFYM------HNESVNIYSHLIPALGFFTV 106
           ++P   R+N YI+HGY      F  T  KSL  +      HNE+ NI+SHL+ A+    +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYL 273

Query: 107 LLLDKSTIKVFETTT--WKDHMIIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLD 163
            + D    +V+       +   I+ +F + A  C++ S  +H     S LR+ +    +D
Sbjct: 274 AIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVD 333

Query: 164 YLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRA 223
           Y GI ILI  S+ +  +   Y  +   C +  I+++ G+    +    +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRI 393

Query: 224 GLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 279
             F+   L + + + S L+    ++I+   +LF  +     V Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPER 448

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 111/240 (46%), Gaps = 24/240 (10%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           ++P   R+N YI++ Y R   S  ++  S+F     HNES NI++HL+ A+    + + D
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 111 KSTIKVFET----TTWKDHMIIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYL 165
               ++F++    TT K  +I+ LF   A  CL+ S  +H     S L++ +    +DY 
Sbjct: 313 FPNSEIFQSEKVPTTAK--LIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYS 370

Query: 166 GICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGL 225
           GI ILI  S+ +  +   Y  F   C++  I++S G+    +    KF + E RP R   
Sbjct: 371 GITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKF 430

Query: 226 FVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVL------YIIGAVLYGMRFPEK 279
           F+      ++      Y        T +Q    LL  V       Y++G V YG   PE+
Sbjct: 431 FILLASMGVLSFLHLTYL-------TNLQYATWLLTPVTNKSIVWYLVGVVFYGSFIPER 483

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 127/285 (44%), Gaps = 35/285 (12%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIPALGFFTVLLLD 110
           E+P   R+N YI+HGY R   S V++  S+   +  HNE++NI+SHL  A+    +L + 
Sbjct: 303 ELPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAVYLAYLLFIQ 361

Query: 111 KSTIKVF--ETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGI 167
             T KVF  +       +II +F      CL+ SS +H L     L +      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 168 CILIVTSMTSILYYGYYEKFSL-----FCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222
            +LI  S+ S  +   Y   +        ++  +++  GI  S +    +F + E RP+R
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFR 481

Query: 223 AGLFVCF-GLSSI----VPIFSGLYCYT--FSEIWTQIQLFWVLLGGVLYIIGAVLYGMR 275
              +V   GL  I    + I  G+   +  F  +W +  L W       Y+IG V YG  
Sbjct: 482 IAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR-SLIW-------YLIGVVFYGSF 533

Query: 276 FPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLK 320
            PE+        W    +L + +   A  C    +L  ++ VH +
Sbjct: 534 IPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVHFR 570

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 110/237 (46%), Gaps = 18/237 (7%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           ++P   R+N YI++ Y R   S  ++  S+F     HNE+ NI++HLI  L    + + D
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 111 --KSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGI 167
             +S I + +       +I+ LF   A  CL  S  +H      +L++ +    +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227
            ILI  S+ +  +   Y  +   C++  I++S GI    +    KF + E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 228 CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLL-----GGVLYIIGAVLYGMRFPEK 279
              L + + + S L+  TF   W      W+L        V Y IG V YG   PE+
Sbjct: 399 ---LLASMGVLSFLHL-TFLTDWKYAT--WLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 127/291 (43%), Gaps = 31/291 (10%)

Query: 16  ERTKSVQELKKRAAGKTPANPAEVA-EAK------KVLKRLYSWD--------------E 54
           E  K + E K R+   TP    E   EAK      K L +++ +D              +
Sbjct: 138 EDLKDLVEEKFRSISSTPELFFETTKEAKLSSEQIKSLIKIFGYDRAYELGKSEHLHYYQ 197

Query: 55  IPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLD--KS 112
           +P   R+N YI++ Y R   S  ++  S+F +HNE+ NI+SHL+ A+ F  VL  D   S
Sbjct: 198 LPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPNS 256

Query: 113 TIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGICILI 171
            I           + + LF   +  C++ S+ +H     S L++      +DY GI ILI
Sbjct: 257 IIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISILI 316

Query: 172 VTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGL 231
            +S+ SI +   Y+  ++   +   +   G+    +     F   E RP R   F+   L
Sbjct: 317 TSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFI---L 373

Query: 232 SSIVPIFSGLY-CYTFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 279
            S    F+ L+  +    I+  I +   L     V Y++G V YG   PE+
Sbjct: 374 LSSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 112/234 (47%), Gaps = 12/234 (5%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           ++P   R+N YI+HGY R   +  ++  S+F     HNE+ NI+SHL+ A+    + + D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 111 KSTIKVFETTTWKDHM--IIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 167
               +V++          I+ +F + A  C++ S  +H     S L++ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227
            ILI  S+ +  +   Y  +   C +  I+++ GI    +    +F + E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 228 CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 279
              L + + + S L+    +++    +LF  +     V Y++G   YG   PE+
Sbjct: 398 ---LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 112/238 (47%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVET-FKSLFYM------HNESVNIYSHLIPALGFFTV 106
           ++P   R+N YI+HGY      F  T +KSL  +      HNE+ NI++HL+ A+    +
Sbjct: 219 QLPFPWRENRYIIHGY-----RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYL 273

Query: 107 LLLDKSTIKVFET--TTWKDHMIIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLD 163
            + D    +V++      +   I+  F + A  C++ S  +H     S L + +    +D
Sbjct: 274 AVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVD 333

Query: 164 YLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRA 223
           Y GI ILI  S+ +  +   Y  +   C +  I+++ G+    +    +F + E RP R 
Sbjct: 334 YSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRI 393

Query: 224 GLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFPEK 279
             F+   L + + + S L+    +++   I LF  +     V Y++G V YG   PE+
Sbjct: 394 RFFI---LLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPER 448

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 136/318 (42%), Gaps = 32/318 (10%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           ++T+ +     +   ++  G      + V    K +K+ + + ++ +WQ+          
Sbjct: 4   LTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQ--------Y 55

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDL 130
           R   S  E+  +L Y+   S++ +  LI    F+ + L          TTT  D+++ + 
Sbjct: 56  RNKSSRNESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNF 107

Query: 131 FYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMTSILYYGYYEKFSL 189
           +    F   ++   +H +K+ SL+       K  YL    L+++S  +ILYY +Y+    
Sbjct: 108 YLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFF 167

Query: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF-----VCFGLSSIVPI--FSGLY 242
           F +F L+    G+      L DK    + R  +   F     VC  L  +  I  F GL 
Sbjct: 168 FKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGL- 225

Query: 243 CYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIWGHSHQLFHFLVV 300
                 +  +I++  +    V  +  +++Y  RFPE +     K + W HS  LFH ++ 
Sbjct: 226 ----ENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVIS 281

Query: 301 IASFCHLRGLLNSYELVH 318
             +F H   L+ SY L+H
Sbjct: 282 GTAFYHFFILIQSYILMH 299

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 109/245 (44%), Gaps = 20/245 (8%)

Query: 47  KRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIPALGF 103
           ++L  + E+P   R+N YI+H Y R   S V++  S    +  HNE+ NI+SH    LGF
Sbjct: 214 EKLLHYYELPFPWRENRYIIHNY-RFYDSNVKSLLSAINWYGWHNETSNIWSHF---LGF 269

Query: 104 FTVLLL-----DKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHS-LRIAT 157
           F V+ L      +S +   +        ++ +F   A  CLI S+ +H     + L++  
Sbjct: 270 FYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRR 329

Query: 158 LGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKRE 217
               +DY GI ILI  S+ +  +    +   +  L+  I+++ GI    +    +F   E
Sbjct: 330 RFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPE 389

Query: 218 WRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWT-QIQLFWVLLGG--VLYIIGAVLYGM 274
            RP R   F+      ++   +  Y     E W   + L   +     V Y++G V YG 
Sbjct: 390 ARPLRIRFFMLLAAMGVLSFINASYL----ESWAYAVDLLSPITNKSIVWYLVGVVFYGS 445

Query: 275 RFPEK 279
             PE+
Sbjct: 446 FIPER 450

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 111/234 (47%), Gaps = 12/234 (5%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           ++P   R+N YI+HGY R   +  ++  S+F     HNE+ NI+SHL+ A+    + + D
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 111 KSTIKVFETTTWKDHM--IIDLFYSGAFACLILSSSFHCLKSHS-LRIATLGNKLDYLGI 167
               +V+  +        I+ +F + A  C++ S  +H     S L++ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227
            ILI  S+ +  +   Y  +     +  I+++ G+    +    +F + E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 228 CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLL--GGVLYIIGAVLYGMRFPEK 279
              L + + + S L+    +++     LF  +     V Y++G V YG   PE+
Sbjct: 399 ---LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPER 449

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 107/242 (44%), Gaps = 27/242 (11%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFY---MHNESVNIYSHLIPALGFFTVLLLD 110
           E+P   R+N YI+HGY R    F +   S+F    +HNE+ NI++H++ A     +L +D
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 111 -KSTIKVFET--TTWKDHMIIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKLDYLG 166
            + T  V +T         II +F      C+  S  +H    + S+R+      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 167 ICILIVTSMTSILY---YGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRA 223
           I +LI  S+ S  Y   Y Y +  S + + + I   FG+    +    KF   E RP R 
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGL---YLNWSPKFDSPEARPLRI 423

Query: 224 GLFVCF----GLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGG--VLYIIGAVLYGMRFP 277
             FV      GLS     F  L C     +   I LF  +     + YIIG   YG   P
Sbjct: 424 KFFVLLAAVGGLS-----FVNLVC--LEGLSRAIWLFSPVTNKSVIYYIIGVFFYGSFIP 476

Query: 278 EK 279
           E+
Sbjct: 477 ER 478

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 137/342 (40%), Gaps = 61/342 (17%)

Query: 28  AAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHG---YVRETCSFVETFKSLF 84
            A + P + AE + A+ + + L+ W E+P   R+N YI++G   Y     S +    + +
Sbjct: 85  GAEEQPLHWAE-SRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-Y 141

Query: 85  YMHNESVNIYSHLIPA--LGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILS 142
             HNE++NI+SHL+ A  L +       +S +             I  F +    C+  S
Sbjct: 142 GWHNETINIWSHLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASS 201

Query: 143 SSFHCLKSH-SLRIATLGNKLDYLGICILIVTS-MTSILYYGYYEKFSLFCLFALITVSF 200
            ++H       L++ +    +DY GI +L+  S +T++    Y     L   + + ++  
Sbjct: 202 VAWHTFNGTCHLKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGL 261

Query: 201 GIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLL 260
           G A  ++     F + E RP R  ++V  GL+++     GL   +F  +W Q++     L
Sbjct: 262 GTAAGVMNWSPHFDRPEARPLRIAVYV--GLAAL-----GL--VSFVHVWMQVRWASAHL 312

Query: 261 GG-------VLYIIGAVLYGMRFPEK--------VCPGK--------------------- 284
                    V Y IG V Y    PE+         C G                      
Sbjct: 313 MAPLVYKSLVWYGIGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQ 372

Query: 285 ------FDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLK 320
                  D + HSH L+H  VV+    H R +L    +V L 
Sbjct: 373 FWSLWWVDYFCHSHFLWHVFVVLGVVGHYRAVLQMSRIVWLD 414

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 136/316 (43%), Gaps = 28/316 (8%)

Query: 11  MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYV 70
           ++T+ +         ++    T    + V    K  K+ + + ++ +WQ         Y 
Sbjct: 4   LTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQ-------YK 56

Query: 71  RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLL--DKSTIKVFETTT-WKDHMI 127
            ++              NESV    +L+ ++  F +L+   D   I +F TTT   D+++
Sbjct: 57  NKSS------------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 128 IDLFYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMTSILYYGYYEK 186
            + +    F   ++   +H +K+ SL+       K  YL    L+++S  +ILYY +Y+ 
Sbjct: 105 FNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 187 FSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFG-LSSIVPIFSGLYCYT 245
              F +F L+    G+      L DK    + R  +   F+    +   +P+ + +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFD 223

Query: 246 -FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPG--KFDIWGHSHQLFHFLVVIA 302
               +  +I++  +    V  +  +++Y  RFPE    G  K + W HS  LFH ++  A
Sbjct: 224 GLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGA 283

Query: 303 SFCHLRGLLNSYELVH 318
           +F H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 107/239 (44%), Gaps = 22/239 (9%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIPALGFFTVLL-- 108
           ++P   R+N YI+HGY R   S  ++F S+   +  HNE+ NI++HL+  L    +    
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 109 LDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLK-SHSLRIATLGNKLDYLGI 167
              S I + +        I+ +F + A  C+  S  +H    +H LR+ +    +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 168 CILIVTSMTSILYYGYYE-KFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF 226
            ILI  S+ ++ +   Y+ K SL   + + +++ GI    +    KF + E RP R   F
Sbjct: 328 TILITASILTVEFVTMYDYKISLL-FYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFF 386

Query: 227 V------CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
           +      C     +V + +  Y        T   + W       Y+IG   YG   PE+
Sbjct: 387 ILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVW-------YLIGVFFYGSFIPER 438

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 95/210 (45%), Gaps = 16/210 (7%)

Query: 119 TTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLG-NKLDYLGICILIVTSMTS 177
           TTT  D+++ + +    F   ++   +H +K+ SL+       K  YL    L+++S  +
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 178 ILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF-----VCFGLS 232
           ILYY +Y+    F +F L+    G+      L DK    + R  +   F     VC  L 
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLP 214

Query: 233 SIVPI--FSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC--PGKFDIW 288
            +  I  F GL       +  +I++  +    V  +  +++Y  RFPE +     K + W
Sbjct: 215 LLTAIITFDGL-----ENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGW 269

Query: 289 GHSHQLFHFLVVIASFCHLRGLLNSYELVH 318
            HS  LFH L+   +F H   L+ SY L+H
Sbjct: 270 NHSEYLFHLLISGTAFYHFFILIQSYILMH 299

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 103/238 (43%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGY--VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLD- 110
           ++P   R+N YI++GY    +    + +  + +  HNE+ NI+SHL+ A+ F  ++L + 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 111 -KSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGIC 168
            KS I            I+ LF      C++ S  +H      S+++      +DY GI 
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGIT 374

Query: 169 ILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVC 228
           ILI  S+ +  +   Y+  S+  ++  +++ FG     +    KF   E RP R   F+ 
Sbjct: 375 ILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFIL 434

Query: 229 FGLSSIVPIFSGLY-------CYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
                 +  F   Y        + +S + T   + W       Y+IG   YG   PE+
Sbjct: 435 LAALGGLAFFHVAYLEGMAYAAWLYSPV-TSKSIVW-------YLIGVFFYGSFIPER 484

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 106/247 (42%), Gaps = 33/247 (13%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           E+P   R+N +I+HGY R   S+ ++  S+F     HNE+VNI++HL  AL    +L   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 111 KSTIKVFET---TTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK-----L 162
            S   V+++    T    M      SG   C + S  +H        I  L  +     +
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSG-LECFLFSVVWHTFNG----ICHLQQRSNCACV 352

Query: 163 DYLGICILIVTSMTS---ILYYGYYE-KFSLFCLFALITVS-FGIACSIVTLKDKFRKRE 217
           DY GI IL+  S+ +   +   G  E  F+   LF   T S  G+    +    KF + E
Sbjct: 353 DYTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPE 412

Query: 218 WRPYRAG---LFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVL--YIIGAVLY 272
            RP R     L   FG       FS L+   F    +  +L   +L   L  Y+IG V Y
Sbjct: 413 SRPLRIAFYLLLASFGF------FSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFY 466

Query: 273 GMRFPEK 279
           G   PE+
Sbjct: 467 GTFIPER 473

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 118/278 (42%), Gaps = 26/278 (9%)

Query: 19  KSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVE 78
           +S+Q   +  A     +  EVA      + L+ + E+P   R+N +I+HGY R   S+ +
Sbjct: 185 QSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYY-ELPFPWRENRFIIHGY-RFYNSYSK 242

Query: 79  TFKSLFYM---HNESVNIYSHLIPALGFFTVLL---LDKSTIKVFETTTWKDHMIIDLFY 132
           +  S+F     HNE+VNI++HL  AL +F  L+     ++T+   E        +  +F 
Sbjct: 243 SLLSIFNWYGWHNETVNIWTHLCGAL-YFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFL 301

Query: 133 SGAFACLILSSSFHCLKS-HSLRIATLGNKLDYLGICILIVTSMTS---ILYYGYYEKFS 188
           +    C + S  +H       L+  +    +DY GI +L+  S+ +   +   G  +   
Sbjct: 302 TAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATF 361

Query: 189 LFCL--FALITVSFGIACSIVTLKDKFRKREWRPYRAG---LFVCFGLSSIVPIFSGLYC 243
            + L  F   + + G     +    KF + E RP R     L   FG       FS L+ 
Sbjct: 362 TWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYLLLASFGF------FSYLHS 415

Query: 244 YTFSEIWTQIQLFWVLLGGVL--YIIGAVLYGMRFPEK 279
             F+       L   +    L  YIIG V YG   PE+
Sbjct: 416 RLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPER 453

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 105/243 (43%), Gaps = 30/243 (12%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVET-FKSLFYM------HNESVNIYSHLIPALGFFTV 106
           ++P   R+N +I+HGY      F ++ +KSL  +      HNE+ NI++HL  AL    +
Sbjct: 136 QLPFPWRENRFIIHGY-----RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWL 190

Query: 107 LLLDKSTIKVFETTTWK--DHMIIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLD 163
            + D     V+E+         I+ +F + A  C++ S   H       L + +    +D
Sbjct: 191 AVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVD 250

Query: 164 YLGICILIVTSMTSILYYGYYE-KFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222
           Y GI +LI  S+ +  +   Y   +SL    A+ TV  GI   I+    KF + E RP R
Sbjct: 251 YSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTV-LGIFGVIMNWSPKFDRPEARPLR 309

Query: 223 AGLFVCF----GLSSIVPIFSGLYCYT--FSEIWTQIQLFWVLLGGVLYIIGAVLYGMRF 276
              F+      GLS +     G + Y        T   L W       Y++G   YG   
Sbjct: 310 IKFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVW-------YLLGVAFYGSFV 362

Query: 277 PEK 279
           PE+
Sbjct: 363 PER 365

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 104/239 (43%), Gaps = 21/239 (8%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSLFYM---HNESVNIYSHLIPALGFFTVLLLD 110
           E+P+  R+N YI++G+ R   S  ++  S+  +   HNE++NI+SH+  A+    ++L  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 111 KSTIKVFETTTWKD--HMIIDLFYSGAFACLILSSSFHCLKSH-SLRIATLGNKLDYLGI 167
                VF +T         I +F      C++ S  +H       L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 168 CILIVTS-MTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLF 226
            ILI  S MT+  +  Y        L+  I++  G+  +      +F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 227 VC---FGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGG---VLYIIGAVLYGMRFPEK 279
           V     GL S V +       T    W+  +L    L     V Y+IG V Y    PE+
Sbjct: 423 VILAGLGLISFVHL-------TVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 109/252 (43%), Gaps = 18/252 (7%)

Query: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIP 99
           K  L R   + E+P   R+N +I+HGY R   S  ++  S+   +  HNE+ NI++HL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLFG 283

Query: 100 AL--GFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSH-SLRIA 156
           +L   +       +S++ +          ++ LF    F CL+ S ++H       L + 
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLR 343

Query: 157 TLGNKLDYLGICILIVTSMTSILY---YGYYEKFSLFCLFALI---TVSFGIACSIVTLK 210
           +    +DY GI +LI  S+ +  +   YG  +  +    F+LI    VS  + C  V + 
Sbjct: 344 SKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMN 403

Query: 211 --DKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGV-LYII 267
              +F + E RP R   ++       +          F+     I+   VL   V  Y+I
Sbjct: 404 WSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRP--VLDKSVCWYLI 461

Query: 268 GAVLYGMRFPEK 279
           G + YG   PE+
Sbjct: 462 GVIFYGSFIPER 473

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 104/244 (42%), Gaps = 32/244 (13%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIPALGFFTVLLLD 110
           ++P   R+N YI+ GY R   S V+   S+   +  HNE++NI+SHL   L    + +  
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 111 KSTIKVFET----TTWKDHMIIDLFYSGAFACLILSSSFHCLK---SHSLRIATLGNKLD 163
               +V+++    TT K  M++ +F      C++ S  +H      S++LR       +D
Sbjct: 177 YPNTEVYQSELIPTTAK--MLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VD 232

Query: 164 YLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRA 223
           Y GI ILI  S+ +  Y           ++  ++++ G     +    KF   E RP R 
Sbjct: 233 YTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRI 292

Query: 224 GLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLF---WVLL-----GGVLYIIGAVLYGMR 275
             FV           S + C +F  +     L    W+L        + Y+IG   YG  
Sbjct: 293 KFFVT---------LSAMGCLSFVHLIFTTSLRHACWLLAPIISKSTIWYVIGVFFYGSF 343

Query: 276 FPEK 279
            PEK
Sbjct: 344 IPEK 347

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 101/238 (42%), Gaps = 20/238 (8%)

Query: 54  EIPEWQRDNDYILHGYVRETCSFVETFKSL---FYMHNESVNIYSHLIPALGFFTVLLLD 110
           E+P   R+N  I++GY R   S  ++  S+   +  HNE+ NI++HL+  L    ++   
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 111 KSTIKVF--ETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSL-RIATLGNKLDYLGI 167
             + +VF  E       +I  +F   A  CL  S  +H     SL R+      +DY GI
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227
            ILI  S+ +  +   Y+       +  ++ + GI    +    KF + E RP R   F+
Sbjct: 337 SILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFI 396

Query: 228 CFGLSSIVPIFSGLYCYTFSE-IW-----TQIQLFWVLLGGVLYIIGAVLYGMRFPEK 279
                 I+      +  + S   W     T+  + W       Y++G V YG   PE+
Sbjct: 397 LLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVW-------YLVGVVFYGSFIPER 447

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 94/207 (45%), Gaps = 14/207 (6%)

Query: 119 TTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLR--IATLGNKLDYLGICILIVTSMT 176
           +TT  D++++++F         L+++F C   H ++    T G+ L  + +      S  
Sbjct: 124 STTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTAGSVLSTITMLNHWACSAV 174

Query: 177 SILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFR---KREWRPYRAGLFVCFGLSS 233
           ++LYY YY+    F L AL T ++ +  + VT+        KR+W   R  L V   +  
Sbjct: 175 TLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWSRRTLLLVYVVVLV 234

Query: 234 IVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQ 293
            VP+  GL  +  +++  ++    +L    +Y+I  V YG    + +    F +  H+  
Sbjct: 235 SVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTEKDTLPKLPFYVAFHTAS 294

Query: 294 LFHFLVVIASFCHLRGLLNSYELVHLK 320
           L H  +++ +F  +R   N   LV  K
Sbjct: 295 LIHLQLLLNAFHLMRAGTNKPTLVSFK 321

>KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} similar
           to uniprot|Q12271 YOR109w Saccharomyces cerevisiae INP53
           Phosphatidylinositol 4,5-bisphosphate 5- phosphatase
          Length = 1117

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 13/108 (12%)

Query: 155 IATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFR 214
           + T  N+LD LG  +L      + +  G+ E F        +T    +  S+  +  +  
Sbjct: 193 VITFRNRLDDLGRQVLDDEGFLTTVIRGFAETF--------VTYIKQLKVSLTVISKQSW 244

Query: 215 KREWRPYRA-GLFVCFGLSSIVP----IFSGLYCYTFSEIWTQIQLFW 257
           KR    Y A G+     +++ V     +FS  YCY F++I   I +FW
Sbjct: 245 KRAGTRYNARGVDDEGNVANFVETELLMFSKEYCYAFTQIRGSIPIFW 292

>Kwal_56.22836 s56 (296883..298724) [1842 bp, 613 aa] {ON} YOL066C
           (RIB2) - DRAP deaminase [contig 184] FULL
          Length = 613

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 8   PFQMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILH 67
           P  MS L   + S Q+ KKR     PA+P ++ EA ++ K     +     ++ N  +  
Sbjct: 17  PISMSELGSNS-SGQDCKKR-----PASPVKITEAAELNK--AQQERAKAKKKKNGGM-- 66

Query: 68  GYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMI 127
           G +R++  F    +   +M N+ V+    +I   G    +L  + T K F    W+D ++
Sbjct: 67  GELRDSNGFKLKIQESNHMRNKQVDPDYEVI-IEGPLRKVLPYQFTYKTFCKLRWRDRLL 125

Query: 128 IDLF 131
           ID+F
Sbjct: 126 IDIF 129

>CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]
           {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117w CYK3
          Length = 880

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 174 SMTSILYYGYYEKFSLFCLFALITVSFGIACSIV 207
           ++ S+LY  Y   + L CLF  + VS  I C +V
Sbjct: 508 NLESVLYQKYCTPYELTCLFKRLAVSLSIQCEVV 541

>KLLA0B02541g Chr2 complement(221104..222636) [1533 bp, 510 aa] {ON}
           similar to uniprot|Q06696 Saccharomyces cerevisiae
           YLR417W VPS36 Component of the ESCRT-II complex which is
           involved in ubiquitin-dependent sorting of proteins into
           the endosome
          Length = 510

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 13/106 (12%)

Query: 66  LHGYV----RETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTT 121
           L+G+V    R     + T   LF ++N+SV I + LI            +   + FE   
Sbjct: 365 LYGFVDSELRGDSGIIVTLVDLFALYNKSVRIGTGLISPEEM-------REACEKFEKLG 417

Query: 122 WKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167
             D  +I +  +G   CL    SF  +++  L++AT+   +D L I
Sbjct: 418 LNDLKLIKI--NGRVLCLAFQDSFDHIRTKVLQLATMRPGVDILQI 461

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 174 SMTSILYYGYYEKFSLFCLFALITVSFGIACSIV 207
           ++ ++LY  Y   + L CLF  +T + GI C  V
Sbjct: 478 NLDTVLYQKYCTPYQLLCLFKALTNALGIRCESV 511

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,875,315
Number of extensions: 1439438
Number of successful extensions: 5292
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5338
Number of HSP's successfully gapped: 82
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)