Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1596.28ON37937920320.0
Suva_15.1726.28ON39837916740.0
Smik_15.1676.28ON37837916620.0
YOL003C (PFA4)6.28ON37837916070.0
Kpol_1037.236.28ON37838012071e-165
TDEL0G044106.28ON38137912051e-165
ZYRO0C07546g6.28ON37737911861e-162
SAKL0E01518g6.28ON37938111751e-160
CAGL0E02497g6.28ON37637911681e-159
NCAS0D021406.28ON37637911551e-157
NDAI0C026506.28ON38938911311e-153
TPHA0J003906.28ON38038011091e-150
Ecym_30326.28ON37737910871e-147
KLLA0C06204g6.28ON37738010281e-138
ACL003C6.28ON37537910271e-138
KLTH0C10978g6.28ON37738010251e-138
Kwal_56.224596.28ON3833809961e-133
KNAG0F029306.28ON3863859521e-127
KAFR0A051306.28ON3963979391e-124
TBLA0B004806.28ON3774134526e-52
CAGL0D02508g3.12ON3321292185e-19
NCAS0E013003.12ON3271302123e-18
TPHA0P015603.12ON3311352081e-17
Kpol_1014.293.12ON3261322072e-17
KNAG0K025703.12ON3281342062e-17
KAFR0A085903.12ON3311312062e-17
KLLA0E02069g3.12ON3251072019e-17
TDEL0A003103.12ON329552011e-16
Kwal_55.221263.12ON3601061992e-16
KLTH0F19580g3.12ON3421631982e-16
NDAI0G013403.12ON3351301973e-16
TBLA0H001503.12ON3451421957e-16
SAKL0C13596g3.12ON333511921e-15
KAFR0B053708.286ON3291991922e-15
YNL326C (PFA3)3.12ON3361401894e-15
KNAG0A027108.389ON3541151861e-14
Suva_14.153.12ON3301291842e-14
Skud_14.153.12ON3361401832e-14
SAKL0H16434g8.286ON5552731844e-14
KLLA0D18370g8.389ON355901824e-14
NCAS0C029208.389ON374721824e-14
ZYRO0C03410g3.12ON3271521814e-14
NCAS0B035908.286ON329481797e-14
Ecym_20143.12ON339671807e-14
ZYRO0D06600g8.286ON330551781e-13
Smik_12.3068.389ON359611781e-13
TPHA0C010708.286ON3331491762e-13
Smik_14.63.12ON3341321762e-13
YLR246W (ERF2)8.389ON359611753e-13
NDAI0J010008.286ON3391731743e-13
CAGL0B01991g8.286ON3301411734e-13
Ecym_41788.389ON368721736e-13
ADL197C3.12ON390641736e-13
TPHA0C023608.389ON404731737e-13
Skud_12.3218.389ON356611701e-12
Suva_10.3428.389ON356611692e-12
NDAI0G022508.389ON389721692e-12
Skud_4.3878.286ON336741663e-12
TBLA0D040408.286ON329491654e-12
TDEL0F051308.389ON359811656e-12
TDEL0F041308.286ON328981646e-12
CAGL0G08217g8.389ON326771646e-12
Kwal_23.33028.389ON353641647e-12
SAKL0H13860g8.389ON352921647e-12
Suva_2.2898.286ON335591647e-12
KLTH0F08668g8.389ON358591647e-12
AGL125C8.389ON367781621e-11
ZYRO0C04092g8.389ON366791621e-11
TBLA0E028305.579ON3861241621e-11
TBLA0H009208.389ON360761602e-11
KLTH0G13112g8.286ON3492591602e-11
KAFR0H019808.389ON361651603e-11
Kpol_1033.168.286ON321551575e-11
YDR126W (SWF1)8.286ON336481566e-11
Smik_4.3728.286ON3351811558e-11
KLLA0F19690g8.286ON324631531e-10
Ecym_42828.286ON340491471e-09
NCAS0F013905.579ON3742591452e-09
Smik_4.7375.579ON3782331452e-09
Ecym_41145.579ON372801433e-09
KAFR0I011105.579ON3701311434e-09
CAGL0K06347g5.579ON3521791416e-09
AGR065W8.286ON326441398e-09
Kwal_56.236978.286ON338481362e-08
Skud_4.7345.579ON3802641362e-08
YDR459C (PFA5)5.579ON3743031362e-08
SAKL0G06160g5.579ON3641211353e-08
Kwal_47.183665.579ON356701354e-08
Kpol_1004.575.579ON3621381344e-08
KLTH0G04972g5.579ON367741335e-08
ZYRO0D13860g5.579ON3651391336e-08
NDAI0H018905.579ON406681337e-08
KNAG0H031108.286ON331551292e-07
TDEL0A044405.579ON365801273e-07
KNAG0C028305.579ON354711264e-07
Suva_2.6345.579ON388611222e-06
KLLA0D06149g5.579ON349811212e-06
ABR203W5.579ON359631185e-06
KAFR0H005705.626ON757711195e-06
TPHA0C003705.626ON759511133e-05
Smik_15.2135.626ON7441571124e-05
NDAI0H008505.626ON786531124e-05
Suva_2.4325.626ON763501105e-05
ZYRO0C11132g5.626ON759661097e-05
Skud_4.5275.626ON764501097e-05
TBLA0J008305.626ON7391151081e-04
Suva_8.875.626ON7301551081e-04
Smik_4.5155.626ON764501081e-04
Kpol_526.325.626ON777551071e-04
KLTH0E02420g5.626ON7341371072e-04
YDR264C (AKR1)5.626ON764501053e-04
Ecym_13305.626ON739731043e-04
NCAS0C052805.626ON757591043e-04
YOR034C (AKR2)5.626ON749861000.001
CAGL0M08712g5.626ON76351970.002
TDEL0A049205.626ON75066970.002
AER388C5.626ON72449960.003
KNAG0C062305.626ON75253950.004
SAKL0G07326g5.626ON73750930.007
Skud_15.1995.626ON741155910.013
KNAG0B031405.626ON68298880.026
Smik_5.256.17ON61573800.27
KLLA0E16721g5.626ON75259770.59
TBLA0D036001.532ON48643741.1
KAFR0E026508.442ON142864722.5
ZYRO0F17072g1.66ON96164722.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.159
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   787   0.0  
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   649   0.0  
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   644   0.0  
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   623   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   469   e-165
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   468   e-165
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   461   e-162
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   457   e-160
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   454   e-159
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   449   e-157
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     440   e-153
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   431   e-150
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   423   e-147
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   400   e-138
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   400   e-138
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   399   e-138
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   388   e-133
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   371   e-127
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   366   e-124
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   178   6e-52
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    89   5e-19
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    86   3e-18
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    85   1e-17
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    84   2e-17
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    84   2e-17
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    84   2e-17
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    82   9e-17
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    82   1e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    81   2e-16
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    81   2e-16
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      80   3e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    80   7e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    79   1e-15
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    79   2e-15
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    77   4e-15
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    76   1e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    75   2e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    75   2e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    75   4e-14
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    75   4e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     75   4e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    74   4e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      74   7e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    74   7e-14
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    73   1e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    73   1e-13
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    72   2e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    72   2e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    72   3e-13
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    72   3e-13
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    71   4e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    71   6e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    71   6e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    71   7e-13
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    70   1e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    70   2e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     70   2e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    69   3e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    68   4e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    68   6e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    68   6e-12
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    68   6e-12
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    68   7e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    68   7e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    68   7e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    68   7e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    67   1e-11
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    67   1e-11
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    67   1e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    66   2e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    66   2e-11
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    66   3e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    65   5e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   6e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    64   8e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    64   1e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    61   1e-09
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    60   2e-09
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    60   2e-09
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    60   3e-09
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    60   4e-09
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    59   6e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    58   8e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    57   2e-08
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    57   2e-08
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    57   2e-08
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    57   3e-08
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    57   4e-08
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    56   4e-08
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    56   5e-08
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    56   6e-08
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    56   7e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    54   2e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    54   3e-07
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    53   4e-07
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    52   2e-06
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    51   2e-06
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    50   5e-06
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    50   5e-06
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    48   3e-05
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    48   4e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    48   4e-05
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    47   5e-05
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    47   7e-05
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    47   7e-05
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    46   1e-04
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    46   1e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    46   1e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    46   1e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    46   2e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    45   3e-04
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    45   3e-04
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    45   3e-04
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    43   0.001
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.002
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    42   0.002
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    42   0.003
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    41   0.004
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    40   0.007
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    40   0.013
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    39   0.026
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...    35   0.27 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    34   0.59 
TBLA0D03600 Chr4 complement(890231..891691) [1461 bp, 486 aa] {O...    33   1.1  
KAFR0E02650 Chr5 (538042..542328) [4287 bp, 1428 aa] {ON} Anc_8....    32   2.5  
ZYRO0F17072g Chr6 complement(1419910..1422795) [2886 bp, 961 aa]...    32   2.6  

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/379 (100%), Positives = 379/379 (100%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 361 WYNDWGESLDDFGVDVDME 379
           WYNDWGESLDDFGVDVDME
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/379 (81%), Positives = 337/379 (88%), Gaps = 1/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLS+SKQ+ FE SLSMIWVSYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G+P P Y+P+P  WPN+CKKCQ+YKPERSHHCKACNQCVLMMDHHCPWTMNCVGF+NY
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRF+FWVI TT  LFC+Q+KR+ FIWQQR LPGYLF+KSEL+FLTIL+PL+FFVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I ILFLRCL NQIINGRSQIESWDMDRLESL DS +LI KLI+NTWRIYPEARS Q ERD
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A+KLLTQ  + RF+E+V+FPYN +  TNA +YLGP+ LWLWP G PAGDGNSF KNDIS+
Sbjct: 261 AEKLLTQH-KIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISK 319

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YEVNS LEDI+LSLPWPPDG K K  SNH+N  IET NEGGEQ+VRSR AQHG  A REK
Sbjct: 320 YEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379

Query: 361 WYNDWGESLDDFGVDVDME 379
           WYNDWGESLDDFGVDVDME
Sbjct: 380 WYNDWGESLDDFGVDVDME 398

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/379 (80%), Positives = 339/379 (89%), Gaps = 1/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MAVKL+WPWLGIAIPT LISFIGYGAHYFILSNFL I+KQ+ FE SLSMIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRPLPNY+P+P IWPNFCKKCQ+YKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFLFW+I+TTSILFC+QVKRICFIWQ+R+ PGYLF+KSEL FLTILSPL+FFVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I +LFLRCL NQI+NGRSQIESWDMDRLESL DS +LI KLI NTWRIYPE+++ QHERD
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A+ LL Q+ R+ F+ LV+FPYNF+  TNAILYLGP+ LWLWPYG P G+GN+FPKNDIS 
Sbjct: 241 AEGLLKQQ-RSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YEV+SPLEDIILSLPWPPDG +T  VSN   STIET NEGGEQ+VRSR AQ+G  A REK
Sbjct: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 361 WYNDWGESLDDFGVDVDME 379
           W+NDWGESLDDFGVDVDME
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/379 (78%), Positives = 330/379 (87%), Gaps = 1/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKL+WPWLGIAIPTFLISFIGYGAHYFILSNFLS+ KQ+ FE  LSMIW+SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRPLPNY+P P IW NFCKKCQSYKPERSHHCK CNQCVLMMDHHCPWTMNCVGF NY
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFLFW+IVTTS+LFC+Q KRI FIWQQR LPGY F+KSELIFLTI SPL+ FVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I ILFLRCL NQI+NGRSQIESWDMDRLESL +SG+L  KLIDNTWRIYPE+RS Q+++D
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A++ LT++ R RFDELV+FPY+F+  TNA+LYLGPI LWLWPYG P GDGN+FPKN IS+
Sbjct: 241 AEEHLTKK-RPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISK 299

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YE NS LED ILSLPWPPDG KT  V NH +STIE  NE GEQ++R+R  Q+G  A REK
Sbjct: 300 YEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 361 WYNDWGESLDDFGVDVDME 379
           WYNDWGESLDDFGVDVDME
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  469 bits (1207), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 283/380 (74%), Gaps = 3/380 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFLSI KQ+ FE+S++MIW+SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G+P  NY P    W N+CKKC +YKPER+HHCK C QCVLMMDHHCPWTMNCVG++N+
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFLFWVIVTT+ L    + RI F+W+ R+LP YLF KSE+IFLTI +P+D FVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I++LF+RC  NQ+++GR+QIE+W+ +RLESL    +L P+LI N W  +PE ++  +E  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A+K++++  R RFD LVSFPY+     N    LG    WLW YG P+GDG  F KN+ S 
Sbjct: 241 AEKIVSK--RIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSL 298

Query: 301 YEVNSPLEDIILSLPWPPDGNKTK-AVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359
           +E +S LED ILSLPWPPDG K    + N + ++IET  + GE ++R R+        R 
Sbjct: 299 FEEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRT 358

Query: 360 KWYNDWGESLDDFGVDVDME 379
           +WYNDWGE+L+DFGVD+D+E
Sbjct: 359 QWYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  468 bits (1205), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 279/379 (73%), Gaps = 1/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLKWPWLGIAIP  L+SFIGY  H+FILSNFLS SKQL F+ +L++IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRP PN+      W N+CKKCQ+YKPER+HHCK CNQCVLMMDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFL WVIV T+ L    V RI  +W+ R+LP Y+F +SEL+FLTIL+PLD FVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I IL  RCL+NQI NG SQIE+W+++RL++L DS +L+P LI+  W I+P  R   +E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A + L+     R +++V+FPY+ +P +NA   LG   LWLWP+G P GDG SF KN+IS+
Sbjct: 241 AAE-LSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISE 299

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           Y   +  ED++LSLPWPPDG +T+A     +S+IE+  + GEQ++R R         R +
Sbjct: 300 YSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 361 WYNDWGESLDDFGVDVDME 379
           W NDWGE+L+DFGVDVD E
Sbjct: 360 WQNDWGENLEDFGVDVDTE 378

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/379 (58%), Positives = 278/379 (73%), Gaps = 2/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFLS  KQ+ FE SL+MIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
             G+PLPN++PS   W ++CKKC++YKPER+HHCK CNQCVL MDHHCPWT NCVG+ N+
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFLFWVI TT  L      R  FI    + P YL+ KSELIFLTIL P+D F+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I+ILF+RCLSNQI  GR+QIE+W+ +RLE L  S +L+P L+ N W +YPE R+ + E +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A +L T+R R   D LV+FPY+ +P +N I +LG    WLWP+G P GDG  FPKNDIS+
Sbjct: 241 ASRLSTRR-RIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISE 299

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           +E  + L D++L+LPWPPDG K K +S    + +ET    GEQ++R R       + R +
Sbjct: 300 FE-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 361 WYNDWGESLDDFGVDVDME 379
           W N WGE+L+DFGVDVD E
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MAVKLKWPWLGIAIP FLISFIGY AHYFILSNFL   KQL FE SL MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G+P P +RPS   W NFC KC +YKPER+HHCKACNQCVL MDHHCPWTMNCVG RN+
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
            HF+RFLFWVI TTS L    VKRI F+W +R +P Y   +SELIFLTIL+P+D FVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I++L LRC  NQI+ G +QIESW+MDR+E++  SG+LIP++++N   I P + S+Q + D
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDD-D 239

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
             KLL+Q  R   DE+V+FPY+ NP  NA+  LG +  W+ P+GT  G+G  F KN++S 
Sbjct: 240 IRKLLSQ-NRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNAQHGSDAIR 358
           YE   P+ED +LSLPWPPDG + K      N    +E+    GE++VR R     +   R
Sbjct: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358

Query: 359 EKWYNDWGESLDDFGVDVDME 379
           +KWYNDWGE+L DFGVD+D E
Sbjct: 359 KKWYNDWGENLADFGVDLDEE 379

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/379 (58%), Positives = 272/379 (71%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLKWPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQL ++   +MIW+SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
             G+P  N++PS   W  +CKKC+ YKPERSHHCK CNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFLFWVIV T+ L      RI  IW  RS P YL+ KSELIFLTIL+PL+ F+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I+IL +RCL NQI NGRSQIESW+MDRLE+L    KL+P LI+N W I+P  R+   E  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A+ LL ++ R   DELV+FPY+  P  NAI  LG   LWL+P+  P  DG  F KN+ S 
Sbjct: 241 AEALLNKK-RLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
            E  + L DIIL LPWPPD  K    ++ + S ++  +E GEQ++R R  +      R +
Sbjct: 300 IEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLS--RSE 357

Query: 361 WYNDWGESLDDFGVDVDME 379
           W NDWGESL+DFGVDVD+E
Sbjct: 358 WLNDWGESLEDFGVDVDVE 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 279/379 (73%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+S   QL F+ SL+M+W+SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRP  +++P    W +FCKKCQ +KPER+HHCK CNQCVLMMDHHCPWTMNCVGF+N+
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHFLRFLFWV+VTT  L    +KR  ++W  + LP YLFEK+E+ FL IL P+D FVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           +A+LF+RCLSNQII G++QIESW+++RLE+L    KL+P+L+ N W IYP  ++ +++  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A KL  +  + RF+ +V+FPY+ +  +NA+  LG    WLW +G P  DG  F KN+++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YE  + +ED++LSLPWPPDG +         + +E+  E GEQ++R RN ++  ++ R+ 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRN--FIQQKGTNVESITENGEQVIRQRNFEN-DNSYRKT 357

Query: 361 WYNDWGESLDDFGVDVDME 379
           W NDWGE+L+DFGVDVD+E
Sbjct: 358 WNNDWGENLEDFGVDVDVE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  440 bits (1131), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 279/389 (71%), Gaps = 12/389 (3%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MA+KLK+PWLG+AIP+F+ISFIGY +HYFILSNFLSI KQ+ F+ SLSMIWVSY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NAGRPLPNYRPSPL----IWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 116
           N G+P  N +P        W   CKKC +YKPERSHHCK CNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 FRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFF 176
           ++N+PHF+RFL W+I+TT  L    +KR   +W  R LP Y+F+++E+IFLTIL P+D F
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQ 236
           +LLTI++LF+RC +NQI+ G +QIE W+++RLE+L  + KL+P +I   W +YP  R+  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 HERDADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKN 296
            +  AD LL++R + RF+ +V+FPY+ +  TN    +G    W+W +G P  +G  F KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 297 DISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQH---- 352
           +IS YE  S +ED++LSLPWPPD  K +   ++ ++++E+    GEQ+VR+R +      
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 353 --GSDAIREKWYNDWGESLDDFGVDVDME 379
               D  RE+W NDWGESL DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  431 bits (1109), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 277/380 (72%), Gaps = 2/380 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VK KWPW+GIAIP  LISFIGY +HY+IL   LS+ KQ  FE SL+MIWVSYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G+P  N++P P  W NFCKKC +YKPERSHHCK CNQCVLMMDHHCPWTMNC+GF N+
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFL W++ TT  L   Q+KRI ++W  R+LP YLFE+SE+I L + +PL+ F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I +LF RCL NQIING++QIE W+MDRLE+     KL+P+LI N W +YPE +S++H+ +
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A++L+ ++G  R+D +V+FPY+     N    +G    WLWP+G P+G+G +F KN+I+ 
Sbjct: 241 AERLIEKKG-IRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIAL 299

Query: 301 YEVNSPLEDIILSLPWPPD-GNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359
           ++ +S L    L+LPWPPD G    + + + +S +E     GEQ+VR+R         RE
Sbjct: 300 FDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSRE 359

Query: 360 KWYNDWGESLDDFGVDVDME 379
           +W+N+WGE+L+DFGVDV+ME
Sbjct: 360 EWFNEWGENLEDFGVDVEME 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  423 bits (1087), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 269/379 (70%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FLS+ +Q+ F+ SL+MIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G P+P ++P    W N+CKKCQ++KPER+HHCK C QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFLFW+I TT+ L     KR  F+W  R     L  K E+IFLTIL+P + FVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I+ILF RC+ NQ++NG +QIE+W+MDR+ES+  + +L+P+L+ N   +YP +    H+ +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
            D++L  R +  F++LV+FPY+ +P  N I  +GP+  WL P+G P G+G  F KN++S 
Sbjct: 240 IDRILNNR-KISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSA 298

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           YE  S L D +LSLPWPPDG +    SN +   +E+    GE I+R R+ +   +  R +
Sbjct: 299 YEHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357

Query: 361 WYNDWGESLDDFGVDVDME 379
           WYNDWGE+L  FGVDVD +
Sbjct: 358 WYNDWGENLAHFGVDVDAD 376

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 263/380 (69%), Gaps = 4/380 (1%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MA+KLK  WLG+AIP FL++ IGYG+HYFILSNFLS ++Q+ ++   +MIWVSYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G P  +++PS   W N+CKKC+ YKPER+HHCK CNQCVL MDHHCPWT+NCVG  N+
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFLFWVI +T+ L  + + RI  +W  R    +    SE+IF+ I++P+D FVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEAR-SSQHER 239
           ++ L  RC+ NQ ++G +QIESW+MDR++SL    +L+ ++ID      PE   + QHE 
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHE- 239

Query: 240 DADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDIS 299
             +KLL++R     ++  +FPY+ NP TN    +GP  LWLWP+  P   G SF KN++ 
Sbjct: 240 -INKLLSKR-YVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELF 297

Query: 300 QYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359
            Y+ NS +ED+++SLPWPPDG    + +  + S+IET   GGEQ++R ++        R 
Sbjct: 298 FYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRN 357

Query: 360 KWYNDWGESLDDFGVDVDME 379
            WYNDWGE L DFGVD ++E
Sbjct: 358 SWYNDWGEDLSDFGVDTELE 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 261/379 (68%), Gaps = 4/379 (1%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFLS  + L F++SLSMIW+SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRP   +RP    W N+C KC++YKPER+HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
                   W+I TT IL    VKRI F W  R     L  K ELIFLTIL+PLD F+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I++LF+RC+ NQI+NGR+QIE+W+MDR+E+L    +L+P+L+ N   IYP +   Q E++
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
            ++ L+      FDE+++FPY+ NP  N +  +G    WL P+G P  DG  F KN+IS 
Sbjct: 240 VEEFLSS-STCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISD 298

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360
           Y+  + ++D +L+LPWPPD  +   ++  + S +E   +GGEQ+VR R+        R +
Sbjct: 299 YDEATSIQDKLLALPWPPDDTR-HGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPP-RNE 356

Query: 361 WYNDWGESLDDFGVDVDME 379
           WYNDWGESL+ FGVDV++E
Sbjct: 357 WYNDWGESLEHFGVDVEVE 375

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  399 bits (1025), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 263/380 (69%), Gaps = 5/380 (1%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M V+LKWPWLGIA+P+FLI++IGY +HYFIL NF S  +QL FE SL++IWVSY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N GRP PN+ P    W N+CKKC +YKPER+HHCK C QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFL WV++TTS L  +  +R    W  R+   ++   SEL FL + +PL+ F+LLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           +++L  RC+ NQ +NG +QIESW+ DR+E+L  + +L+P+LIDN   ++PE   +  E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE--DTFDEGA 237

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A KLL+ + +   +++++FPY+ +   N    +GPI  W  P G P  +G  F  ND+S 
Sbjct: 238 AQKLLSSK-QLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSD 296

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHN-NSTIETYNEGGEQIVRSRNAQHGSDAIRE 359
           Y++ + +ED +LSLPWPPDG + K+  + +  ST+ET++ GGE  +R+R+        R 
Sbjct: 297 YDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRT 356

Query: 360 KWYNDWGESLDDFGVDVDME 379
           +W+NDWGE+L DFGVDVD E
Sbjct: 357 EWHNDWGENLSDFGVDVDAE 376

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 263/380 (69%), Gaps = 5/380 (1%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M VKLKWPWLGIAIP+ LI+FIGYG+HYFIL NFLS+ +Q+ F++ LSMIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           N G+P   ++P P  W N C+KC++YKPER+HHCK C+QCVL+MDHHCPWTMNCVG  N+
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           PHF+RFL WVI+TTS L  M  KRI   WQ R    Y+ +K EL+F+ I +PL+ FV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           I +L LRC  NQ + G +QIE W+ +R+E+  ++G+LIP+L++N   IY +     +  +
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237

Query: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300
           A KL+  R   + +E+V+FPY+ N   N    +G +   + P+ +P G+G  F KND+S 
Sbjct: 238 AKKLINARD-LQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSS 296

Query: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHN-NSTIETYNEGGEQIVRSRNAQHGSDAIRE 359
           Y+    +ED +LSLPWPPDG + +   +   +S IE ++  GE ++R R      +  R 
Sbjct: 297 YDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRT 356

Query: 360 KWYNDWGESLDDFGVDVDME 379
           +WYNDWGE+L DFGVDV+ E
Sbjct: 357 EWYNDWGENLSDFGVDVESE 376

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  371 bits (952), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 254/385 (65%), Gaps = 13/385 (3%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M V+LK PW GIAIP  LI FIGY AH+FIL N LS  +Q++F+  L+MIW+SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NAGRPLPN--YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFR 118
           N G+P      + +      +C KC  +KPERSHHCK C QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLP--GYLFEKS--ELIFLTILSPLD 174
           N+P F+RFL WVI+TTS LF   + RI  IWQ R++P  G +   +  EL+ L +L+P+D
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 FFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARS 234
            FVL TI  LF+RC++NQ+I G +QIESW+M+RL+++  S KL+P +I+  W  +P  ++
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 SQHERDADKLL--TQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNS 292
            +HE +A+KLL   ++G  +F  +V+FPY+ +  TN    LG   L LWP+ T  G+G +
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 293 FPKNDISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNA 350
           F KNDIS YE N  + D++L L WPPDG +        +    I+   E GE ++R RN+
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 351 QHGSDAIREKWYNDWGESLDDFGVD 375
              S   R  W N WGE+L+ FGVD
Sbjct: 361 PIES---RTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 196/397 (49%), Positives = 256/397 (64%), Gaps = 19/397 (4%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           MA++LKWPWLGIAIPTFLISFIGY AHYFIL + LS   QL F+ SLSMIW+SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NAGRP-LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRN 119
           + G P + +          +CKKC +YKP R+HHCK CN+C+LMMDHHCPWTMNCVGF+N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 YPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLL 179
           YPHFLRFLFWVIVTT+ L     +RI FIW        L ++ E++ LTIL+P+D F+LL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGK-----LIPKLIDNTWRIYPEARS 234
           TI +L +RC  NQI +G SQIE W+M+RLES   S K      +  LI+N + I+     
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 235 SQHERDADKLLTQRGRAR--FDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNS 292
             ++ + + LL Q  + R  F  +++FPY+ +  TNA   LGP   WL P+G P GDG  
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 293 FPKNDISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNA 350
           F  N+I+  E  S L D++LSLPWPPD   +K   + +  T  +ET+ EGGE ++R+R  
Sbjct: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 351 QHGSD--------AIREKWYNDWGESLDDFGVDVDME 379
               D          R+ W N+WGE+L  FGVD++ E
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  178 bits (452), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 136/413 (32%), Positives = 209/413 (50%), Gaps = 73/413 (17%)

Query: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L+ ++ + +  +  MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPE----------------RSHHCKACNQCVLMM 104
               P P   PS L   +F     + + +                R+HHCK CN CV+MM
Sbjct: 61  ---PPTP--APSTLT-QSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFE--KS 162
           DHHCPWTMNCVG+ NYPHF+RFL WVI++T+ L    +K+   ++  R+ P +L++  K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 ELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLE-----SLCDSGKL 217
           ++I LT+L P   FV LT+ +L L+ L NQI NG +QIE W  + +E     S      L
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 218 IPKLIDNTWRIYPEARSSQHERDADKLLTQ-----RGRARFDELVSFPYNFNPCTNAILY 272
             +L++N    Y +  S+       KL++      R    F  +++FPY+     N    
Sbjct: 235 QLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294

Query: 273 LGPIR--LWLWPYGTPAGDGNSFPKNDISQY------EVNSPLEDIILSLPWPPDGNKTK 324
           +G +    W  P+ TP         N I+++      E +  ++D++L LPWP       
Sbjct: 295 MGSLNPLSWFNPWYTPLTAS----YNKINEFAIWDDNETHDNIKDMLLCLPWP------- 343

Query: 325 AVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREKWYNDWGESLDDFGVDVD 377
            ++  NNST     + GE +V+S               ND+GE+L DFGVD D
Sbjct: 344 -LNYSNNSTF----QDGELVVKS---------------NDYGETLQDFGVDYD 376

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 72/129 (55%), Gaps = 7/129 (5%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           CK C S+KP+R HHC  CN CVL MDHHCPW   CVG+RN   F++FL +  V + ++  
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVLI 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGRS 198
           +    I + W      G  FE  ELI  T+LS     ++++I+I      S +Q+   ++
Sbjct: 166 LSSMEI-YTW----FKGEFFE-VELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQT 219

Query: 199 QIESWDMDR 207
            IE + + R
Sbjct: 220 TIELYSLRR 228

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 7/130 (5%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
            C+ CQ +KP+R HHC  C++C+L MDHHCPW   C+GF N  +F++FL +    + ++ 
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVVL 159

Query: 139 CMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGR 197
                 + + W      G  +E  ELI L +L+     +++T++++F    S  Q++  +
Sbjct: 160 FFTSCELHY-W----FSGKQYE-DELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQ 213

Query: 198 SQIESWDMDR 207
           + IE + M R
Sbjct: 214 TTIEMYGMKR 223

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 77  PNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSI 136
           P  C+ C  +KP+RSHHC  CN+CVL MDHHCPW   C+GF+N   F++FL +      +
Sbjct: 107 PRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTTYAYV 166

Query: 137 LFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSN----Q 192
           +  +  K++ + W         F    L+FL IL+         +  L L C +      
Sbjct: 167 IAILTSKQM-YNWFDDGSYENEFVNMYLLFLWILA--------LVVSLALSCFAGFSVYM 217

Query: 193 IINGRSQIESWDMDR 207
           ++N ++ IE + M +
Sbjct: 218 VMNNKTTIEMYAMRK 232

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 69/132 (52%), Gaps = 13/132 (9%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC AC++C+L MDHHCPW   CVGF+N  +F++FL +  V  +IL  
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV-YAILVM 164

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSN----QIIN 195
                  + W +  L      K  L+ + ILS     V LT+      C +     Q IN
Sbjct: 165 TYTSFQIYDWFKNELYETEIIKIRLLMVWILSVA---VFLTVT-----CFTGFSIYQTIN 216

Query: 196 GRSQIESWDMDR 207
            R+ IE + + +
Sbjct: 217 NRTTIEMYTLRK 228

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 17/134 (12%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVGFRN   F++FL +       +  
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 140 MQVKRICFIW------QQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQI 193
           M   ++ + W      Q+  + GY      L+FL I S L  F+ +T   LF     +Q+
Sbjct: 163 MTSVQL-YRWFYNDKFQEELISGY------LLFLWIFS-LVVFIAMT---LFSAFSVSQV 211

Query: 194 INGRSQIESWDMDR 207
           +  ++ IE + + R
Sbjct: 212 LKNQTTIEMYGVQR 225

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 75/131 (57%), Gaps = 5/131 (3%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+GF+N  +F++FLF+    + I+  
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVLF 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQ 199
           +   +I + W + +   Y F   +L+ + +L+ + F  L    +LF      Q++  ++ 
Sbjct: 166 VTSIQI-YHWFRSTSYEYEFIDFKLLTVWLLAIVIFISL----VLFTGFSVFQLLGNQTT 220

Query: 200 IESWDMDRLES 210
           IE +   R ++
Sbjct: 221 IELYAYRRYKA 231

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 82.0 bits (201), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
           FC+ C+ +KP+R HHC  CN+C L MDHHCPW  +CVGFRN   F++FL +  V +  + 
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 139 CMQVKRICFIWQQRSLPGYLFEKSELI--FLTILSPLDFFVLLTIAI 183
            M   ++   ++Q      L +   L+   L++++ +  F   T  I
Sbjct: 164 LMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTI 210

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIV 132
             C+ C  +KP+R HHC ACN+C+L MDHHCPW  +CVGFRN  +F++FL +  +
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
           FC+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG+RN  +F+ FL +    + ++F
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVF 191

Query: 139 CMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAIL 184
            +    +   ++ +   GY     ELI L +L      +++TI++L
Sbjct: 192 FLTGADLLMWFRSQ---GY---NQELINLPLLIVWILSLVITISML 231

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 75/163 (46%), Gaps = 29/163 (17%)

Query: 7   WPWLGIAIPTFLISF--IGYGAHYFILSNFLSISKQLLFE-LSLSMIWVSYYLAIYTNAG 63
           W  +  A P  L  F  I  G+   +    L IS  +    L +S+   +Y+  I T AG
Sbjct: 4   WSIITSAFPKCLTVFLFIYTGSVTVLDVRVLPISLTIAMAGLCMSLSLYTYFKVIRTGAG 63

Query: 64  RPL--PNYR-------------PSPLIWPN-----------FCKKCQSYKPERSHHCKAC 97
            PL  P  R             P P +              FC+ C  +KP+R HHC AC
Sbjct: 64  SPLDFPELRIDNVDAADEGVELPPPFLSKRSVTLKRNGRFRFCRVCAVWKPDRCHHCSAC 123

Query: 98  NQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFCM 140
            +C L MDHHCPW  +CVG+ N  +F++FL +  V + ++F +
Sbjct: 124 KKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFLL 166

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 72/130 (55%), Gaps = 7/130 (5%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
            C+ CQ +KP+R HHC  CN+C+L MDHHCPW   C+GF+N   F++FL +  +   +  
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTIYAFVAL 167

Query: 139 CMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGR 197
            +   +    ++ ++   Y+ E  +   L I+  L F  +++I++L     S  Q++  R
Sbjct: 168 GLISYQFVNWYKNQN---YMNEYIDFTLL-IVGLLAF--VISISVLAFSSFSIYQVLKNR 221

Query: 198 SQIESWDMDR 207
           + IE + + R
Sbjct: 222 TTIEMYGIRR 231

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 77/142 (54%), Gaps = 15/142 (10%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +C++C+L MDHHCPW   C+GF+N+ +F+ FL +  +  + +  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAI---LFLRCLSNQIING 196
           +  K    +W   S   Y+   +ELI + +L  L F V L  ++   LF      Q++  
Sbjct: 166 ISSKE---LWNWFSQEKYV---TELINIHLL--LLFIVSLITSVSMTLFTAYSIYQVLIN 217

Query: 197 RSQIESWDMDR----LESLCDS 214
           R+ IE +   R    LE L D+
Sbjct: 218 RTTIELYAYRRYKEELEILQDT 239

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 39/51 (76%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV 130
           C+ C+ +KP+RSHHC +CN+C L MDHHCPW  +C+GF+N   F++FL + 
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYT 155

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 88/199 (44%), Gaps = 22/199 (11%)

Query: 72  SPLIWPN-FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV 130
           S + +PN FC  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY +F  FL   
Sbjct: 128 SLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL--- 184

Query: 131 IVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS 190
            V+ ++L      RI  +     +    F    L FL ILS   F +LL    L      
Sbjct: 185 -VSNTLLLGYAFLRIILLTAYSDIG---FPNIVLTFL-ILSGAFFAILLVFTYLQFAL-- 237

Query: 191 NQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRI-YPEARSSQHERDADKLLTQRG 249
             + +G +  E      ++     G+LI +  +  W I +PE  + Q  R          
Sbjct: 238 --VYDGMTTNEKDKWFTIQEFMREGRLI-RTDNGQWLIAHPEEPAGQATRFYST------ 288

Query: 250 RARFDELVSFPYNFNPCTN 268
              +D  +  P NF P T+
Sbjct: 289 -NAYDHTIYCPVNFRPITH 306

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 67/140 (47%), Gaps = 11/140 (7%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GFRN   F++FL +  +   ++  
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLI 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGRS 198
                +   +   S         ELI   +L      V + I++L   C S  Q+   ++
Sbjct: 166 YTCYELGTWFNSGSF------NRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQT 219

Query: 199 QIESWDMDR----LESLCDS 214
            IE   M R    LE L DS
Sbjct: 220 TIEVHGMRRYRRDLEILNDS 239

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP  + S  +   +C  C+ ++P R+ HC+ C  CV   DHHC W  NCVG RNY +FL 
Sbjct: 172 LPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLT 231

Query: 126 FLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
           FL     T ++LF      I    + R++P  L   S +     L  L + V +T
Sbjct: 232 FLTATCATCTVLFVSSA--IHLSHETRAVPIVLVAYSGIALWYPLVLLVYHVCMT 284

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF+N   F++FL +      ++  
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLI 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGRS 198
                +   +   S         ELI   +L      + + I++L     S  Q+ N ++
Sbjct: 166 YSCYELGTWFHSGSF------NQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQT 219

Query: 199 QIESWDMDR 207
            IE + M R
Sbjct: 220 TIELYGMRR 228

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (47%), Gaps = 11/140 (7%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +C+ C+L MDHHCPW   C GF+N   F++FL +      ++  
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTFYAFLVLI 165

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGRS 198
                +   +   S         ELI L +L      + + I++L     S  Q+ N ++
Sbjct: 166 DTCYELGTWFNSGSF------SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQT 219

Query: 199 QIESWDMDR----LESLCDS 214
            IE   M R    LE L DS
Sbjct: 220 TIELHSMRRYRRDLEILNDS 239

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 113/273 (41%), Gaps = 33/273 (12%)

Query: 5   LKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFE--------LSLSMIWVSYY- 55
           L++ W    +P F  S   Y    F    +  +S  LLF         L L  I   Y  
Sbjct: 44  LRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLGPIITGYLC 103

Query: 56  LAIYTNAGRPLPNYR---PSPLIWPN-FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWT 111
           + I  ++ + L + R      +  P   C+ C   KP RS HC  CN+C+LM+DHHC W 
Sbjct: 104 MTIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWV 163

Query: 112 MNCVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILS 171
            NC+G  NY +F  FL   +   S  F +++  I  + Q  ++     +   ++ LTIL+
Sbjct: 164 NNCIGKGNYKYFYGFLLSNVTLLSYSF-LRLTSIQLMSQTENI-----KTKPMLVLTILT 217

Query: 172 PLDFFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLI-PKLIDNTWRIYP 230
                    I  +F     N + +G +  E      ++     G L+  K     +RI  
Sbjct: 218 G----CFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGNLVRDKKGHYYFRILD 273

Query: 231 EARSSQHERDAD---------KLLTQRGRARFD 254
           E+ S + +++ +         K+L +    R D
Sbjct: 274 ESSSDRDQKEEEDSYRSNNKKKMLLENANTRID 306

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 49/90 (54%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP   P+  +   +C+ C+ ++P RS HC  C+ CVL  DHHC W  NC+G RNY  FL 
Sbjct: 160 LPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLE 219

Query: 126 FLFWVIVTTSILFCMQVKRICFIWQQRSLP 155
           FL    ++  +L  +   R+ +  Q R  P
Sbjct: 220 FLMASTISCILLILLSSFRLSYSPQVRYTP 249

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP +     I   +CK C+ ++P RS HC  C  CVLM DHHC W  NCVG RNY +FL 
Sbjct: 170 LPTFHTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLT 229

Query: 126 FLFWVIVTTSIL 137
           FL    +T+  L
Sbjct: 230 FLTSSTLTSIFL 241

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 74/152 (48%), Gaps = 11/152 (7%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC  C++C+L MDHHCPW   C+GF N   F+++L +    + ++F 
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIFL 166

Query: 140 MQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLS-NQIINGRS 198
               ++   +  +        + ELI   +LS     V +++++ F    S  Q+   ++
Sbjct: 167 FSSIQLLHWFNTKQY------EVELIDFHLLSVWLLGVAVSVSLSFFTGFSIYQVTKNQT 220

Query: 199 QIESWDMDR----LESLCDSGKLIPKLIDNTW 226
            +E     R    LE L D+   I    DN +
Sbjct: 221 TVEMHIYRRYREELEILADTCGSINPNRDNAY 252

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           C+ CQSYKP RS HC  C++CVL+ DHHC W  NCVG  NY +F  FL
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL 184

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
           +C  C  +KP+RSHHC +CN+C L  DHHCPW  +C+GF N   F++FL +  + +  +F
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 CMQVKRI 145
                +I
Sbjct: 169 IAATLQI 175

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           L +PN  C+ CQ  KP RS HC  CNQCVL +DHHC W  NCVG  NY +F  FL
Sbjct: 128 LFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C+ C+ ++P RS HC  CN CV++ DHHC W  NC+G RNY  FL FL   ++++ IL
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIIL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 67/149 (44%), Gaps = 12/149 (8%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           N C  C   KP RS HC  C  C+L+ DHHC W  NC+G  NY +F  FL    ++ S  
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYA 196

Query: 138 FCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGR 197
           F   ++ +     +  +P    +   ++ L IL+         I  +F      Q+ NG 
Sbjct: 197 F---LRLLHITLSKPDVP----KSKNILALCILTG----SFSVICGVFFYLQMKQVNNGM 245

Query: 198 SQIESWDMDRLESLCDSGKLIPKLIDNTW 226
           +  E+     ++ L   GKLI K  DN W
Sbjct: 246 TTNETDKWYAVQELMREGKLI-KSEDNNW 273

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C  +KP+R HHC +C+ CVL MDHHCPW   C GF+N   F++FL +   TT   F 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAF- 161

Query: 140 MQVKRICFIWQQRSLPGYLFEKS---ELIFLTILSPLDFFVLLTIAILFLRCLS-NQIIN 195
                +  I+    L  +    S   ELI   +L      V + I +L     S  Q+  
Sbjct: 162 -----LVLIYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCK 216

Query: 196 GRSQIESWDMDR 207
            ++ IE   M R
Sbjct: 217 NQTTIEVHGMRR 228

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C  C+ ++P RS HC  CN CV++ DHHC W  NC+G RNY  FL FL   I+++ IL
Sbjct: 173 KYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 76/173 (43%), Gaps = 13/173 (7%)

Query: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIV 132
           + +PN  C+ C   KP RS HC+ CN C+L+ DHHC W  NC+G  NY +F  FL    +
Sbjct: 132 MYYPNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCI 191

Query: 133 TTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQ 192
           T +  F     R+  ++ Q   P      S    LT+L     F ++     FL+     
Sbjct: 192 TMTYSFI----RLFLMYCQGHAP------SSRNILTLLILCGSFAVICAGFTFLQL--QL 239

Query: 193 IINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERDADKLL 245
           + +G +  E      L+     GKLI    +N W I      +    +AD + 
Sbjct: 240 VKDGMTTNEQDKWFTLQEYMRDGKLIRTKDENKWFIANPNDDATITINADTIF 292

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 11/141 (7%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C+ C+  KP RS HC  CN C+ + DHHC W  NCVG  NY +F  FL     +  +L  
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL----CSNLLLLS 191

Query: 140 MQVKRICFIWQQRSLPGY--LFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGR 197
               R+ FI   +S        EKS LI L+IL    F V+L +   F+  L N  +   
Sbjct: 192 YSFIRLIFIQFNKSAYNTTPTGEKSLLI-LSILCG-SFTVILAVYCYFVFELVNSGMTTN 249

Query: 198 SQIESWDMDRLESLCDSGKLI 218
            + + W M  +    ++G L+
Sbjct: 250 EK-DKWQM--VHDYINTGDLV 267

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP+   +  I   +C  C+ ++P R+ HC  CN C++  DHHC W  NCVG RNY +FL 
Sbjct: 175 LPSSSTNSPIQLKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLT 234

Query: 126 FLFWVIVTTSIL 137
           F++  ++T  +L
Sbjct: 235 FIYSAVLTIILL 246

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 7/64 (10%)

Query: 79  FCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL-------FWVI 131
           +C KC+ +KP+R HHC AC++C L  DHHC W   C+G+ N+  FL FL       FW+ 
Sbjct: 170 YCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWIC 229

Query: 132 VTTS 135
           + T+
Sbjct: 230 IITT 233

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP    S  +   +C+ C+ ++P RS HC  C+ CV+ +DHHC W  NCVG RNY +FL 
Sbjct: 182 LPIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLI 241

Query: 126 FLFWVIVTTSILF 138
           FL   I+T   L 
Sbjct: 242 FLTSTIMTVIFLL 254

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C+ C+ ++P R+ HC  CN CV++ DHHC W  NCVG RNY  FL FL   I ++  L
Sbjct: 173 KYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C  C+ ++P RS HC  CN CV++ DHHC W  NC+G RNY  FL FL   I ++ +L
Sbjct: 173 KYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILL 232

Query: 138 F 138
            
Sbjct: 233 L 233

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 38/72 (52%)

Query: 66  LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           LP   P   I   +C  C+ ++P RS HC  C  C++  DHHC W  NC+G RNY  FL 
Sbjct: 203 LPTGNPESTINIKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLT 262

Query: 126 FLFWVIVTTSIL 137
           FL     T+  L
Sbjct: 263 FLLSGTFTSIFL 274

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFC 139
           C  C+  KP RS HC  CN+C+L+ DHHC W  NC+G  NY  F  FL   IV+ S  F 
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 140 MQVKRICFIWQQRS 153
               R+C I  + S
Sbjct: 196 ----RLCSISLKSS 205

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           CK C+  KP RS HC  C+QC+L+ DHHC W  NC+G  N+ +F  FLF
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 59  YTNAGRPLPNYRPSPL--IWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 116
           Y++   P P     PL  I   +C  C+ ++P R+ HC  C  CV+  DHHC W  NCVG
Sbjct: 158 YSSISLPTPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVG 217

Query: 117 FRNYPHFLRFLFWVIVTTSIL 137
            RNY +F+ FL   ++    L
Sbjct: 218 QRNYRYFIIFLIGTVLAELFL 238

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 53/98 (54%), Gaps = 6/98 (6%)

Query: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIV 132
           L +PN  C+ C   KP RS HC  C +CVL+ DHHC W  NC+G  NY  F  FL   ++
Sbjct: 131 LYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVI 190

Query: 133 TTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTIL 170
           + S  F     R+ +I   +     ++ +S LIF TIL
Sbjct: 191 SLSYGFL----RVLWISVMKDPSMVVYPRSILIF-TIL 223

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C  C+ ++P R+ HC  C  CVL  DHHC W  NCVG RNY +FL FL      +S L
Sbjct: 158 KYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLL-----SSTL 212

Query: 138 FCMQVKRICFIWQQRSL 154
            C  +   C +   R+L
Sbjct: 213 ACALLIANCALHLHRAL 229

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF--WVIVTTS 135
            +C  C+ ++P R+ HC  C  C+L  DHHC W  NC+G RNY +FL FL   W+     
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVIC 230

Query: 136 ILFC 139
           I+ C
Sbjct: 231 IVSC 234

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 54  YYLAIYTNAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMN 113
           YY  I    G PL        I   +C  C+ ++P R+ HC  C  C++  DHHC W  N
Sbjct: 151 YYNMITLPTGNPL-----IANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNN 205

Query: 114 CVGFRNYPHFLRFLFWVIVTTSILFCMQVKRI 145
           C+G RNY +F  FL   ++ T+ +      R+
Sbjct: 206 CIGQRNYHYFFTFLVSCVIATAFIIANCAIRV 237

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138
           C  C++ K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FLF  I + S  F
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF 194

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSI 136
            +C  C+ ++P R+ HC  C  CVL  DHHC W  NC+G RNY +FL FL    + T++
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTL 234

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 71  PSPL----IWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRF 126
           PSP+    +   +C  C+ ++P R+ HC  C+ C+L  DHHC W  NC+G RN+ +FL F
Sbjct: 174 PSPVANAPVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAF 233

Query: 127 LFWVIVTTS-ILFCMQVK 143
           LF  ++++  +L C  +K
Sbjct: 234 LFSSVLSSIWLLTCCALK 251

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
            +C  C+ ++P R+ HC  C  C+L  DHHC W  NC+G RNY +F+ FL   I+++  L
Sbjct: 179 KYCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFL 238

Query: 138 FCMQVKRICFIWQQRSLPG 156
                     I+  R+LP 
Sbjct: 239 I---ANCSIHIYHHRNLPS 254

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 2/124 (1%)

Query: 62  AGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYP 121
           A  P   Y+  P  +P +C +CQS K ER+HH  A   CV   DH+C W    +G  NY 
Sbjct: 105 AVLPPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYL 164

Query: 122 HFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTI 181
            FL+F+ +  +  SI++   V  I  I ++R    +    + LI + + + L +  L T+
Sbjct: 165 LFLQFVAYYAINLSIIWVSIVSYIHMIIRKRPNQPHHHFNTNLIIILVFAILGW--LFTV 222

Query: 182 AILF 185
            + F
Sbjct: 223 GLFF 226

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 59  YTNAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFR 118
           YTN  R LP    +  I   +C  C  ++P R+ HC  C  C+ + DHHC W  NCVG R
Sbjct: 170 YTNTIR-LPVANKNHSIELKYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNR 228

Query: 119 NYPHFLRFLFWVIVTT 134
           NY +F+ FL   I+++
Sbjct: 229 NYRYFIIFLVGAILSS 244

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 108/259 (41%), Gaps = 30/259 (11%)

Query: 6   KWPWLGIAIPTFLISFIGYGAHYF-------ILSNFLSISKQLLFELSLSMIWVSYYLAI 58
           ++ W   AIP F +S   Y    F       I S    + + L+  ++LS   ++  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  Y-----TNAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMN 113
           +     T A   L  Y          C+ C+  K  R+ HC  C+QCV + DHHC W  N
Sbjct: 107 WIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANN 166

Query: 114 CVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPL 173
           C+G  NY +F  FL   +  T+  F     R+ F+  QR          +L+ L+IL   
Sbjct: 167 CIGRGNYQYFYLFLVSNVFLTNYGFL----RLLFL--QR-----FVHSRQLLILSILLGC 215

Query: 174 DFFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEAR 233
            F V+L +   F      Q +  R  + + + ++   + D  +    + D+T + Y    
Sbjct: 216 -FGVILAVFSYF------QFVLVRDGMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLL 268

Query: 234 SSQHERDADKLLTQRGRAR 252
           +   E  A+ L   R  ++
Sbjct: 269 ADCQEDSAESLTNPRHSSQ 287

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 66  LPNYRPSP---LIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPH 122
           LP  R +P    I   +C+ C+ ++P R+ HC  C  CV+  DHHC W  NCVG RNY +
Sbjct: 161 LPITRGNPNGDSILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRY 220

Query: 123 FLRFL 127
           F+ FL
Sbjct: 221 FVTFL 225

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           L +PN  CK C+  KP RS HC  C++C+L+ DHHC W  NC+G  NY  F  F+
Sbjct: 128 LYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FL
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 80/181 (44%), Gaps = 31/181 (17%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL----FWVIVTTS 135
           C  C   KP RS HC  CN+C+L+ DHHC W  NC+G  NY  F  FL    F ++    
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFL 195

Query: 136 ILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQIIN 195
            L+C+ +        + +LP        ++ LTIL     F ++ I   +L     Q+  
Sbjct: 196 RLWCISLN------SKTALP------RAVLTLTILCGC--FTIICIIFTYL-----QLTI 236

Query: 196 GRSQIESWDMDR---LESLCDSGKLIPKLIDNTWRIYPEARSSQHERDADKLLTQRGRAR 252
            R  + + + D+   ++     GKL+  L DN    + +      E D  K LTQ   A 
Sbjct: 237 VREGMTTNEQDKWYTIQEYMREGKLVRSLNDNCQSWFLKLT----EDDTTK-LTQDQHAT 291

Query: 253 F 253
           F
Sbjct: 292 F 292

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 67  PNYRPSPLIW--PNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFL 124
           P ++P  +I+     C+ C++ K  RS HC  C +C+ + DHHC W  NCVG+ NY +F 
Sbjct: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173

Query: 125 RFL 127
            FL
Sbjct: 174 SFL 176

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  FL 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 105/259 (40%), Gaps = 32/259 (12%)

Query: 62  AGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYP 121
           + +P   Y+     +P +C  CQS K  RSHH K   +C+L  DH+C W    +   NY 
Sbjct: 100 STKPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYR 159

Query: 122 HFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTI 181
            FL+++ W      +L    +    FI     L G       +I   ILS L + + L +
Sbjct: 160 LFLQYVGWF---NLLLLWYWLTIAVFIRTIGMLNG------NVIVGFILSCLGWMMTLGL 210

Query: 182 AILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERDA 241
            I  +  +SN     ++ IE+ D +R        K    ++ N      E   ++ E + 
Sbjct: 211 FISHIYYMSNN----KTSIETLDAER-----GKRKKHKMMVTN-----DEIEHARIEYNR 256

Query: 242 DKLLTQRGRARFDELVSFPYN-FNPC-------TNAILYLGP-IRLWLWPYGTPAGDGNS 292
                   + +F  +V    + F  C        NA  +LG  I  WL+P+G+   D   
Sbjct: 257 KYFCYYNQQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDLRK 316

Query: 293 FPKNDISQYEVNSPLEDII 311
              +    Y  +  LE+II
Sbjct: 317 REASSFQSYGQSYDLENII 335

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 99/233 (42%), Gaps = 29/233 (12%)

Query: 57  AIYTNAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 116
           ++  +A  P   Y+  P  +P +C  CQS K ERSHH      C+   DH+C W    +G
Sbjct: 108 SVEYDAVIPPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIG 167

Query: 117 FRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFF 176
             NY  F++F  +    +S+L  M V    FI   R++  +    +        SPL+  
Sbjct: 168 RDNYRPFVQFTGYF---SSLLLIMWVSICVFI---RNITQHHHNHN--------SPLNAN 213

Query: 177 VLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQ 236
           V LT+A           I G     S     +  +C +   +  ++D+  + +   +   
Sbjct: 214 VFLTLAFA---------IFGWLFTTSMLASNIFYMCQNKTYLEAIMDSKRKNFGTRKIFC 264

Query: 237 HERDADKL--LTQRGRARFDELVSFPYNFNPCTNAILYLGP-IRLWLWPYGTP 286
           +  +A+KL  + +  R  F    S    F    N   ++GP + +WL P+G P
Sbjct: 265 YYSEANKLRFVVEFERTEFHSFWSKKTIF---ANIKDFMGPNMLMWLIPFGKP 314

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           Y+  P  +P +C  CQS K ERSHH +    CV   DH+C W    +G +NY  F++++ 
Sbjct: 116 YQCDPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVM 175

Query: 129 WV---IVTTSILFCMQVKRI 145
           +    +VT S+   + +KRI
Sbjct: 176 YFTIYLVTASLTIALFMKRI 195

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 5/131 (3%)

Query: 65  PLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFL 124
           P   Y+     +P +C  C+  K  RSHH    N C+   DH+C W    +G  NY  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAIL 184
            FLF+  V+  I++   +  +C++   R           L+ L IL  + +F    +A L
Sbjct: 164 IFLFYCTVSFGIMWISAI--VCYLKYGRHYQEQNNFDGNLVTLVILGAMGWFF---VAGL 218

Query: 185 FLRCLSNQIIN 195
            L  +S  + N
Sbjct: 219 LLAHISYMVRN 229

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 19/179 (10%)

Query: 67  PN-YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLR 125
           PN Y+  P  +P +C  CQS K  R+ H      CV   DH+C W    +GF+NY  F++
Sbjct: 102 PNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQ 161

Query: 126 FLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILF 185
           F+F+  V   +L  + +    +I   R     L   + LI L I+S + + +   + + +
Sbjct: 162 FVFYFAV---LLMIVWITISVYIRDIRQYHARL--NANLIVLLIISGIGWLMTSGLFVSY 216

Query: 186 LRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERDADKL 244
           +  +S  +    + IE  D+ +        K  P+L  +  R+Y    S  H R   KL
Sbjct: 217 IYYMSQNL----TSIEVIDLKK-------RKRTPEL--SMQRLYCYYNSDDHYRYVVKL 262

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHF 123
           C+ C+  KP RS HC  C +CV + DHHC W  NCVG  NY  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%)

Query: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           C+ C+  K  RS HC  C +C  + DHHC W  NC+G  NY +F  FL
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL 178

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 106/264 (40%), Gaps = 43/264 (16%)

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           +A  P   Y+  P  +P +C  CQS K ER+HH      CV   DH+C W    +G  NY
Sbjct: 113 DAVIPPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNY 172

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICF----IWQQRSLPGYLFEKSELIFLTILSPLDFF 176
             F++F+ +     SIL  +    IC     I Q+    G                ++  
Sbjct: 173 RLFVQFVAYF----SILLLIMWASICVYTKEITQRHHSQG--------------PRINVN 214

Query: 177 VLLTIAILFLR-CLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSS 235
           V+LT+A   L   L+   +       S +   LE++ DS +   K    T +I+    S 
Sbjct: 215 VMLTLAFAILGWLLTTSTLGSAIFYMSQNKTSLEAIMDSKR--KKF--GTRKIF----SY 266

Query: 236 QHERDADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGP-IRLWLWPYGTP-------A 287
             E +  + + +  R+ F    +F        N   ++GP + +WL P G P        
Sbjct: 267 YSESNKLRFVVEFDRSEFH---AFWSKKTILANVKDFMGPNMLMWLIPLGKPFILSSKTD 323

Query: 288 GDGNSFPKND-ISQYEVNSPLEDI 310
              NS P    ++  E+  P E++
Sbjct: 324 EVDNSLPSGQRVTLTEILGPYEEL 347

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 120/303 (39%), Gaps = 51/303 (16%)

Query: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120
           +A  P   Y+  P  +P +C +CQS K ER+HH      C+   DH+C W    +G  NY
Sbjct: 112 DAVVPPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNY 171

Query: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180
             F++F  +    +++L  M V    +I   R +  +    S  +   I+S L F +L  
Sbjct: 172 RLFVQFAAYF---STLLLIMWVSICVYI---RIITQHNHNYSPNLNANIISTLVFAILGW 225

Query: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240
           +       L+  ++       S +   LE++ DS +          + +   +   +  +
Sbjct: 226 L-------LTASLLASSIFYMSQNKTSLEAIIDSKR----------KKFGTRKIFCYYSE 268

Query: 241 ADKLLTQRGRARFD--ELVSFPYNFNPCTNAILYLGP-IRLWLWPYGTP-----AGDGNS 292
           A+KL   R    FD  E  SF    +   N   ++G  I +W+ P G P       DG S
Sbjct: 269 ANKL---RFVVEFDRSEFHSFWDKKSILANIKDFMGSNILMWIIPLGKPYTSRCKSDGKS 325

Query: 293 FPKNDISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQH 352
             K  +   E+  P E+                +S++    IE     GE +   R +  
Sbjct: 326 GSKTTL--VEILGPYEE---------------TLSDYTIQAIEDKISRGEYLATLRASGD 368

Query: 353 GSD 355
            SD
Sbjct: 369 DSD 371

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 10/121 (8%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRF-- 126
           Y+  P  +P +C  CQS K ER+HH      CV   DH+C W    VG +NY  F++F  
Sbjct: 116 YQCDPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSM 175

Query: 127 -LFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILF 185
             F+  V   I  C  +K I    +  S P        ++ L IL  + F   L +  LF
Sbjct: 176 YFFFYFVIVLIPVCKYLKDIIHHNRHTSPP----VNPNILVLLILCAIGF---LMVTPLF 228

Query: 186 L 186
           L
Sbjct: 229 L 229

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%)

Query: 60  TNAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRN 119
           T + +P   Y+  P  +P +C  CQS K  R+HH      C+   DH+C W    VG +N
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 YPHFLRFLFW 129
           Y  F++F F+
Sbjct: 165 YRLFVQFAFY 174

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 76  WPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTS 135
           +P +C  C+S K  R+HH K    C+   DHHC W    +G  NY  F +F+F+    + 
Sbjct: 120 YPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SC 176

Query: 136 ILFCMQVKRICFIWQQRSLP--GYLFEKSELIFLTILSPLDFFVLLTIAILFLRCLSNQI 193
           +L    +  + +I +    P  GY  + + ++ L +  P   F ++T++ LFL  +    
Sbjct: 177 LLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP---FSIMTLS-LFLSHVYFTF 232

Query: 194 INGRSQIESWDMDRLESL 211
           +N R+ +E  ++ R + L
Sbjct: 233 MN-RTSLEIINIKRNKKL 249

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           Y+  P  +P +C  CQS K  R+HH      C+   DH+C W    VG +NY  F++F F
Sbjct: 121 YQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAF 180

Query: 129 W-------VIVTTS 135
           +       VIV+T+
Sbjct: 181 YFWAFAIFVIVSTA 194

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           Y+  P  +P +C  CQS K ER+HH +    CV   DH C +  + +G  NY  F+++  
Sbjct: 116 YQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCV 175

Query: 129 WVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLTIAILFLRC 188
           ++ +  +I++   V  I  I +     G       LI + IL+ L +  + ++ +  L C
Sbjct: 176 FMTIWLAIIWTSIVAYIRSITRDYRGHGSHLN-GNLIAILILTTLFWITVTSLLLTQLNC 234

Query: 189 LSNQIINGRSQIESWDMDR 207
               I+  ++ IE  +  R
Sbjct: 235 ----IVKNKTSIEVMERRR 249

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%)

Query: 62  AGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYP 121
           + +P   Y+  P  +P +C  CQS K ER HH +    C+   DH+C W    +G  NY 
Sbjct: 99  STKPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYR 158

Query: 122 HFLRFLFW 129
            F++++F+
Sbjct: 159 LFIQYVFY 166

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 74  LIWPNF-CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           L +PN  C+ C + K  RS HC  C +C+ + DHHC W   C+G  N+ +F  FL
Sbjct: 132 LYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           Y+  P   P +C  C S K ER+HH      CV   DH C W    +G  NY  F++F+ 
Sbjct: 116 YQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVM 175

Query: 129 WVIVTTSILF---CMQVKRI 145
           ++ + +  +F   C  ++RI
Sbjct: 176 YMAILSLFVFVPICAFIRRI 195

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 67  PNYRPSPLIW-------PNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRN 119
           P     PLI+       P +C  CQS K  R+HH      CV   DH+C W    +G  N
Sbjct: 106 PQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGN 165

Query: 120 YPHFLRFLFWV 130
           Y  F++FL ++
Sbjct: 166 YLLFIQFLVYM 176

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%)

Query: 69  YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           Y+  P  +P +C  CQS K ER+HH      CV   DH+C W    +G  NY  F++F+ 
Sbjct: 126 YQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVT 185

Query: 129 W 129
           +
Sbjct: 186 Y 186

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 76  WPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTS 135
           +P +C  CQS K  R+HH      CV   DH+C W    +G  NY  F++F F++ +   
Sbjct: 124 YPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVL 183

Query: 136 ILFCMQVKRICFIWQQRSLPG 156
           IL       I    Q R + G
Sbjct: 184 ILM------ISIATQMRQMKG 198

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%)

Query: 76  WPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTS 135
           +P +C  CQS K  R+HH      CV  +DH+C W    +G RNY  F +FL   ++   
Sbjct: 118 YPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHAL 177

Query: 136 ILF 138
           I+F
Sbjct: 178 IIF 180

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    KP RS      N  V   DH+CPW  N +G +N+  F+ F+  V +   I 
Sbjct: 461 NFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGILIF 520

Query: 138 FCMQVKRICFI 148
            C+ +K   F+
Sbjct: 521 VCLTMKYFDFL 531

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           NFC +  + KP RS +    N  V   DH+CPW  N VG +N+  FL F+ 
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 67/157 (42%), Gaps = 19/157 (12%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    KP RS         V   DH CPW  N +G +N+  FL F   V     + 
Sbjct: 443 NFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTVQYHMFLF 502

Query: 138 --FCMQ-VKRICFIWQQRSLPGY----LFEKSELIFLTILSPLDFFVLLTI--------A 182
              C+   KR   I++Q  + GY    LF+   L   +   P  FF+ + +        A
Sbjct: 503 MWLCLAYFKRTNHIYEQ--VDGYARCALFKNETLCKGSNYDPSTFFLFIWVSVNFLWLGA 560

Query: 183 ILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIP 219
           +L ++C   QI+ G +  E + + + E    S  LIP
Sbjct: 561 MLIVQCF--QILKGITVPELFILIKEERRAKSFSLIP 595

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV 130
           NFC +  + KP RS +    N  V   DH CPW  N VG +N+ +F+ F+  V
Sbjct: 472 NFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           NFC +  + KP RS      N  V   DH+CPW  N VG +N+  F+ F+
Sbjct: 469 NFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    KP RS      N  V   DH+CPW  N +G RN+  FL  +  V +   + 
Sbjct: 462 NFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILMLLF 521

Query: 138 --FCMQ 141
              CM+
Sbjct: 522 NYLCME 527

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           NFC +  + KP RS      N  V   DH+CPW  N VG +N+  F+ F+
Sbjct: 470 NFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 15/115 (13%)

Query: 42  LFELSLSMIWVSYYLAIYTNAGRPLPNYRPSPLIWP-------------NFCKKCQSYKP 88
           +F +S+  +   +Y  I +N GR   N+    +                +FC +    KP
Sbjct: 417 IFGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKP 476

Query: 89  ERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVT--TSILFCMQ 141
            RS         V   DH+CPW  N +G RN+  F+ F+F+  VT  + ++ C +
Sbjct: 477 LRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVIVCFE 531

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 15/155 (9%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    KP RS +       V   +H+CPW  N +G +N+  F+ F F V     + 
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQYEMFLF 488

Query: 138 --FCMQ-VKRICFIWQQ-RSLPGYLFEKSE-LIFLTILSPLDFFVLLTIA--------IL 184
              C++  K+   I++Q        F K+E L   +   P  FF+ + I+        +L
Sbjct: 489 MWLCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMNFVWLGGML 548

Query: 185 FLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIP 219
            ++C   QI  G +  E + + + E   ++  LIP
Sbjct: 549 IVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           +FC +  + KP RS +    N  V   DH+CPW  N VG +N+  F+ F+
Sbjct: 470 SFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIV 132
           NFC +    KP RS +    +  V   DH CPW  N +G +N+  F+ F+  +++
Sbjct: 477 NFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 56/137 (40%), Gaps = 15/137 (10%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           +FC      KP RS   +     ++  DH CPW  N VG  N+  F+ FL  ++   S  
Sbjct: 452 HFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCF 511

Query: 138 FCMQVKRI------------CFIWQQRSLPGYLFEKSELIFL--TILSPLDFFVLLTIAI 183
           F   ++              C I+      G+  +    + L  T++  +  F L+ + +
Sbjct: 512 FIACIEYFDFLEDESKTDFKCGIFDDEICAGFHLDTFAFLVLSWTLIQAVWVFFLIAVQL 571

Query: 184 L-FLRCLSNQIINGRSQ 199
               + ++NQ +N  S+
Sbjct: 572 FQTFKGITNQELNSASR 588

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           NFC +    KP RS      N  V   DH+CPW  N VG +N+  F+ F+
Sbjct: 470 NFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           +FC       P RS +  A N  +   DH+CPW  N +GF N+  FL F+ ++ +   I 
Sbjct: 454 HFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFIF 513

Query: 138 FCMQVKRICFIWQ 150
             + ++     WQ
Sbjct: 514 VRLSIRYFELEWQ 526

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSI 136
           NFC +    KP RSH        V   DH CPW  N +G +N+ +F+    W I+ T +
Sbjct: 455 NFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEV 509

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    KP RS +       V   DH+CPW  N VG +N+  F+   F V V   + 
Sbjct: 446 NFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFV--FFAVTVQYHMF 503

Query: 138 FCMQVKRICFIWQQRSLPGYLFEKSE 163
             M    +C  + +++   Y++E+ E
Sbjct: 504 LFMW---LCLAYFKKT--NYIYEQVE 524

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128
           +FC +    KP RS +    +  +L  DH+CPW  N VG +N+  F+ F+ 
Sbjct: 454 SFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           +FC +    KP RS         +   DH+CPW  N VG +N+  FL F+  + V   I 
Sbjct: 460 HFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAVWIF 519

Query: 138 --FCMQ 141
              C++
Sbjct: 520 AHLCLE 525

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRF 126
           +FC       P R+ + +  +  +L  DH+CPW  N +GFRN+  F+ F
Sbjct: 446 HFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV 130
           NFC +    KP R       ++ VL  DH+CPW  N VG  N+  F+ ++  V
Sbjct: 458 NFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127
           +FC      KP RS         V   DH CPW  N +G RN+  FL F+
Sbjct: 450 HFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFI 499

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 64/155 (41%), Gaps = 15/155 (9%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSIL 137
           NFC +    K  RS +       V   DH+CPW  N +G +N  H L   F + V   + 
Sbjct: 440 NFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFAMTVQYHMF 497

Query: 138 FCM-----QVKRICFIWQQ-RSLPGYLFEKSE-LIFLTILSPLDFFVLLTIAILF----- 185
             M       K+   I++Q        F K+E L   +   P  FF+ + I++ F     
Sbjct: 498 LFMWLSLAYFKKTNHIYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISVNFVWLGA 557

Query: 186 -LRCLSNQIINGRSQIESWDMDRLESLCDSGKLIP 219
            L     QI+ G +  E + + + E   ++  LIP
Sbjct: 558 MLSVQFFQILKGITTPELFTLIKEERRAETFNLIP 592

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWV---IVTT 134
            FC K    KP R    K   Q V   DH+C W  N VG +N+  ++ FL  +   ++T 
Sbjct: 403 TFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTF 462

Query: 135 SIL-----FCMQVKRICFIWQQRSLPGYLFEKSELIFL 167
            +L       M+    CF++  R++  + ++  +++FL
Sbjct: 463 GVLNWRYFGLMEKTAECFLF-NRTIICHGYKNLKVVFL 499

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 182 AILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERDA 241
           A+LF     N I +GR    S+DM +  SL      IPKL D+  RI  E  S +   + 
Sbjct: 534 AVLF-----NNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEE--SVRSAENF 586

Query: 242 DKLLTQRGRARFD 254
           DK+    G+ + +
Sbjct: 587 DKICVLLGKPKLE 599

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 78  NFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSI 136
           +FC       P RS + +     +   DH CPW  N +G  N  H L ++F V++  S+
Sbjct: 466 HFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLLEISV 522

>TBLA0D03600 Chr4 complement(890231..891691) [1461 bp, 486 aa] {ON}
           Anc_1.532 YKL211C
          Length = 486

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 135 SILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSP--LDF 175
           SI+ C+  KR+  +  Q  +PGY FE  E  F   L+P  LDF
Sbjct: 214 SIMNCIYAKRMEDVTAQSKIPGYTFEDLEANFKLGLAPPVLDF 256

>KAFR0E02650 Chr5 (538042..542328) [4287 bp, 1428 aa] {ON} Anc_8.442
            YDR227W
          Length = 1428

 Score = 32.3 bits (72), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 312  LSLPWPPDGNKTKAVSNHNNSTIETYNEG-GEQIVRSRNAQHGSDAIREKWYNDWGESLD 370
            ++LP   D + TK    ++ S+ ET N     +I + R  +  SDA + +W +DW E+L 
Sbjct: 1004 INLPTHFDSSNTKNSIGNSISSFETDNSTIASRIDKLRQNKVSSDA-KSQWIHDWSEALK 1062

Query: 371  DFGV 374
             + V
Sbjct: 1063 TYNV 1066

>ZYRO0F17072g Chr6 complement(1419910..1422795) [2886 bp, 961 aa]
           {ON} similar to Saccharomyces cerevisiae YLR187W SKG3
           Protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cell periphery,
           cytoplasm, bud, and bud neck; potential Cdc28p substrate
           And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
           YNL278W CAF120 Part of the evolutionarily-conserved
           CCR4- NOT transcriptional regulatory complex involved in
           controlling mRNA initiation, elongation, and degradation
          Length = 961

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 65  PLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHH--------CPWTMNCVG 116
           PL NY P P++         +Y P++SHH K  N      +HH         P+ MN V 
Sbjct: 831 PLTNYPPQPMMKQVGGFPSYNYPPQQSHHRKYPNP-----NHHRPHVYGPPRPYPMNGVP 885

Query: 117 FRNY 120
            RNY
Sbjct: 886 NRNY 889

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.470 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,329,373
Number of extensions: 1959687
Number of successful extensions: 7056
Number of sequences better than 10.0: 133
Number of HSP's gapped: 7100
Number of HSP's successfully gapped: 133
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)