Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_15.1586.29ON1555155572800.0
YOL004W (SIN3)6.29ON1536155759490.0
Suva_15.1716.29ON1561101445520.0
Smik_15.1666.29ON1566101744820.0
TDEL0G044006.29ON1490136738620.0
NCAS0D021306.29ON1434130136590.0
KNAG0F029206.29ON1492135635830.0
Kwal_56.224626.29ON1541123934090.0
Kpol_1037.226.29ON1496111032130.0
ZYRO0C07524g6.29ON167099831540.0
KAFR0A051206.29ON147999229930.0
Ecym_30336.29ON1474100128580.0
CAGL0E02475g6.29ON149396328190.0
ACL004W6.29ON137798728170.0
SAKL0E01540g6.29ON141596828010.0
KLTH0C10956g6.29ON143393827970.0
TPHA0J004006.29ON151297127680.0
KLLA0C06182g6.29ON151996127480.0
TBLA0E031606.29ON173982727240.0
NDAI0C026606.29ON1657100527140.0
CAGL0J11594g6.29ON9373656245e-66
Suva_15.170singletonON1611153002e-30
Kpol_1064.538.403ON48969890.12
Suva_8.2618.623ON75683773.2
TPHA0H010805.88ON828116764.6
TDEL0E006903.60ON83365764.7
Skud_11.2202.497ON1483116756.0
KAFR0A04880na 1ON344102728.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_15.158
         (1555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  2808   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  2296   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1758   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1731   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1492   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1414   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1384   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1317   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1242   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1219   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1157   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1105   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1090   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1089   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1083   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1082   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1070   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1063   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1053   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1050   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   244   5e-66
Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004...   120   2e-30
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    39   0.12 
Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W ...    34   3.2  
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    34   4.6  
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    34   4.7  
Skud_11.220 Chr11 complement(402296..406747) [4452 bp, 1483 aa] ...    33   6.0  
KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {O...    32   8.6  

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 2808 bits (7280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1392/1555 (89%), Positives = 1392/1555 (89%)

Query: 1    MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLXXXXXXXXXXXXXXXXITLPSLSALN 60
            MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPL                ITLPSLSALN
Sbjct: 1    MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLQGRQPSFPGQQQQQQRITLPSLSALN 60

Query: 61   ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQXXXXXXXXXXXXXXXX 120
            ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQ                
Sbjct: 61   ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQSHEYHPHPKSSSSSPS 120

Query: 121  LKTAVVDXXXXXXXXXXXXXXXXXXXXSFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK 180
            LKTAVVD                    SFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK
Sbjct: 121  LKTAVVDTAPATTLAPALAPLPTAGGASFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK 180

Query: 181  ANQQQIQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQVK 240
            ANQQQIQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQVK
Sbjct: 181  ANQQQIQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQVK 240

Query: 241  FQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIEC 300
            FQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIEC
Sbjct: 241  FQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIEC 300

Query: 301  STNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNV 360
            STNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNV
Sbjct: 301  STNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNV 360

Query: 361  YRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQSLPVQEDAKKNVDVEFSQAI 420
            YRSEQSQDQKQSLPLSANSVGLSS            LQGQSLPVQEDAKKNVDVEFSQAI
Sbjct: 361  YRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQGQSLPVQEDAKKNVDVEFSQAI 420

Query: 421  SYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 480
            SYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP
Sbjct: 421  SYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 480

Query: 481  DSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLY 540
            DSSASAN                                                  FLY
Sbjct: 481  DSSASANQQVQHAQQHAQQQQEAQMHAQTQAQAQVQAHAQAEVEQQQQKHQQKQQPQFLY 540

Query: 541  PASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGP 600
            PASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGP
Sbjct: 541  PASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGP 600

Query: 601  NMVHQGIANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLD 660
            NMVHQGIANENLPISDLRTSLTDQYAPSTF     NPPSISPITDLQYGDVPVRPEIDLD
Sbjct: 601  NMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPVRPEIDLD 660

Query: 661  XXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 720
                           DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL
Sbjct: 661  PSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 720

Query: 721  VEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSD 780
            VEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSD
Sbjct: 721  VEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSD 780

Query: 781  TFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 840
            TFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE
Sbjct: 781  TFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 840

Query: 841  SNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 900
            SNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA
Sbjct: 841  SNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 900

Query: 901  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL 960
            LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL
Sbjct: 901  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL 960

Query: 961  LTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAY 1020
            LTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAY
Sbjct: 961  LTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAY 1020

Query: 1021 SNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRPYQQE 1080
            SNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENV              RKRPYQQE
Sbjct: 1021 SNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSESSGSDDGGSSTSRKRPYQQE 1080

Query: 1081 MSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVE 1140
            MSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLD               ARNPWLTGNLVE
Sbjct: 1081 MSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVE 1140

Query: 1141 EANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAK 1200
            EANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAK
Sbjct: 1141 EANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAK 1200

Query: 1201 DLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTI 1260
            DLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTI
Sbjct: 1201 DLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTI 1260

Query: 1261 DKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFR 1320
            DKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFR
Sbjct: 1261 DKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFR 1320

Query: 1321 IELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLER 1380
            IELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLER
Sbjct: 1321 IELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLER 1380

Query: 1381 LIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIA 1440
            LIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIA
Sbjct: 1381 LIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIA 1440

Query: 1441 NDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENEVKE 1500
            NDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENEVKE
Sbjct: 1441 NDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENEVKE 1500

Query: 1501 LKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKIQY 1555
            LKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKIQY
Sbjct: 1501 LKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKIQY 1555

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 2296 bits (5949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1167/1557 (74%), Positives = 1257/1557 (80%), Gaps = 24/1557 (1%)

Query: 1    MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLXXXXXXXXXXXXXXXXITLPSLSALN 60
            MSQVWHNSNSQ NDVATSNDA  SNER++KEP L                ITLPSLSAL+
Sbjct: 1    MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQR---ITLPSLSALS 57

Query: 61   ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQXXXXXXXXXXXXXXXX 120
              +EDRRD NG Q L SHA HILGY P HSN +PSI+TDSALKQ                
Sbjct: 58   TKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALKQPHEYHPRPKSSSSSPS 117

Query: 121  LKTAVVDXXXXXXXXXXXXXXXXXXXXSFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK 180
            +  ++++                    SFSLSRFDNPLPI   V T++ KSYNG+QEEEK
Sbjct: 118  INASLMNAGPAPLPTVGAA--------SFSLSRFDNPLPIKAPVHTEEPKSYNGLQEEEK 169

Query: 181  ANQ--QQIQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDE-DPDYRPLNVKDALSYLE 237
            A Q  Q  ++       A+A +PSSN+ D +   NN  ++ + D DYRPLNVKDALSYLE
Sbjct: 170  ATQRPQDCKEVPAGVQPADAPDPSSNHADANDDNNNNENSHDEDADYRPLNVKDALSYLE 229

Query: 238  QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 297
            QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR
Sbjct: 230  QVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 289

Query: 298  IECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVP 357
            IECS+NPDDPIRVTTPMGTTTVNNN+SPSGRGT D QE  S  E DGN +Q   N+PMVP
Sbjct: 290  IECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVP 349

Query: 358  SNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQSLPVQEDAKKNVDVEFS 417
            S+VY+SEQ+QDQ+QSLPL A S GL S             Q QSL  QEDAKKNVDVEFS
Sbjct: 350  SSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFS 409

Query: 418  QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK 477
            QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK
Sbjct: 410  QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK 469

Query: 478  FLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 537
            FLPDSSASAN                                                  
Sbjct: 470  FLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQKQQQQ---------- 519

Query: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597
            FLYPAS YY H +NRG+PQQNLPPIGSFSPPTNGSTVH+ YQDQQHMQPPH +PLPS+VQ
Sbjct: 520  FLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQ 579

Query: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEI 657
            HGPNMVHQGIANEN P+SDLRTSLT+QYAPS+      +P SISPI + QYGD+PVRPEI
Sbjct: 580  HGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPVRPEI 639

Query: 658  DLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 717
            DLD               +NISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 640  DLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 699

Query: 718  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 777
            DDLVEKVDFYLGSNKELF+WFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 700  DDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 759

Query: 778  KSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 837
            KSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 760  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 819

Query: 838  YIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 897
            YIESNLRTIQCLETIVNKIENMTE+EK++FKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 820  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 879

Query: 898  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 957
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD
Sbjct: 880  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 939

Query: 958  KKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHT 1017
            KKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IFYDIL LAD+FI+HT
Sbjct: 940  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHT 999

Query: 1018 TAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRPY 1077
            TAYSNPDKERLKDLLKYFISLFFSI  EKIE++L  HK+NV              RKRPY
Sbjct: 1000 TAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRPY 1059

Query: 1078 QQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGN 1137
            QQEMSLLDILHR+RYQKLKRSNDE+GK+PQLSEP +               A+NPWLTGN
Sbjct: 1060 QQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGN 1119

Query: 1138 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVT 1197
            LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMN ++TKE+NTRSTVT
Sbjct: 1120 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVT 1179

Query: 1198 FAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1257
            FAKDLDLLS+QL EMGLDF+GEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL
Sbjct: 1180 FAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1239

Query: 1258 YTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIEN 1317
            YTIDKVTQSLVKHAHTLM D KTAEIMALFVKDRNA TTSAKDQIIYRLQVRS+MSN EN
Sbjct: 1240 YTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTEN 1299

Query: 1318 MFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF 1377
            MFRIE +KR+LHVS+QYIALDDLTLKEPKADEDKWKYYVTSY LPHPTEGI HEKLKIPF
Sbjct: 1300 MFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF 1359

Query: 1378 LERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYP 1437
            LERLIEFGQD DG EVDEEFSPEGIS+STL+IKIQPITY+LHIENGSYDVFTRKA NKYP
Sbjct: 1360 LERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYP 1419

Query: 1438 TIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENE 1497
            TIAND+  K MV QK  LIS+FL+ A+  RN+L+EA K  MQ+K   LK   AK +  N+
Sbjct: 1420 TIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQ 1479

Query: 1498 VKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKIQ 1554
              E +TE+    KQEQ  NL +S A+V+ +SI+  PQ  N E   +   S+K  KIQ
Sbjct: 1480 GIESETEKGKITKQEQSDNLDSSTASVLPASITTVPQDDNIETTGNTESSDKGAKIQ 1536

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1758 bits (4552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 841/1014 (82%), Positives = 905/1014 (89%)

Query: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597
            FLYPAS+YY+HSTN G+PQQNLPPIGSFSPPTNGST H+ +QDQQHMQPPHL+PLPSMVQ
Sbjct: 544  FLYPASNYYSHSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQ 603

Query: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEI 657
             GPNMVHQGI NEN+P+SDLRTSLTDQYAPS F       PSISPI D QYGDVPVRPEI
Sbjct: 604  QGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEI 663

Query: 658  DLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 717
            DLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL
Sbjct: 664  DLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDL 723

Query: 718  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLP 777
            DDLVEKVDFYLGSNKELFSWFKNFVGYQEK K IEN+VHEKHRLDLDLCEAFGPSYKRLP
Sbjct: 724  DDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLP 783

Query: 778  KSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 837
            KSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF
Sbjct: 784  KSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF 843

Query: 838  YIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 897
            YIESNLRTIQCLETIVNKIENMTE+EK++FKLPPGLGHTSMTIYKKVIRKVYDKERGFEI
Sbjct: 844  YIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEI 903

Query: 898  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQAD 957
            IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQAD
Sbjct: 904  IDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQAD 963

Query: 958  KKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHT 1017
            KKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFI+HT
Sbjct: 964  KKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHT 1023

Query: 1018 TAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRPY 1077
            TAYSNPDKERLKDLL YFISLFFSIPLEKIE+ALQ +K+N+              RKRPY
Sbjct: 1024 TAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRPY 1083

Query: 1078 QQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGN 1137
            QQEMSLLDILHR++YQKLKRSNDE+GK+PQLSEPLD               A+NPWLTGN
Sbjct: 1084 QQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGN 1143

Query: 1138 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVT 1197
            LVEEANSQGIIQNR+IFNLFAN+NIYIFFRHWTTIYERLLEIKQMN K+TKE++ RS VT
Sbjct: 1144 LVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVT 1203

Query: 1198 FAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1257
            FAKDLDLLS+QL EMGLDF GEDAYKQVL+LSRRLING+LEHQWFEE LRQAYNNKAFKL
Sbjct: 1204 FAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKL 1263

Query: 1258 YTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIEN 1317
            YTIDKV Q LVKHAHTLM D KTAEIMALFVKDRNA TTSAKDQIIYRLQ RSYMSN EN
Sbjct: 1264 YTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTEN 1323

Query: 1318 MFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF 1377
            MFR+E ++R+LHVSVQYIALDDLTLKEP+ADEDKWKYYVTSY LPHPTEGISHEKLKIPF
Sbjct: 1324 MFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPF 1383

Query: 1378 LERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYP 1437
            LERLIE+GQDTDGREVDE+FSPEG+S+STL+IKIQP+TYKLHIE+GSYDVFTRKA NKYP
Sbjct: 1384 LERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYP 1443

Query: 1438 TIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENE 1497
            T+ANDD+HKEMVV+KT LIS+FL+NAIR RNDLNE  K  MQEKL  LKG T K + +++
Sbjct: 1444 TVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKADVDDK 1503

Query: 1498 VKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKET 1551
            +   K E+ + AK+EQ +NLPTSD +V+ SSI+N PQ  N E   + GP +KET
Sbjct: 1504 ITVAKNEKAIEAKEEQQENLPTSDMHVLPSSIANVPQDDNTEVTGNTGPFDKET 1557

 Score =  483 bits (1242), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/332 (77%), Positives = 275/332 (82%), Gaps = 9/332 (2%)

Query: 160 INTSVCTKDSKSYNGVQEEEKANQQQIQDQR--PAA-HSANASEPSSNYVDTSYSVNNEN 216
           +N    T+D KS+NG+ EEEKANQ  +QD +  PAA   A+A+E S+ Y DT   +N EN
Sbjct: 1   MNALGRTEDRKSFNGLPEEEKANQP-VQDHKRAPAAVQPADAAEVSNVYADTKDEINAEN 59

Query: 217 SNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 276
           +NDEDPDYRPLNVKDALSYLEQVKFQF+SRPDIYNLFLDIMKDFKSQAIDTPGVIERVST
Sbjct: 60  TNDEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVST 119

Query: 277 LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEP 336
           LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSP  R  ++ QEP
Sbjct: 120 LFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEP 179

Query: 337 SSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQS-LPLSANSVGLSSXXXXXXXXXXX 395
           SSL E DG+ I   HN+PMVPSNVY SEQSQDQ+Q  LPL AN  GL S           
Sbjct: 180 SSLPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIP-- 237

Query: 396 XLQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 455
             Q Q L  QED KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN
Sbjct: 238 --QSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 295

Query: 456 EVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 487
           EVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN
Sbjct: 296 EVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 327

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1731 bits (4482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 840/1017 (82%), Positives = 895/1017 (88%), Gaps = 2/1017 (0%)

Query: 538  FLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ 597
            FLYPASSYY HS NRG+PQQNLPPIGSFSPPTNGSTVH+NYQDQQHMQPPHL+PLPSMVQ
Sbjct: 551  FLYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQ 610

Query: 598  HGPNMVHQGIANENLPISDLRTSLTDQYAPSTFXXXXX-NPPSISPITDLQYGDVPVRPE 656
            HG N+VHQGIANENLP+SDLRTSLT+QYAPS        +P SISPI + QYGDVPVRPE
Sbjct: 611  HGANIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPE 670

Query: 657  IDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 716
            IDLD               DNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD
Sbjct: 671  IDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILD 730

Query: 717  LDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRL 776
            LDDLVEKVDFYLGSNKELFSWFKNFVGYQE+TK IENIVHEKHRLDLDLCEAFGPSYKRL
Sbjct: 731  LDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRL 790

Query: 777  PKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 836
            PKSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 791  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 850

Query: 837  FYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 896
            FYIESNLRTIQCLETIVNKIENMTE+EK +FKLPPGLGHTSMTIYKKVIRKVYDKERGFE
Sbjct: 851  FYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFE 910

Query: 897  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 956
            IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA
Sbjct: 911  IIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQA 970

Query: 957  DKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISH 1016
            DKKLLTTKQLISEI+SIKVDQTNKKIHWLTPKPKSQLDFDFPDK+IF DILYLADSFISH
Sbjct: 971  DKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISH 1030

Query: 1017 TTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRP 1076
            TTAYSNPDKERLKDLLKYFISLFFSI LE+IE++LQ +K++V              RKR 
Sbjct: 1031 TTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKRS 1090

Query: 1077 YQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTG 1136
            YQQEM+LLDILHR+RYQKLKRS DE+GK+PQLSE  D               A+NPWLTG
Sbjct: 1091 YQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTG 1150

Query: 1137 NLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTV 1196
            NLVEEANSQG+IQNR IFNLFANTNIYIFFRHWTTIYERLLEIKQMN K+TKE+NTRSTV
Sbjct: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210

Query: 1197 TFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFK 1256
            TFAKDLDLLSNQL EMGLDFIGEDAYKQVL+LSRRLINGDLEHQWFEESLRQAYNN+AFK
Sbjct: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270

Query: 1257 LYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIE 1316
            LYTIDKVTQSLVKHAHTLM D KTAEIMALFVKDRN  TTSAK QIIYRLQVRS+MSN E
Sbjct: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330

Query: 1317 NMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIP 1376
            NMFRIE +KR+LHVS+QYIALDDLTLKEPK DEDKWKYYVTSY LPHPTEG+ HEKLKIP
Sbjct: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390

Query: 1377 FLERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKY 1436
            FLERLIEFGQD DG++VDE+FSPEGIS+STL+IKIQP TYKL IENGSYDVFTRK+ NKY
Sbjct: 1391 FLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKY 1450

Query: 1437 PTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDEN 1496
            PT+ANDD HKE+VVQK  LISRFL+ A+  RNDLNE+ K  MQEK   LK  TAK+N + 
Sbjct: 1451 PTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVDG 1510

Query: 1497 EVKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGPSEKETKI 1553
            +V + K EE    KQEQ +NL +SDA+V  SS S+ PQ  N E   S G S+ ETKI
Sbjct: 1511 QVVDTKIEEATKTKQEQQENLASSDASVF-SSTSDVPQDDNIEVMRSTGLSDTETKI 1566

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/497 (66%), Positives = 361/497 (72%), Gaps = 15/497 (3%)

Query: 1   MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLXXXXXXXXXXXXXXXXITLPSLSALN 60
           MSQVWHN NSQ NDVATSNDAA SNER+++                    ITLPSLSALN
Sbjct: 1   MSQVWHNPNSQSNDVATSNDAAGSNERNERNEKEPLLQGNQSSFVQQQQRITLPSLSALN 60

Query: 61  ANDEDRRDYNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQXXXXXXXXXXXXXXXX 120
             +E+ RD NG  PLASH THILGY P H NIIPSI++DS  KQ                
Sbjct: 61  NKEENGRDSNGQLPLASHGTHILGYPPTHPNIIPSITSDSTFKQSHEYQPHPKSSSSSPS 120

Query: 121 LKTAVVDXXXXXXXXXXXXXXXXXXXXSFSLSRFDNPLPINTSVCTKDSKSYNGVQEEEK 180
           + T+V++                    SFSLSRFDNPLPIN  V T+ S+SYN  QEEEK
Sbjct: 121 INTSVMNAASASAPAPLPTAGGA----SFSLSRFDNPLPINAPVHTEGSQSYNCPQEEEK 176

Query: 181 ANQQQIQDQRPAAHSANASEPSSN----------YVDTSYSVNNENSNDEDPDYRPLNVK 230
           A+QQ  QD +  +  A  ++ + +            + + + NNEN N+EDPDYRPLNVK
Sbjct: 177 ASQQ-TQDHKEVSAGAQPTDATKSANDHIDTNDDNNNNNSNNNNENFNEEDPDYRPLNVK 235

Query: 231 DALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNT 290
           DALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNT
Sbjct: 236 DALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNT 295

Query: 291 FLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPF 350
           FLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN+SP  RGT+D QEPSSL E DGN  Q  
Sbjct: 296 FLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEADGNGTQRS 355

Query: 351 HNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQSLPVQEDAKK 410
           HN+PMVPSNVY SEQ+QDQ+Q LPLSA S GL S             Q Q L VQED KK
Sbjct: 356 HNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLAVQEDVKK 415

Query: 411 NVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPD 470
           NVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPD
Sbjct: 416 NVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPD 475

Query: 471 LLEDFKKFLPDSSASAN 487
           LLEDFKKFLPDSSASAN
Sbjct: 476 LLEDFKKFLPDSSASAN 492

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1492 bits (3862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/1367 (57%), Positives = 943/1367 (68%), Gaps = 110/1367 (8%)

Query: 221  DPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 280
            D  YRPLNVKDALSYLEQVK+QF+SRPD+YN FLDIMKDFKSQAIDTPGVI+RVSTLF+G
Sbjct: 188  DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 281  YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLS 340
            YP LIQGFNTFLPQGYRIECS NPD+PIRVTTPMG+++V         GT++        
Sbjct: 248  YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSV--------AGTIE-------- 291

Query: 341  EPDGNAIQPFHNLPMV--------------PSNVYRSEQSQDQKQSLPLSANSVGLSSXX 386
                NA+  F   P +              P +V    Q      + P   N        
Sbjct: 292  ----NAVAGFPAQPRIQQLQQLGQQQEQSLPEHVLPGVQVTTSATTTPTLNNQQPQPQPR 347

Query: 387  XXXXXXXXXXLQ---GQS--LPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 441
                      LQ   GQ   LP  +  KK  DVEFSQAI+YVNKIK RFA+QPDIYKHFL
Sbjct: 348  PQLPADYQLPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFL 407

Query: 442  EILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXX 501
            EILQTYQREQKPINEVYAQVT LFQNAPDLL+DFKKFLPDSS SAN              
Sbjct: 408  EILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSP 467

Query: 502  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLYPASSYYNHSTNRGVPQQNLPP 561
                                                  +  S+YYN  T+    +QNLPP
Sbjct: 468  A-------------------------------------FGLSAYYNE-TSPPTSRQNLPP 489

Query: 562  IGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQ--------HGPNMVHQGIANENLP 613
            +GSFSPP NG+  H+ Y+DQQ    P  + LP + Q          P++  QGIA E +P
Sbjct: 490  LGSFSPPPNGAVPHNYYRDQQ----PQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMP 545

Query: 614  ISDLRTSLTDQYAPSTFXXXXXNP--PS--ISPITDLQYGDVPVRPEIDLDXXXXXXXXX 669
            +S+LR+ +T Q +PS           PS   + I D QY D+ VRPEIDLD         
Sbjct: 546  VSNLRSQITAQ-SPSELAQLHQQQQIPSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPE 604

Query: 670  XXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLG 729
                  D+++L EE +FF++AK++IGNK +YTEFLKILNL+SQD+LD+D+LV +V+ YLG
Sbjct: 605  PTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLG 664

Query: 730  SNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRD 789
             NKELF WFKNFVG+Q+K K IENIVHEKHRLDLDLCEA GPSYK+LPKSDTFMPCSGRD
Sbjct: 665  GNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRD 724

Query: 790  DMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCL 849
            +MCW +LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ L
Sbjct: 725  EMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTL 784

Query: 850  ETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTA 909
            ETI +KI NM+E EK+ FKLPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALHE+PA+  
Sbjct: 785  ETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAV 844

Query: 910  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISE 969
            PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISE
Sbjct: 845  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISE 904

Query: 970  INSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLK 1029
            I SIK DQTNK++HWLTPKPK QLD+  PDK +F+DIL L D+FI+H ++YSNPDK RLK
Sbjct: 905  IGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLK 964

Query: 1030 DLLKYFISLFFSIPLEKIEKALQFHK---ENVXXXXXXXXXXXXXXRKRPYQQEMSLLDI 1086
            DL K F+SLFFSIP+ ++ +A+       ++                KRP + E+SL ++
Sbjct: 965  DLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPREDEISLSEV 1024

Query: 1087 LHRNRYQKLK-RSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQ 1145
            LHR + Q+ K R+ DE  +                        A+ PWL GNLVEE N+Q
Sbjct: 1025 LHRAKNQRFKSRAADETSEESAAEP----EPELNEEEETIRQEAKKPWLLGNLVEEVNAQ 1080

Query: 1146 GIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLL 1205
            G+I NR  FN+FANTNIY+FFRH TT+YERL E+K+MN  +TKE+N+R  V FAKDL+L+
Sbjct: 1081 GLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLI 1140

Query: 1206 SNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQ 1265
            S QL EMGLDF G DAY+Q+  L +RLI GD+EHQWFEESLRQAYNNKAFKLYT+DKV Q
Sbjct: 1141 SQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQ 1200

Query: 1266 SLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNK 1325
            SLVKHAHT++ D KT+EIM  F KDR    TSAKDQI+YRLQVRSYMS+ ENMFRIE NK
Sbjct: 1201 SLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNK 1260

Query: 1326 RSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIE-- 1383
            +S +V +Q+IA+DDLTL EP++ E+KW+YYVTSY L HPTEGIS E+L++PFLE+++E  
Sbjct: 1261 QSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETE 1320

Query: 1384 --FGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIAN 1441
              +G D D   +D +FSPEG+S STL+IKI P TY L IE GSYDVF+RK+VN++P I +
Sbjct: 1321 EDYGSDVDNFSID-KFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVD 1379

Query: 1442 DDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENEVKEL 1501
             + +     +K  ++ +FLE+    + +L++     +QEKLA +K     ++D NE  + 
Sbjct: 1380 SNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKE-NGSLDDFNEASQT 1438

Query: 1502 KTEEDLAA--KQEQPKNLPTSDANVITSSISNAPQYGNAEAGESPGP 1546
            +   ++ A  K EQ K    +D N +   +  A   GN    +   P
Sbjct: 1439 QQASEIIAPSKVEQSKESTVADVNSLPKELVEAEDRGNDTTADEVDP 1485

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1414 bits (3659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/1301 (56%), Positives = 900/1301 (69%), Gaps = 125/1301 (9%)

Query: 220  EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279
            +D  YRPLNVKDALSYLEQVK+QFS RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFR
Sbjct: 203  QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 280  GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSL 339
            GYP+L+QGFNTFLPQGYRIEC+T+PD PIRVTTPMGT+T++        G    + PSS 
Sbjct: 263  GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS--------GGPAMEAPSS- 313

Query: 340  SEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQG 399
            SE +    Q  H  P +PS                L+A++   S+               
Sbjct: 314  SESNLQQ-QQHHQSPTIPS----------------LAASTFQESNF-------------- 342

Query: 400  QSLPVQED-AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 458
            Q  P  ED + KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY
Sbjct: 343  QQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVY 402

Query: 459  AQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 518
            +QVT LFQ+APDLL+DFKKFLP+SS + +                               
Sbjct: 403  SQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQ------ 456

Query: 519  XXXXXXXXXXXXXXXXXXXFLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNY 578
                               + YP ++YY + T     QQNLPPIGSF+PP NG+   +  
Sbjct: 457  -------------------YGYP-NNYYPNGTGT---QQNLPPIGSFAPP-NGTASREYA 492

Query: 579  QDQQHMQPPHLVPLPSMVQHG--------PNMVHQGIANENLPISDLRTSLTDQYAPSTF 630
               Q + P  L   PSM+ +         P +VH G  NE +P+S+LR+ LTDQ  P+  
Sbjct: 493  PGNQFVGPGGL---PSMIPNDQALQQQQQPGLVH-GYTNEAIPVSNLRSPLTDQQYPNLL 548

Query: 631  XXXXXNPP-------SISPITDLQYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEE 683
                   P       + +P+      + P+RPEIDLD                N+SL EE
Sbjct: 549  NMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEE 608

Query: 684  VTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG 743
              FFEKAK++IG K +YTEFLKILNLYSQD+L  D+L  KV++YLGSN+ELF+WFKNFVG
Sbjct: 609  TNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG 668

Query: 744  YQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGH 803
            +QEK   IENIVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWE+LNDEWVGH
Sbjct: 669  FQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGH 728

Query: 804  PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESE 863
            PVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQ LETI NKI NMT  E
Sbjct: 729  PVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEE 788

Query: 864  KSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEW 923
            K +FKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID LHE PA+T PVVLKRLKQKDEEW
Sbjct: 789  KKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEW 848

Query: 924  RRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIH 983
            RRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEI+SIKVDQTNK+IH
Sbjct: 849  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 908

Query: 984  WLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIP 1043
            WLTPKPKSQL+F F D DIF DIL L   FI+H++ YSNP+KER+KD L+ F+SLFFSIP
Sbjct: 909  WLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIP 968

Query: 1044 LEKIEKALQFHKENVXXXXXXXXXXXX-------------XXRKRPYQQEMSLLDILHRN 1090
            L+K+ +AL      +                           +KRP   ++ L DIL ++
Sbjct: 969  LDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKH 1028

Query: 1091 RYQKLKRS-----------NDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLV 1139
            +YQK+++             D+E  +   +E L+                + PWL GN++
Sbjct: 1029 KYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEE----IKRPWLLGNII 1084

Query: 1140 EEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFA 1199
            E A++ G I NR +FN+FANTNIY+FFR WT IYERL E+KQ+N K+TKEVN+R    FA
Sbjct: 1085 ETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFA 1144

Query: 1200 KDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYT 1259
            KDL+L+S QL +MGLDF+G ++Y+++L LS+RLI  D+EHQWFEESLRQA+NNKAFKLYT
Sbjct: 1145 KDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYT 1204

Query: 1260 IDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMF 1319
            +DKV QSLVKHAHT++ DVKT+EIM LF KDR   +TSAK+QI+YRLQ R++M+N ENMF
Sbjct: 1205 VDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMF 1264

Query: 1320 RIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLE 1379
            RIE N+   HV +QYIAL+DLT+K+PK+ E  W+YYVTSY LPHPTEG+  ++LKIPFLE
Sbjct: 1265 RIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLE 1324

Query: 1380 RLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTI 1439
            + +E   D +G   D + SPEG+S S L+IKI P +Y L IE GS+D+F+RK++N YPT 
Sbjct: 1325 KTLELEVDEEG---DNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTY 1381

Query: 1440 ANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQE 1480
            +++   ++ + Q T    +FL+     + +L  A  + +++
Sbjct: 1382 SDETKKRKSIDQMT----KFLDGKNGWKKNLTTADSTNIED 1418

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1384 bits (3583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1356 (54%), Positives = 905/1356 (66%), Gaps = 116/1356 (8%)

Query: 221  DPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 280
            D  YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 281  YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLS 340
            +P LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG   V  NV   G      Q+P+   
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENVR--GSDITADQQPA--- 326

Query: 341  EPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQ 400
                        LP        + QS  Q    P  +  + L S             Q  
Sbjct: 327  ---------IGQLP--------TTQSPIQASLPPPQSAHLHLPSTVAAATTVQ----QSA 365

Query: 401  SLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 460
            ++  + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYAQ
Sbjct: 366  NVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQ 425

Query: 461  VTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 520
            VT LF NAPDLL+DFKKFLPD S+++N                                 
Sbjct: 426  VTVLFHNAPDLLDDFKKFLPD-SSASNEQQPKQSPYSPQVYSGADMARG----------- 473

Query: 521  XXXXXXXXXXXXXXXXXFLYPASS-YYNHSTNRGVPQQNLPPIGSFSPPTNG----STVH 575
                             ++Y  +  YY    N+  PQ NLPPIGSFSPP NG    +   
Sbjct: 474  -----------------YMYNNTGVYYPPQVNQ--PQSNLPPIGSFSPPANGVAPTTGTA 514

Query: 576  DNYQDQQHMQPPHLVPLPSMV----QHGPNMVHQGIANENLPISDLRTSLT----DQY-- 625
              + D+QH+    +  +P+M     QH P+M++    N+ + IS++R   T    +QY  
Sbjct: 515  IPHADEQHV----VAGVPAMAPHEQQHAPSMIN----NDGIQISNMRGGGTVPALNQYGM 566

Query: 626  -APSTFXXXXXNPPSISPITDLQY-------------GDVPVRPEIDLDXXXXXXXXXXX 671
             +P  +                Q              GD+ VRPEIDLD           
Sbjct: 567  ISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDLDPSIVPVVPEPT 626

Query: 672  XXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSN 731
                +N+SL+EE +FFEK K+ IGN+ +Y EFLK+LNL+SQD++ +D+LV KV+ YL   
Sbjct: 627  EPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQ 686

Query: 732  KELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDM 791
             ELF WFKNFVGYQ+K K IEN++HEKHRLDLDLCEA+GPSYK+LPKSDTFMPCSGRDDM
Sbjct: 687  PELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDM 746

Query: 792  CWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLET 851
            CWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LET
Sbjct: 747  CWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLET 806

Query: 852  IVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPV 911
            I +KI NMTE EK+ FKLPPGLGHTS+TIYKK+IRKVYDKERGFEIID LHEHPA+T P+
Sbjct: 807  IASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPI 866

Query: 912  VLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEIN 971
            VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEI+
Sbjct: 867  VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEIS 926

Query: 972  SIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDL 1031
            SIKVDQ NK++HWLTPKPK QLD+ F D DI +DI+ L D F+ H + YSNPDKERLKDL
Sbjct: 927  SIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDL 986

Query: 1032 LKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRPYQQ-EMSLLDILHRN 1090
             + FISLFF IP + I  AL   K +               +KRP    E+SL DILHR 
Sbjct: 987  FRVFISLFFFIPRDLISAALD-TKSDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRA 1045

Query: 1091 RYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQN 1150
            +YQKLK      G+   +SE  D               A  PWL G++VE ANS G++ +
Sbjct: 1046 KYQKLKN-----GEGLGMSEDDDEEKLAKEAEEMSEKNASKPWLVGDIVERANSHGLVTD 1100

Query: 1151 RSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLP 1210
            R+++NLF NTN+YIF RHW+T+Y RLLE+KQM+ ++TKE+N R  V FA+DL+LLS QL 
Sbjct: 1101 RAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLR 1160

Query: 1211 EMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKH 1270
            +MGLDF G++AY++ L+LS+RLI  +LEHQWFEESLRQAYNNKAFKLYT+DKV  SLVKH
Sbjct: 1161 DMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKH 1220

Query: 1271 AHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHV 1330
            AHTLM D K++E+M LF KDR   +T  KDQI+YRL  RS+MS+ ENMFR++ NK + HV
Sbjct: 1221 AHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHV 1280

Query: 1331 SVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDT-D 1389
            S+QYI LDD+TL++ K D ++W YY+TSY LPHPTEGI  +KL +PFLER++EF  D  D
Sbjct: 1281 SIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLD 1340

Query: 1390 GREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMV 1449
                 + ++P G S S L+I I P TYKL I++GSYD+F+R ++N+YP   +   + +MV
Sbjct: 1341 VEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMV 1400

Query: 1450 VQKTALISRFLENAIRSRNDLNEATKSGMQ--EKLALLKGVTAKVNDENEVKELKTEEDL 1507
             ++     +FL+     + DL++   + ++  +K+ALL           E K++ T    
Sbjct: 1401 EKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALL---------SEETKDVGTLSTP 1451

Query: 1508 AAKQEQPKNLPTSDANVITSSISNAPQYGNAEAGES 1543
               ++  +N       V  +  SNA   G +  G++
Sbjct: 1452 VTTEKGAENTVHGLQPVALAENSNASTMGTSTVGDA 1487

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 7/115 (6%)

Query: 183 QQQIQDQRPAAHSANASEPS----SNYVDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQ 238
           Q  IQ   P   SA+   PS    +  V  S +V+ EN   +  D   +    A+SY+ +
Sbjct: 334 QSPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKAND---VEFSQAISYVNK 390

Query: 239 VKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLP 293
           +K +FS +PDIY  FL+I++ ++ +      V  +V+ LF   P L+  F  FLP
Sbjct: 391 IKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLP 445

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1317 bits (3409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1239 (55%), Positives = 847/1239 (68%), Gaps = 66/1239 (5%)

Query: 220  EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279
            +D  YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 245  QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

Query: 280  GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTT---TVNNNVSPSGRGTVDGQ 334
            GYP+LIQG NTFLPQGY+IEC++NP DP  I+VTTP  TT   ++++N   S  G     
Sbjct: 305  GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVG----- 359

Query: 335  EPSSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVG-----LSSXXXXX 389
                L+ P   +  P   +P   + V  ++Q ++    LP SA           S     
Sbjct: 360  --GHLAGPATVSTSP-SQIPRQETAVSETKQ-EETPVDLPASAAFAQDQVHHAESDTQRE 415

Query: 390  XXXXXXXLQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 449
                    Q Q        + N DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQR
Sbjct: 416  IQKSAQLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQR 475

Query: 450  EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXX 509
            EQKPI+EVY QVT LFQNAPDLL+DFKKFLPD++A A+                      
Sbjct: 476  EQKPIHEVYTQVTSLFQNAPDLLDDFKKFLPDATA-AHEQHQQLLQQQQQQQQLQHQIQL 534

Query: 510  XXXXXXXXXXXXXXXXXXXXXXXXXXXXFLYPASSYYNHSTNRGVPQQNLPPIGSFSPPT 569
                                        F +PAS +Y H   R    QNLPP+G+FSPP 
Sbjct: 535  QQQQSQQYQSFQSSPQELDQRQQQSNSPFNHPAS-FYQHQQARA---QNLPPLGNFSPPI 590

Query: 570  NGSTVHDNYQDQQHMQPPHL-VPLPSMVQHGPNMVHQGIANENLPISDLRTSLTDQYAPS 628
            NG   ++   +   +QPP L  P     Q   ++V QG+ N +LP+SD+R  +   +AP 
Sbjct: 591  NGRD-NEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQ 649

Query: 629  TFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFE 688
                            D+QY +   RPEIDLD               ++ +L EE +FF+
Sbjct: 650  PLYSQ-----------DVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFD 698

Query: 689  KAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKT 748
            KAK+Y+GNK +YTEFLKILNL+SQD++D D+LV+KV+ YLG N ELF WFK+FV Y E+ 
Sbjct: 699  KAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERP 758

Query: 749  KCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWAS 808
            K IEN+VHEKHRLDLDLCEA  PSYK+LPK+DTFMPC GRD+MCWE+LNDEWVGHPVWAS
Sbjct: 759  KHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWAS 818

Query: 809  EDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFK 868
            EDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI NKI NMT  EK  FK
Sbjct: 819  EDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFK 878

Query: 869  LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQR 928
            LPPGLGHTS TIYKKVIRKVYDK+RGFEIIDALHE+PAV+ P+VL+RLKQKDEEWRRAQR
Sbjct: 879  LPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQR 938

Query: 929  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPK 988
            EWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQLISEI+SIK+DQ NK+I+  T K
Sbjct: 939  EWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSK 998

Query: 989  PKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIE 1048
            PKSQLDFD  DK + +DIL L D+FI H+T YSNPDKE+L    + F+S+FFSIPL  ++
Sbjct: 999  PKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD 1058

Query: 1049 KALQFHK-ENVXXXXXXXXXXXXXXRKRPYQQEMSLLDIL--------HRNRYQKLKRSN 1099
               + HK EN               RKR    +    D+L         +   Q+ + ++
Sbjct: 1059 NPSEEHKVEN-----------GDSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTS 1107

Query: 1100 DEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFAN 1159
            D++    + S  L+               A+ PWL GN+++EAN+ G + NR  +N+FAN
Sbjct: 1108 DDQDTAAKTSPDLE-------YEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFAN 1160

Query: 1160 TNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGE 1219
            TNIY+FFRH TT+Y+RL E K +N ++TKE+N+R  V FAKDL+L S QL +MGLDF G 
Sbjct: 1161 TNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGA 1220

Query: 1220 DAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVK 1279
            DAY+Q+L L +RLI  D+EHQWFEESLRQAY NKAFK+YT+DKV QSLVKHAH+++ D K
Sbjct: 1221 DAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAK 1280

Query: 1280 TAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDD 1339
            TAEIM LF KDR A TTS ++QI+YRLQVRS M   ENMFRIELN  S HVS+Q++A+DD
Sbjct: 1281 TAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDD 1340

Query: 1340 LTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTDGREVDEEFSP 1399
            LTL +P + +D+W+YY+TSY L HPTEG+ HE++K PFLE+ +    D D  E  E +SP
Sbjct: 1341 LTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTLR--DDGDSDEDSEWYSP 1398

Query: 1400 EGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPT 1438
             G S+S LRI+I P +Y L IE  S D+FTR  VNK+PT
Sbjct: 1399 GGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPT 1437

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1110 (57%), Positives = 774/1110 (69%), Gaps = 69/1110 (6%)

Query: 409  KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 468
            +K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 356  EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415

Query: 469  PDLLEDFKKFLPDSSASANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 528
            PDLL+DFKKFLPDSS S                                           
Sbjct: 416  PDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQP----------------------- 452

Query: 529  XXXXXXXXXFLYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTV---HDNYQDQQHMQ 585
                      +Y  ++ Y  +       QNLPP+G+FSPP+NG+      +   + QH  
Sbjct: 453  ----------MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH-- 500

Query: 586  PPHLVPLPSMVQ----HGPNMVHQGIA---NENLPISDLRTSLTDQ-----YAPSTFXXX 633
              H++ LPSM+Q    H      Q IA   NE +PISDLR+ + D      Y P      
Sbjct: 501  --HMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAQL 558

Query: 634  XXNPPSISPIT----------DLQYG-DVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNE 682
                                 +  Y  +  VRPEIDLD               +++SL E
Sbjct: 559  QQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVE 618

Query: 683  EVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFV 742
            E  FF+KAK++IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFV
Sbjct: 619  EANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFV 678

Query: 743  GYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVG 802
            G+Q+K K IEN+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWE+LNDEWVG
Sbjct: 679  GFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVG 738

Query: 803  HPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTES 862
            HPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE 
Sbjct: 739  HPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEE 798

Query: 863  EKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEE 922
            EK  FKLP GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+E
Sbjct: 799  EKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKE 858

Query: 923  WRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKI 982
            WRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EI+SIKVDQTNK+I
Sbjct: 859  WRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRI 918

Query: 983  HWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSI 1042
            HWLTPKPKSQLD++  DK + +DIL LAD FI+HT++YSNPDKERL+D L+ +I LFFSI
Sbjct: 919  HWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSI 978

Query: 1043 PLEKIEKALQFHKENVXXX-XXXXXXXXXXXRKRPYQQEMSLLDILHRNRYQKLKRSND- 1100
            P+ +I+ A++   +N                 KRP   E+ L DIL+R+RYQ+LK S D 
Sbjct: 979  PIREIKDAVEAAIDNGKQLDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSLDS 1038

Query: 1101 EEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFANT 1160
             E  +  +S                   A+ PWL G+LVEEANSQG+IQNR I+N+FAN 
Sbjct: 1039 SEASLGAVSP---GQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANV 1095

Query: 1161 NIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGED 1220
            N+Y+F R+  TIY+RL E+K +N  +TKE+N R  V FAKDL+L+S QL  MGLDF G D
Sbjct: 1096 NMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGD 1155

Query: 1221 AYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKT 1280
            +Y Q+L LS+RLI GDLEHQWFEESLRQAY N+AFKLYTIDKV QSLVKHAH +M D K+
Sbjct: 1156 SYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKS 1215

Query: 1281 AEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDL 1340
            +++MALF KDR + +T++KDQI+YRLQ RS+MS  E+MFRIE N +   +S+QYIALDDL
Sbjct: 1216 SDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDL 1275

Query: 1341 TLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQ-DTDGREVDEEFSP 1399
            TL+EPK  EDKWKYY+TSY L HPTEGI  E++KIPFL+++IE  Q   +  + + ++SP
Sbjct: 1276 TLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSP 1335

Query: 1400 EGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRF 1459
            EG+S S L IKI P TY+L +E GS+D+F+RK+VNK+P     + +K     +      F
Sbjct: 1336 EGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNF 1395

Query: 1460 LENAIRSRNDLNEATKSGMQEKLALLKGVT 1489
            L      +  L+    S +++K   LK  T
Sbjct: 1396 LNGKHGWKRQLSSDAISKIEQKFNDLKNGT 1425

 Score =  186 bits (472), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 84/99 (84%), Positives = 92/99 (92%)

Query: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 322
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 479 LP 480
           LP
Sbjct: 189 LP 190

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 292 LP 293
           LP
Sbjct: 426 LP 427

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1219 bits (3154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/998 (60%), Positives = 731/998 (73%), Gaps = 59/998 (5%)

Query: 542  ASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQD--QQHMQPP--HLVPLPSMVQ 597
            A+ Y  +  N+ V +QNLPP+GSFSPP NG+   D YQ+  Q    PP  HL    + V 
Sbjct: 612  ATGYGYYGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVT 671

Query: 598  HGPNMVHQGIANENLPISDLRT-------------------------------------- 619
                ++ QG++N+ +P+S++R+                                      
Sbjct: 672  PSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLP 731

Query: 620  ------SLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXXXXXXXXXX 673
                  SL  Q  P T       P  + P  ++QY D+ VRPEIDLD             
Sbjct: 732  PQQQEQSLPPQTIPLT------QPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEP 785

Query: 674  XXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 733
              D++SL EE +FF+KAK++IGNK LYTEFLKILNLYSQD+LD+D LVEKV+ YLG +KE
Sbjct: 786  IEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKE 845

Query: 734  LFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 793
            LF+WFKNFVGYQ++ K IEN++HEKHRLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCW
Sbjct: 846  LFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCW 905

Query: 794  EILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 853
            E+LNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQ LETI 
Sbjct: 906  EVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIA 965

Query: 854  NKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 913
            +KI NMTE EK++FKLPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPAV  PVVL
Sbjct: 966  SKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVL 1025

Query: 914  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSI 973
            KRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEI+SI
Sbjct: 1026 KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 1085

Query: 974  KVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLK 1033
            KVDQTNK+IHWLTPKPKSQLD+DFPD++IF DIL L + F++HT  YSN DKERLKD LK
Sbjct: 1086 KVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLK 1145

Query: 1034 YFISLFFSIPLEKIEKALQFHK---ENVXXXXXXXXXXXXXXRKRPYQQEMSLLDILHRN 1090
             F+SLFFSIP+ ++   L+      +                 KRP + E+ L DILHRN
Sbjct: 1146 SFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRN 1205

Query: 1091 RYQKLK-RSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQ 1149
            +YQKLK RS+ EEG I Q  E LD               A+ PWL GN+VEEAN+QGII 
Sbjct: 1206 KYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIIS 1265

Query: 1150 NRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQL 1209
            NR  FNLFANT+IY+FFRH TT+YERL+E+K ++ ++T+E+N+R    FAKDL+L+S QL
Sbjct: 1266 NRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQL 1325

Query: 1210 PEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVK 1269
              MGLDF G DAY+Q+L LS+RLI GD+EHQWFEESLRQAYNN+AFK YT+DKV Q+LVK
Sbjct: 1326 KNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVK 1385

Query: 1270 HAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLH 1329
            HAHT++ D+K +EIM LF KDR   TTSAKDQI+YR+Q RS+MSN ENMFRIE N+ S H
Sbjct: 1386 HAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKH 1445

Query: 1330 VSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTD 1389
            V +QYIA+DDLTL E K+ EDKWKYYVTSY L HPTEGISHE L++PFLE++IE  Q+ D
Sbjct: 1446 VCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYD 1505

Query: 1390 -GREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEM 1448
                 D +FSPEG+S S+LRIKI P TY L +E GS DVF+RKAVNK+P   N + HK  
Sbjct: 1506 EDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTK 1565

Query: 1449 VVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK 1486
            V +K  LI  +L++    + +L+  +   ++EKL  +K
Sbjct: 1566 VDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVK 1603

 Score =  193 bits (490), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/113 (78%), Positives = 98/113 (86%)

Query: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLFRGYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEP 336
           LIQGFNTFLPQGYRI+CS NPD+PI+VTTPMG++TV      +      GQ+P
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQP 389

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 479 LP 480
           LP
Sbjct: 345 LP 346

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 292 LP 293
           LP
Sbjct: 585 LP 586

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/992 (58%), Positives = 710/992 (71%), Gaps = 78/992 (7%)

Query: 554  VPQQNLPPIGSFSPPTN-GSTVHDNYQDQQHMQPPHLVPLPSMVQH----------GPNM 602
            V QQ+LPPIGSFSPP N G ++HD        Q PH++ LPSM+QH           P +
Sbjct: 474  VAQQSLPPIGSFSPPANTGISMHD------QSQRPHMMALPSMLQHEQIIDMNNHPKPAV 527

Query: 603  VHQGIANENLPISDLRTSLTDQYAPSTFXXXXXNP--PSISPITDLQ------------- 647
              QGI+N+ +P+SD+R +   QY           P  P + P    Q             
Sbjct: 528  STQGISNDEIPVSDVRMA---QYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQ 584

Query: 648  ------------------YGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEK 689
                              Y + PVRPEIDLD                N +L EE +FF+K
Sbjct: 585  LMLQQQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDK 644

Query: 690  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTK 749
            AK++I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K
Sbjct: 645  AKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPK 704

Query: 750  CIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASE 809
             IENIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWE+LNDEWVGHPVWASE
Sbjct: 705  IIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 764

Query: 810  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKL 869
            DSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK +FKL
Sbjct: 765  DSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKL 824

Query: 870  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 929
             PGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQRE
Sbjct: 825  EPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQRE 884

Query: 930  WNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKP 989
            WNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEI+SIKVDQ NK+IHWLTPKP
Sbjct: 885  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKP 944

Query: 990  KSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEK 1049
            KSQL+FD  D +I +DIL L+++FI+H++ YS  DKERL D LK FISLFFS+PL +I  
Sbjct: 945  KSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINN 1004

Query: 1050 AL-----QFHKENVXXXXXXXXXXXXXXRKRPYQQEMSLLDILHRNRYQKLKRSN----- 1099
            AL     Q + E V              R   +  E+S+ DILHR +YQK+K SN     
Sbjct: 1005 ALDKRNNQKNSEKVTDSALPDGTENQKKRSI-HDIELSMSDILHRTKYQKMKLSNRGSDS 1063

Query: 1100 DEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFAN 1159
             EE  I  + +  +               A+ PWL G+++++ N+QGII +R  FNLFAN
Sbjct: 1064 QEENNIDTIIDE-ESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFAN 1122

Query: 1160 TNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGE 1219
            TNIY+F RHWTT+YERLLE+K+MNG++TKE+N R +V FA+DL L+S QL  MGLDF+ +
Sbjct: 1123 TNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDK 1182

Query: 1220 DAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVK 1279
            D+Y+++LRLS+RLI  D+EHQWFEESLRQAYNN+AFKLYT+DKV Q+LVKH HTLM D K
Sbjct: 1183 DSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYK 1242

Query: 1280 TAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDD 1339
            T E+M LF KDR +  TSAKDQI+YRLQ RS+MSN E MFRIE NK   ++ +QYIALDD
Sbjct: 1243 TTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDD 1302

Query: 1340 LTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQ-----DTDGREVD 1394
            LTLKE   +E+KWKYYVTSY LPHPTEGI HE L+IPFL++++EF Q     + +  + +
Sbjct: 1303 LTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSN 1362

Query: 1395 EEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTA 1454
             ++SPEG+S S  +IKI P  Y L I+ GS+D+F+RK++NKYP   N+D     + +K  
Sbjct: 1363 GKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKN 1422

Query: 1455 LISRFLENAIRSRNDLNEATKSGMQEKLALLK 1486
            +++ FLE+        N   K  ++++L+L K
Sbjct: 1423 ILNTFLES--------NNGWKKHLKKQLSLKK 1446

 Score =  306 bits (785), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 177/336 (52%), Positives = 212/336 (63%), Gaps = 63/336 (18%)

Query: 150 SLSRFDNPLPINTSVCTKDSKSYNGVQEEEKANQQQIQDQRPAAHSANASEPSSNYVDTS 209
           S++ FDNPLP                      NQQQ Q   PA H  +  +         
Sbjct: 163 SVASFDNPLP--------------------PLNQQQSQPSFPAMHMRDQQQ-------QQ 195

Query: 210 YSVNNENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPG 269
                  + ++D  YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPG
Sbjct: 196 QMAAAPAAAEDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPG 255

Query: 270 VIERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRG 329
           VIERVSTLFRGYP LIQGFNTFLP GYRI+C +NP+DPI+VTTP+G++T++       R 
Sbjct: 256 VIERVSTLFRGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRA 315

Query: 330 TVDGQEPSSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSA--NSVGLSSXXX 387
             + Q+  +LS+   N +Q                Q+Q     +P+ +  N+  L++   
Sbjct: 316 NSNLQQQQALSQ--NNMMQ----------------QAQ-----IPIGSISNNANLNAA-- 350

Query: 388 XXXXXXXXXLQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTY 447
                    +Q      ++  KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTY
Sbjct: 351 ---------VQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTY 401

Query: 448 QREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSS 483
           QREQKPINEVYAQVT LFQNAPDLL+DFKKFLPDSS
Sbjct: 402 QREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSS 437

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1001 (57%), Positives = 706/1001 (70%), Gaps = 61/1001 (6%)

Query: 558  NLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSM---VQHGPNMVHQGIANENLPI 614
            NLPP+GSFS P           D   M  P LV  P+M     H  +++ QG++N+ +PI
Sbjct: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536

Query: 615  SDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXXXXXXXXXXX 674
            SDLRT+    Y P+ +          S   D QY +   RPEIDLD              
Sbjct: 537  SDLRTTADTSYRPAEY----------SQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPL 586

Query: 675  XDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 734
             D ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    EL
Sbjct: 587  EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPEL 646

Query: 735  FSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 794
            F WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWE
Sbjct: 647  FDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWE 706

Query: 795  ILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 854
            +LNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI N
Sbjct: 707  VLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIAN 766

Query: 855  KIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 914
            KI NMT  EK+ FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VLK
Sbjct: 767  KIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLK 826

Query: 915  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIK 974
            RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLISEI+SIK
Sbjct: 827  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIK 886

Query: 975  VDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKY 1034
            VDQ NK+IH LTPK KSQLD DF D ++FYDIL LA  F+ +   YS PDKERLKD  K 
Sbjct: 887  VDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKG 946

Query: 1035 FISLFFSIPLEKIEKAL------------QFHKENVXXXXXXXXXXXXXXRKRPYQQEMS 1082
            FISLF S P+ +IEKAL              + E                ++     +  
Sbjct: 947  FISLFCSYPVPQIEKALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRL 1006

Query: 1083 LLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEA 1142
            L D+L RN+ QK  R N   G     S                   A+NPWL G++V+EA
Sbjct: 1007 LRDVLFRNKQQKGGR-NSPRGD----SSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEA 1061

Query: 1143 NSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDL 1202
            ++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN ++TKE+  R  V FAKDL
Sbjct: 1062 DNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDL 1121

Query: 1203 DLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDK 1262
            +L+S QL +MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQAY NKAFK+YT+DK
Sbjct: 1122 NLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDK 1181

Query: 1263 VTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIE 1322
            V Q+LVKHAH ++ D KT EIM LF KDR + +TS KDQI+YRLQVRS MSNIENMFRIE
Sbjct: 1182 VIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIE 1241

Query: 1323 LNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLI 1382
             N+ + HV +Q++A+DDLTL+EPK+ +DKW+YY+TSY L HPTEGISH+ L+ PFLE++I
Sbjct: 1242 YNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKII 1301

Query: 1383 EFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIAND 1442
            E  +D    + DE++SPEG++ S L++KI PITY + +E GS+D+F+RKAVNK+P     
Sbjct: 1302 ESEEDIIEDK-DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV-- 1358

Query: 1443 DVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK--GVTAKVNDENEVKE 1500
            D+ K+   +    + RFL +    + DL+    + ++++L  +K  G   + +D++ V  
Sbjct: 1359 DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVAS 1418

Query: 1501 LK-------TEEDLAAKQEQPKNLPTSDANVITSSISNAPQ 1534
                      +ED+A  Q        S++ V+++S++   Q
Sbjct: 1419 TSAVSGSDLAKEDIARSQ--------SESTVVSASMATCAQ 1451

 Score =  184 bits (467), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (95%)

Query: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 317
           LIQGFNTFLPQGY IECS++P+DPI+VTTP GTT
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score =  145 bits (366), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/77 (90%), Positives = 72/77 (93%)

Query: 408 AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 467
            KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 346 GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405

Query: 468 APDLLEDFKKFLPDSSA 484
           APDLL+DFKKFLPD+SA
Sbjct: 406 APDLLDDFKKFLPDASA 422

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%)

Query: 403 PVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 462
           P  +D      +    A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+
Sbjct: 152 PAHQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 211

Query: 463 HLFQNAPDLLEDFKKFLP 480
            LFQ  P L++ F  FLP
Sbjct: 212 TLFQGYPTLIQGFNTFLP 229

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 292 LP 293
           LP
Sbjct: 417 LP 418

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 14/124 (11%)

Query: 186 IQDQRPAAHSANASEPSSNYVDTSYSVNNENSN-DEDPDYRPL------NVKDALSYLEQ 238
           I D R  A ++      S   DT Y   N     D DP   P+       ++D L+ +E+
Sbjct: 536 ISDLRTTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEE 595

Query: 239 VKF-----QFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLP 293
             F     ++     IY  FL I+  +    +D   ++E+V     G P L   F +F+ 
Sbjct: 596 ASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFV- 654

Query: 294 QGYR 297
            GY+
Sbjct: 655 -GYQ 657

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/963 (55%), Positives = 677/963 (70%), Gaps = 51/963 (5%)

Query: 559  LPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGPNMVHQGI----------- 607
            LPPIGSFSPPTNG  V    Q         ++ LPSM+ +   +  Q I           
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 608  ---------------ANENLPISDLRTSLTDQ-YAPSTFXXXXXNPPSISPITDLQYGDV 651
                           +N+++P+S+LRT++ +Q Y P T      N  +   + D  Y   
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGN--AQQHMVDGGYVGT 587

Query: 652  P----VRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 707
            P    VRPEIDLD               ++++L EE  FFE+ K+ IGNK +Y EFLKIL
Sbjct: 588  PSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647

Query: 708  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCE 767
            NL+S D+L +D+LV+KV++Y+G+NKELF WFK FVGYQ+K K IENIVHEKH+LDLDLCE
Sbjct: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707

Query: 768  AFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 827
            A+GPSYK+LPK+DTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767

Query: 828  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRK 887
            IEEERHEYD+YIESNLRTIQ LETI NKI NMT++EK+ F+LPPGLGHTSMTIYKKVIRK
Sbjct: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827

Query: 888  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 947
            VYDKERGFEIIDALH +PA++ P++L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLD
Sbjct: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887

Query: 948  HLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1007
            HLGLTFKQADKKLLTTKQLISEIN IKVDQ +K+IHWLTPKPK+QLD+DFPD DI +DI+
Sbjct: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947

Query: 1008 YLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQ---FHKEN------- 1057
             L   F  +T  YSNPDKER+KD+L+ F+S FFSIPL+++  AL+   F  +N       
Sbjct: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKG 1007

Query: 1058 ------VXXXXXXXXXXXXXXRKRPYQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEP 1111
                  +              +KRP+  ++++ DILH+ + QK K + + +G      + 
Sbjct: 1008 SGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDL 1067

Query: 1112 LDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1171
                              R  WL G++V+ AN +  + NR+I+NLFANTNIYIFFRH  T
Sbjct: 1068 GTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVT 1127

Query: 1172 IYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRR 1231
            +YERL E+KQ+N +I KE+ +R   TFAKDL L+S QL E+GLDF   DAY+Q+L LS+R
Sbjct: 1128 LYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKR 1187

Query: 1232 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDR 1291
            LI GD+EHQWFEES+RQAYNN+AFKLYTIDKV QS VKHAHTL++D KT+EIM LF   R
Sbjct: 1188 LIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQR 1247

Query: 1292 NAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDK 1351
            N   T+ KDQI+YR+Q RS+MS+ ENMFRIE  +   H S+QYIALDDLTLK  K+ E+ 
Sbjct: 1248 NNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEA 1307

Query: 1352 WKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQD-TDGREVDEEFSPEGISLSTLRIK 1410
            W YYVTSY L +PTEG+ HE L++PFLE++IEF Q+ +     +  +S  GIS S L I 
Sbjct: 1308 WNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHID 1367

Query: 1411 IQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENA-IRSRND 1469
            I    Y L ++ GS DV++R  + KYP +A+D+     + +KT  I + L +    S +D
Sbjct: 1368 IDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDD 1427

Query: 1470 LNE 1472
            +NE
Sbjct: 1428 VNE 1430

 Score =  316 bits (810), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 206/310 (66%), Gaps = 58/310 (18%)

Query: 186 IQDQRPAAHSANASEPSSNYVDTSYSVNNENSNDEDP-DYRPLNVKDALSYLEQVKFQFS 244
           +Q+QR    S  ASE S+     S  V+       DP  YRPLNVKDALSYLEQVKFQF 
Sbjct: 151 LQNQRQG--STGASETSTT---QSPLVSGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFH 205

Query: 245 SRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSTNP 304
           +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+GYP LIQGFNTFLPQGYRIECS NP
Sbjct: 206 TRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNP 265

Query: 305 DDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNVYRSE 364
           +DPI+VTTPMG++T   N +P        + PS                   PS++  + 
Sbjct: 266 NDPIKVTTPMGSSTTVLNTAPQ-------KSPS-------------------PSDIQTNN 299

Query: 365 QSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQSLPVQED-------AKKNVDVEFS 417
           Q   Q Q++   A    L S             Q   +P Q D       AKK  DVEFS
Sbjct: 300 Q---QTQAI---AQEAQLQS-------------QATPIPTQHDVGQNFGSAKKPADVEFS 340

Query: 418 QAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKK 477
           QAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT LFQNAPDLL+DFKK
Sbjct: 341 QAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKK 400

Query: 478 FLPDSSASAN 487
           FLPDSSAS +
Sbjct: 401 FLPDSSASGS 410

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/987 (56%), Positives = 694/987 (70%), Gaps = 61/987 (6%)

Query: 556  QQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGPN----------MVHQ 605
            QQNLPP+G+FS P +                 H + LPS+   GPN          +V Q
Sbjct: 392  QQNLPPLGNFSTPGDH----------------HPMSLPSV--QGPNVGLSQGQSGHIVTQ 433

Query: 606  GIANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXX 665
            G++N+++P+SDLR +    +  S +            + D+QY +  VRPEIDLD     
Sbjct: 434  GVSNQHIPVSDLRGAPDASFRASEYNQ----------VQDVQYMEPTVRPEIDLDPSLVP 483

Query: 666  XXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVD 725
                      D ++L EE TFF+KAK++IGNK +YTEFLKILNLYSQD+L+ + LVE V 
Sbjct: 484  VIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVS 543

Query: 726  FYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPC 785
             YL  + ELF WFK+FVGYQE+ K IEN++HEKHRLDLDLCEA GPSYKRLPK+DTFMPC
Sbjct: 544  HYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPC 603

Query: 786  SGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRT 845
            SGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRT
Sbjct: 604  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRT 663

Query: 846  IQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHP 905
            IQ LETI NKI NMT  EK+ FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHP
Sbjct: 664  IQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHP 723

Query: 906  AVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQ 965
            A+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQ
Sbjct: 724  AITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQ 783

Query: 966  LISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDK 1025
            LISEI+SIKVDQ+NK+IH LTPK KSQL +DF + ++F DIL L   F+++   YS  D 
Sbjct: 784  LISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDN 843

Query: 1026 ERLKDLLKYFISLFFSIPLEKIEKALQ---------FHKENVXXXXXXXXXXXXXXRKRP 1076
            ERLKD  K FISLFFS PL +IE+ L           H ++               RKR 
Sbjct: 844  ERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRV 903

Query: 1077 YQQEMSLL-DILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLT 1135
                  LL DIL+RN+ QK+ +    +    Q SE  +               A+ PWL 
Sbjct: 904  RDDTEHLLRDILYRNKQQKVNKGPQND----QSSEEFE-KESDIEEKEIVRQEAKKPWLL 958

Query: 1136 GNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRST 1195
            G++V+EA++ G + +R  FN+FANTNIY+FFRH TT+YERL+E+K++NG++TKE++ R  
Sbjct: 959  GSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKV 1018

Query: 1196 VTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAF 1255
            V FAKDL+L+S QL +MGLDF G DAY+++LRLSR LI+G+LEHQWFEESLRQAY NKAF
Sbjct: 1019 VQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAF 1078

Query: 1256 KLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNI 1315
            KLYTIDKV Q+LVKHAHT++ D KT EIM LF  DR + +TS KDQI+YRLQVRS MSNI
Sbjct: 1079 KLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNI 1138

Query: 1316 ENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKI 1375
            ENMFRIE N  + H S+Q++A++DLTL EPK+  DKW+YY+TSY L HPTEGISH+ L+ 
Sbjct: 1139 ENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRT 1198

Query: 1376 PFLERLIEF--GQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAV 1433
            PFLE++IE   G   DG   DE +SPEG++ S +++KI P+TY + +E G +D+F+RK+V
Sbjct: 1199 PFLEKIIERDEGYIDDG---DERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSV 1255

Query: 1434 NKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVN 1493
            NK+PT    DV K+   +   ++  FL      +  L     +  + +L  +K     ++
Sbjct: 1256 NKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKN-NGTLD 1312

Query: 1494 DENEVKELKTEEDLAAKQEQPKNLPTS 1520
            D  E     T+  L+   +   N+ T+
Sbjct: 1313 DYAEEISTDTKAALSTTTDTAGNVSTA 1339

 Score =  303 bits (777), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 182/261 (69%), Gaps = 35/261 (13%)

Query: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPD 343
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT      +  +G G        + +EP 
Sbjct: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTI---GEIPITGAGGNHAH--GANTEP- 242

Query: 344 GNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQGQSLP 403
              +Q   N+P     VYRS +      + P +                     Q  + P
Sbjct: 243 --RLQSTQNVP----TVYRSAEGSPAAIATPATTQE------------------QYGTGP 278

Query: 404 VQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 463
                KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT 
Sbjct: 279 -----KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 333

Query: 464 LFQNAPDLLEDFKKFLPDSSA 484
           LFQNAPDLL+DFKKFLPDSSA
Sbjct: 334 LFQNAPDLLDDFKKFLPDSSA 354

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 113/288 (39%), Gaps = 56/288 (19%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 292 LPQGYRIECSTNPDDPIRVTTPM-------------GTTTV--NNNVSPSGR-------- 328
           LP     +  ++      +  P              GT  +    N+ P G         
Sbjct: 349 LPDSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHH 408

Query: 329 ------------GTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNVYRSE---QSQDQKQSL 373
                       G   GQ    +++   N   P  +L   P   +R+    Q QD +   
Sbjct: 409 PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQYME 468

Query: 374 PLSANSVGLSSXXXXXXXXXXXXLQGQSLPVQEDAKKNVDVEFS--QAISYVNKIKTRFA 431
           P     + L                   +PV  +  K ++ E +  +  ++ +K K +F 
Sbjct: 469 PTVRPEIDLDPSL---------------VPVIPEPIKPLEDELNLVEEATFFDKAK-KFI 512

Query: 432 DQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 479
               IY  FL+IL  Y ++     ++   V+H    +P+L + FK F+
Sbjct: 513 GNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFV 560

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/968 (57%), Positives = 700/968 (72%), Gaps = 36/968 (3%)

Query: 552  RGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGPNMVHQGIANEN 611
            +  PQQNLPP+GSFSPP++GS     +     +QPP +       QH   ++ QG++N++
Sbjct: 427  QAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPPSMDISGQPQQH---IITQGMSNDD 483

Query: 612  LPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXXXXXXXX 671
            +PIS++R +    Y              +    ++QY +   RPEIDLD           
Sbjct: 484  IPISEVRNTADGAYRSD-----------LRNSGEVQYMEPVARPEIDLDPSLVPVIPEPI 532

Query: 672  XXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSN 731
                + +SL EE +FF+KAK++IGNK +YTEFLKILNLYSQD+LD D+LVEKV++YLG N
Sbjct: 533  EPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGN 592

Query: 732  KELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDM 791
            KELF WFKNFVGY++K K IENIVHEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+M
Sbjct: 593  KELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEM 652

Query: 792  CWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLET 851
            CWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQ LET
Sbjct: 653  CWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLET 712

Query: 852  IVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPV 911
            I NKI NMT  EK+ FKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE P++  P+
Sbjct: 713  IANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPI 772

Query: 912  VLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEIN 971
            VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEI+
Sbjct: 773  VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEIS 832

Query: 972  SIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDL 1031
            +IKVDQ NK+IH LTPKPKSQLD+ F D+++ YDIL LA  FI   T YSNPDKE++ D 
Sbjct: 833  TIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDF 892

Query: 1032 LKYFISLFFSIPLEKIEKALQFHKENVXXX---XXXXXXXXXXXRKRPYQQEMSLLDILH 1088
            LK F+ LFFS P+ ++E A    + ++                 RKR  ++E  L D+L 
Sbjct: 893  LKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLR 952

Query: 1089 RNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGII 1148
            RN+YQK  R+  EE  IP+ SE  +               A+ PWL G++V+EAN  G +
Sbjct: 953  RNKYQK-GRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFV 1011

Query: 1149 QNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQ 1208
            +NR  FN+FANTNIY+FFRH  T+Y RL E+K +N  +T+E+  R  V FAKDL+L+S Q
Sbjct: 1012 ENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQ 1071

Query: 1209 LPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLV 1268
            L +MGLDF G DAY QVL LS+RLI GD+EHQWFEESLRQAY NKAFK+YTIDKV QSLV
Sbjct: 1072 LSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1131

Query: 1269 KHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSL 1328
            KHAHT++ D KT EIM LF KDR    TSAK+QI+YRLQVRS+M+  ENMFRIE N++S 
Sbjct: 1132 KHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQST 1191

Query: 1329 HVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDT 1388
            H S+Q++A+DDLTL+EPK+ ED+WKYYVTSY L HPTEGISHE+L+ PFLE+++E  ++ 
Sbjct: 1192 HASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEF 1251

Query: 1389 DGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEM 1448
                 + E+SPEG+S S L++KI P TY L ++ GSYD F+RK++NK+P   N+D +K  
Sbjct: 1252 QCE--NGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSK 1309

Query: 1449 VVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLKGVTAKVNDENEVKELKTEEDLA 1508
              +K   ++ +L  A             G +  L   K + A    + E++ +KT+  L 
Sbjct: 1310 RGEKAKCLTSYLNGA------------KGWKRGLVASKVLKA----QTEIEYVKTKGTLV 1353

Query: 1509 AKQEQPKN 1516
              + + KN
Sbjct: 1354 GLESKDKN 1361

 Score =  301 bits (772), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 169/275 (61%), Positives = 196/275 (71%), Gaps = 29/275 (10%)

Query: 220 EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279
           +DP YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 280 GYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNVSPSGRGTVDGQEP 336
           GYP LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P     ++ + P
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP-----LEQRYP 268

Query: 337 SS---LSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXX 393
           S+   L  PD   +Q  H++        + +  Q  +        +   +          
Sbjct: 269 SNENVLLSPDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQ-------- 320

Query: 394 XXXLQGQSLPVQED----AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 449
                 Q  P Q+D    AKK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQR
Sbjct: 321 ------QHYPDQQDQHYLAKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQR 374

Query: 450 EQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSA 484
           EQKPINEVYAQVT LFQNAPDLL+DFKKFLPD+SA
Sbjct: 375 EQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASA 409

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 112/270 (41%), Gaps = 32/270 (11%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 292 LPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFH 351
           LP     + +T P  P+   T         N+ P G  +      +   E  G       
Sbjct: 404 LPDASAPQSTTTP-APVNGGTFYPQAAPQQNLPPLGSFSPPSSGSAREGEHVG------- 455

Query: 352 NLPMV-PSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXXXXXXXLQ--GQSLPVQEDA 408
            LP V P ++  S Q Q    +  +S + + +S             L+  G+   ++  A
Sbjct: 456 -LPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVA 514

Query: 409 KKNVD-------------------VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 449
           +  +D                   V   +  S+ +K K +F     IY  FL+IL  Y +
Sbjct: 515 RPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAK-KFIGNKQIYTEFLKILNLYSQ 573

Query: 450 EQKPINEVYAQVTHLFQNAPDLLEDFKKFL 479
           +    +E+  +V +      +L + FK F+
Sbjct: 574 DLLDRDELVEKVEYYLGGNKELFDWFKNFV 603

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/938 (56%), Positives = 681/938 (72%), Gaps = 34/938 (3%)

Query: 548  HSTNRGVPQQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGP-NMVHQG 606
            + T +G PQ NLPP+GSFSPP NG   +D   +   +QPP +      V H P ++V Q 
Sbjct: 460  YQTQQGRPQ-NLPPLGSFSPPINGRE-NDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQV 517

Query: 607  IANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPVRPEIDLDXXXXXX 666
            I    LP+SDLR ++   +AP                 D+Q+ +   RPEIDLD      
Sbjct: 518  IPGGTLPLSDLRGAMDGNFAPQPLQSQ-----------DVQFIEPTSRPEIDLDPSLVPV 566

Query: 667  XXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDF 726
                     ++++L EE +FF++AK+Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ 
Sbjct: 567  IPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEH 626

Query: 727  YLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCS 786
            YLG + ELF WFK+FV Y EK K IEN++HEKHRLDLDLCEA  PSYK+LPK+DTFMPCS
Sbjct: 627  YLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCS 686

Query: 787  GRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTI 846
            GRD+MCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTI
Sbjct: 687  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTI 746

Query: 847  QCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPA 906
            Q LETI NKI NMT  EK  FKLPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PA
Sbjct: 747  QLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPA 806

Query: 907  VTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQL 966
            V+ P++LKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQL
Sbjct: 807  VSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQL 866

Query: 967  ISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKE 1026
            ISEI+SIKVDQTNK+I+  TPKPKSQLD+D  DK + +DIL L ++FI H++ YSNPDKE
Sbjct: 867  ISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKE 926

Query: 1027 RLKDLLKYFISLFFSIPLEKIEKALQFHKENVXXXXXXXXXXXXXXRKRPYQQEMSLLDI 1086
            +L    K F+S+FFSI  ++IE +     + V              RKR ++ E  L ++
Sbjct: 927  KLAAFFKGFLSVFFSISYQEIENSTPADSDAV---------SNSNPRKRLWESEQPLKEL 977

Query: 1087 LH-RNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQ 1145
            L  ++++ K + ++ E+  I       +               A+ PWL GN+++EAN  
Sbjct: 978  LRSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDH 1037

Query: 1146 GIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLL 1205
            G + NR IFNLFANTN+Y+FFRH TT+Y+RL E+K MN ++T+E+N+R+ V FAKDL+L+
Sbjct: 1038 GYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLV 1097

Query: 1206 SNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQ 1265
            S QL +MGLDF G+DAY Q+L L +RLI  D++HQWFEESLRQAY NKAFK+YT+DKV Q
Sbjct: 1098 STQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQ 1157

Query: 1266 SLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNK 1325
            SLVKHAH+++ D K+AEIM LF KDR    TS K+QI+YRLQVRSYM   ENMFR+E+NK
Sbjct: 1158 SLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINK 1217

Query: 1326 RSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFG 1385
             S HV +QY+A+DDLTLKEP++ +D+W YY+TSY L HPTEGI HE++K+PFLE+ ++  
Sbjct: 1218 DSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQ-- 1275

Query: 1386 QDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVH 1445
             D +  E  EE SP G SLS LRI++ P +Y+L IE GS D+FTR AVN++   + ++ +
Sbjct: 1276 DDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSN 1335

Query: 1446 KEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLA 1483
             ++  +K           + S+ D +   K GM ++L 
Sbjct: 1336 TDLKEEK--------RKTLMSQLDGSRGWKKGMSQELV 1365

 Score =  291 bits (746), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/286 (56%), Positives = 190/286 (66%), Gaps = 38/286 (13%)

Query: 220 EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279
           +DP YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

Query: 280 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPM-GTTTVNNNVSPSGRGTVDGQ-- 334
           GYPILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP      +N     +G G V+G   
Sbjct: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257

Query: 335 -------EPSSLSEPDGNAIQP-FHNLPM---VPS----NVYRSEQSQDQKQSLPLSANS 379
                   P  L   +  A+QP   N P    VP+    N+ + EQ   Q          
Sbjct: 258 LMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNQNLPQHEQQNQQH--------- 308

Query: 380 VGLSSXXXXXXXXXXXXLQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKH 439
            G  S              G         + + DVEFS AISYVNKIKTRFADQP+IYKH
Sbjct: 309 -GSQSPAMPQQQRQDQQFMGN--------RPSGDVEFSHAISYVNKIKTRFADQPEIYKH 359

Query: 440 FLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 485
           FLEILQTYQREQKPI+EVYAQVT LFQNAPDLL+DFKKFLPD++A+
Sbjct: 360 FLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAA 405

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/971 (56%), Positives = 679/971 (69%), Gaps = 64/971 (6%)

Query: 557  QNLPPIGSFSPPTN---------------GSTVH---DNYQDQQHMQPPHLVPLPSMVQH 598
            Q+LPP+G+F PP+N                S +H   D+ Q QQ++        P+  Q 
Sbjct: 482  QSLPPLGNFLPPSNKNNNTTAVNNNLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQS 541

Query: 599  GPNMVHQGIANENLPISDLRTS-LTDQYAPSTFXXXXXNPPSISPITDLQY--------- 648
               +      NE + IS+LR S + D            +P  ++ +   Q+         
Sbjct: 542  TTQL-----TNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQ 596

Query: 649  ---------------------GDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFF 687
                                  D+ VRPEIDLD               D++SL EE  FF
Sbjct: 597  QQQQQQQLQMQMQMQMDGGYPQDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFF 656

Query: 688  EKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEK 747
            +KAK++I NK +Y EFLKILNLYSQ+IL++++LVEKV +YLGSNKELF WFK FVGYQ+K
Sbjct: 657  DKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDK 716

Query: 748  TKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWA 807
             K IENIVHEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD+MCWE+LND+WVGHPVWA
Sbjct: 717  PKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWA 776

Query: 808  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDF 867
            SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE E+++F
Sbjct: 777  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANF 836

Query: 868  KLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQ 927
            KLP GLGHTS+TIY+KVIRKVY KERGFE+IDALHE+PAV  P++LKRLKQKDEEWRRAQ
Sbjct: 837  KLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQ 896

Query: 928  REWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTP 987
            REWNKVWREL+QKV++KSLDHLGLTFKQADKKLLTTKQLISEI+SIKVDQTNKK+HWLTP
Sbjct: 897  REWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTP 956

Query: 988  KPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKI 1047
            KPKSQLD+   D+ I YDIL L D FI+HT+ YSNPDKERL+D L+ FISLFF IPL  I
Sbjct: 957  KPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADI 1016

Query: 1048 EKALQFHK---ENVXXXXXXXXXXXXXXRKRPYQ-QEMSLLDILHRNRYQKLKRSNDEEG 1103
            + A++      +                +KR  +  ++S  DIL + +YQK+K+  D   
Sbjct: 1017 KAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLD--- 1073

Query: 1104 KIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIY 1163
            K    S  +                A+ PWL G++V++ANS GIIQNRS +N+F NTNIY
Sbjct: 1074 KNETFSNDI-SSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIY 1132

Query: 1164 IFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYK 1223
            +F RH  T+YERL E KQMN ++T+E+  RS V FAKDL+L+S QL  MGLDF G D+YK
Sbjct: 1133 VFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYK 1192

Query: 1224 QVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEI 1283
            Q+L LS RLI G+LEH WFEESLRQA+ NKAFKLYTIDKVTQS+VKHAHT+M+D KTAEI
Sbjct: 1193 QLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEI 1252

Query: 1284 MALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLK 1343
            M L  KDR+  TTS+KDQI+YRLQ RS+MS  +NMFRIE NK S ++S+QYI +DDLTL 
Sbjct: 1253 MMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLG 1312

Query: 1344 EPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTDGRE--VDEEFSPEG 1401
            EPK  E+KWKYY+TSY L HPTEG+  E+++IPFLE+++E  +     E  +++++SP+G
Sbjct: 1313 EPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKG 1372

Query: 1402 ISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLE 1461
            +S S L+IKI P  Y L IE GS+D F+R ++NKYP     D +K         ++ FL 
Sbjct: 1373 VSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLN 1432

Query: 1462 NAIRSRNDLNE 1472
                 +  L+E
Sbjct: 1433 GKFGWKQSLSE 1443

 Score =  290 bits (742), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 217/366 (59%), Gaps = 62/366 (16%)

Query: 151 LSRFDNPLPINTSVCTKDSKSYNGVQEEEKANQQQIQDQRPAAHSANASEPSSN-----Y 205
           ++ FDNPLP+ T                              A SA  S P+ N      
Sbjct: 91  VASFDNPLPVKTETT--------------------------PAISAETSIPNVNTTYSAT 124

Query: 206 VDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAI 265
             T+ S N+   +DE   YRPLNVKDAL+YLEQVK QFSSRPDIYN FLDIMKDFKSQ+I
Sbjct: 125 AGTTASANDSKESDEQ-FYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSI 183

Query: 266 DTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV------ 319
           DTPGVIERVSTLFRGYP LIQGFNTFLPQGY IEC+ NP+DPI+VTTP+G+ T+      
Sbjct: 184 DTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAKPI 243

Query: 320 -----NNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLP 374
                N NV     G      P + +   G       N   +P N+ R++++   +    
Sbjct: 244 PSAATNTNVP----GPTTSTSPPTAATTTGTTTPVAANTTAIP-NITRNKETNAIENVAT 298

Query: 375 LSANSV--GLSSXXXXXXXXXXXXLQGQS-LPVQED-----------AKKNVDVEFSQAI 420
            +  S+   L +            +Q  +  P+Q +            +K  DVEFSQA+
Sbjct: 299 AAQPSLLPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAV 358

Query: 421 SYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLP 480
           SYVNKIK RF D+PDIYK FLEILQTYQ+EQKPI+EVY+QVT LFQNAPDLL+DFKKFLP
Sbjct: 359 SYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLP 418

Query: 481 DSSASA 486
           D++ SA
Sbjct: 419 DNNNSA 424

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/961 (55%), Positives = 673/961 (70%), Gaps = 46/961 (4%)

Query: 558  NLPPIGSFSPPTNGSTVHDNYQ---DQQHMQPPHLVPLPSMVQHGPNMVHQGIANENLPI 614
            NLPP+G+FS     S   +++      QH+   H++P     QH   +V QG++N+++P+
Sbjct: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIP-----QH---VVTQGMSNQDIPV 623

Query: 615  SDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGDVPV-RPEIDLDXXXXXXXXXXXXX 673
            S++R+++   Y    +       P   P+  +QY + P+ RPEIDLD             
Sbjct: 624  SEMRSTMNGTYNQVEYIQGAPGYPQ--PLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQP 681

Query: 674  XXDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 733
              D I+L +EVTFFE+ KR+IGNK +Y EFLKILNLYSQD+L   +LV KV+FYL S+KE
Sbjct: 682  PEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741

Query: 734  LFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 793
            LF WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYK+LPK DTFMPCSGRD+MCW
Sbjct: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801

Query: 794  EILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 853
            E+LNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQ LETI 
Sbjct: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861

Query: 854  NKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 913
            NKI NMT  EK++FKLPPGLGHTS+TIYKKV+RKVYDK+RGFEIIDALHEHPAVT P+VL
Sbjct: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVL 921

Query: 914  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSI 973
            KRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEI+SI
Sbjct: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981

Query: 974  KVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLK 1033
            KVDQTNK+IH LTPKPKSQLDF+  D+++ YDIL L  +F+    +YSN DK +L    K
Sbjct: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041

Query: 1034 YFISLFFSIPLEKIEKALQ-----FHKENVXXXXXXXXXXXXXXRKRPYQQEMSLLDILH 1088
             FISLFFS P++ + +A+        +EN               R    +    + DIL 
Sbjct: 1042 AFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILR 1101

Query: 1089 RNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXXXXXXXXXARNPWLTGNLVEEANSQGII 1148
            R +    K SN EE +                        A  PWL G+L++EAN+ GI+
Sbjct: 1102 RTK--NAKTSNSEENQ-----NSSSVKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIV 1154

Query: 1149 QNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQ 1208
             +R IFNLF NT IY+FFRH  T+YERLLE+K+++ ++T E+  R  V FA DL+L+S Q
Sbjct: 1155 SDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQ 1214

Query: 1209 LPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLV 1268
            L +MGL F    AY ++LRLS+RLI GDL+HQWFEESLRQAY NKAFK+YTIDKV QSLV
Sbjct: 1215 LADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1274

Query: 1269 KHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSL 1328
            KHAH+++ D K A +M LF +DR    T+AKDQI+YRL+VR+ M   ENMFRIE N  S 
Sbjct: 1275 KHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSS 1334

Query: 1329 HVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEF-GQD 1387
            HVS+QY+A+DDLTLKEP+  ++KW YYVTSY L HPTEGI+ E +  PFL ++IE   + 
Sbjct: 1335 HVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEY 1394

Query: 1388 TDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKE 1447
             D  E +++FSPEG+S S L++ I P TY+L  E GS DVFTRK+VNK+P+         
Sbjct: 1395 LDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPS--------S 1446

Query: 1448 MVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK-----------GVTAKVNDEN 1496
               Q  + + +FL ++   + +L+       + K+ +LK            +TAK+ + N
Sbjct: 1447 QSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQTLTITAKIEEPN 1506

Query: 1497 E 1497
            E
Sbjct: 1507 E 1507

 Score =  183 bits (465), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (95%)

Query: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVI+RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT 317
           LIQGFNTFLP GY+IECSTNP+DPI+VTTP GTT
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294

 Score =  136 bits (342), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 3/85 (3%)

Query: 401 SLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 460
           +LP Q+   K  +VEFS AISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQ
Sbjct: 415 ALPGQQ---KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQ 471

Query: 461 VTHLFQNAPDLLEDFKKFLPDSSAS 485
           VT LFQN PDLL+DFKKFLPDSS S
Sbjct: 472 VTILFQNNPDLLDDFKKFLPDSSVS 496

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ  P+L++ F  F
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268

Query: 479 LP 480
           LP
Sbjct: 269 LP 270

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 292 LP 293
           LP
Sbjct: 490 LP 491

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1053 bits (2724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/827 (62%), Positives = 628/827 (75%), Gaps = 14/827 (1%)

Query: 646  LQYGDVPVRPEIDLDXXXXXXXXXXXXXXXDNISLNEEVTFFEKAKRYIGNKHLYTEFLK 705
            + Y +  VRPEIDLD               D + L EE  FF+K K+YIGNK +Y EFLK
Sbjct: 823  VMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLK 882

Query: 706  ILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDL 765
            +LNLYS D+L++D+LVEK+ +YL  N+ELFSWFKNFVGY EK K IENIVHEKH+LDLDL
Sbjct: 883  VLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDL 942

Query: 766  CEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETL 825
            CEA GPSYK+LPK+DT MPCSGRD+MCWEILNDEWVGHPVWASEDSGFIAHRK   ++  
Sbjct: 943  CEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPY 1002

Query: 826  FKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVI 885
             +++++ HEYDFYIESNLRTIQ LETI +KI NMTE+EK +FKLP GLGHT+ TIYKKVI
Sbjct: 1003 LRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVI 1062

Query: 886  RKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKS 945
            RKVYDKERGFEIIDALHE+PA+  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKS
Sbjct: 1063 RKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKS 1122

Query: 946  LDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYD 1005
            LDHLGLTFKQADKKLLTTKQLISEI+SIKVDQT+K++HWLTPKPKSQLDF+ PDKDI +D
Sbjct: 1123 LDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFD 1182

Query: 1006 ILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQ---FHKENVXXXX 1062
            IL   + F+ HT+ YSNP+KERL D +KYF SLFFSIPLE+I++A+      ++N     
Sbjct: 1183 ILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLE 1242

Query: 1063 XXXXXXXXXXRKRPYQQ-EMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDXXXXXXXX 1121
                      +KR  +   +SL DIL R +YQ+LK  +D +      +   D        
Sbjct: 1243 DKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD--QKLLEE 1300

Query: 1122 XXXXXXXARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQ 1181
                   A+ PWL G LVEEAN+QG I +R+IFN+F+NTN+YIF RH TT+YERL EIKQ
Sbjct: 1301 EELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQ 1360

Query: 1182 MNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQW 1241
            MN K+++E++ R    FAKDL+L+S QL EMGLDF   D Y+Q+L L +RLI GDLEHQW
Sbjct: 1361 MNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQW 1420

Query: 1242 FEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQ 1301
            FEESLRQA+NNKAFKLYT+DKVTQ+LVKHAHT+++D+KT EIMALF KDR   +TS+KDQ
Sbjct: 1421 FEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQ 1480

Query: 1302 IIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGL 1361
            I+YRLQ R+ M++ ENMFRIE N  + H+ +QYIALDDLT+K+ K  E+KWKYY+TSY L
Sbjct: 1481 ILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYAL 1540

Query: 1362 PHPTEGISHEKLKIPFLERLIEFGQDTDGREVDEE--------FSPEGISLSTLRIKIQP 1413
             HPTEGI  E ++IPFLER+IE  Q  +  E D++        +SPEGIS STL+IKI P
Sbjct: 1541 SHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDP 1600

Query: 1414 ITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFL 1460
              Y L+IE GS+D+F+RK++N++P     D     + +    + +FL
Sbjct: 1601 QNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFL 1647

 Score =  187 bits (476), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 104/134 (77%)

Query: 213 NNENSNDEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIE 272
           N ++S  ED  YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVI 
Sbjct: 288 NTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIA 347

Query: 273 RVSTLFRGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVD 332
           RVS+LF  YP LIQGFNTFLPQGYRIECS+NP+ PI V TPMGTTTV+  +  S     +
Sbjct: 348 RVSSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQN 407

Query: 333 GQEPSSLSEPDGNA 346
            Q   SL +P   A
Sbjct: 408 HQLQHSLPQPSTTA 421

 Score =  141 bits (355), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 78/89 (87%), Gaps = 2/89 (2%)

Query: 401 SLPVQE--DAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 458
           S P+QE  + ++  DVEFSQAISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY
Sbjct: 528 SPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVY 587

Query: 459 AQVTHLFQNAPDLLEDFKKFLPDSSASAN 487
           +QVT LFQ APDLLEDFKKFLPDSSA+ N
Sbjct: 588 SQVTVLFQEAPDLLEDFKKFLPDSSANNN 616

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF + P L++ F  F
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366

Query: 479 LP 480
           LP
Sbjct: 367 LP 368

 Score = 46.6 bits (109), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A+SY+ ++K +F+++P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 292 LP 293
           LP
Sbjct: 608 LP 609

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1005 (54%), Positives = 679/1005 (67%), Gaps = 103/1005 (10%)

Query: 554  VPQQNLPPIGSFSPPTNG----------STVHDNYQDQQHMQPPHLVPLPSMVQHGPNMV 603
            +PQQNLPPIGSFSPPT             TV +N++    MQ      LPSM+   P+  
Sbjct: 584  IPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISMQ----TALPSMMT--PDT- 636

Query: 604  HQGIANENLPISDLRTSLTDQYAPSTFXXXXXNPPSISPITDLQYGD------------- 650
                  E +PIS+LR+   D + PS+          + P+ + Q  D             
Sbjct: 637  ------EAIPISNLRS--VDGFPPSS--------GGVIPMPNNQTADFQYQQQQPQPPLT 680

Query: 651  ---------------------------------VPVRPEIDLDXXXXXXXXXXXXXXXDN 677
                                              P RPEIDLD               +N
Sbjct: 681  NRLPDQFPLDQQQSQQQQAQQQAQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENN 740

Query: 678  ISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSW 737
            I+L EE +FFEK K++I +K +Y EFLK+LNLYSQD+L  ++LV +VD+Y+GSNKELF W
Sbjct: 741  ITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDW 800

Query: 738  FKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILN 797
            FK FVGY E    IENI+HEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD MCWE+LN
Sbjct: 801  FKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLN 860

Query: 798  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIE 857
            DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQ LETI NKI 
Sbjct: 861  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKIN 920

Query: 858  NMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLK 917
            NMT  EK +FKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHPA   P++L+RLK
Sbjct: 921  NMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLK 980

Query: 918  QKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQ 977
            +KDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISEI+SI+VDQ
Sbjct: 981  EKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQ 1040

Query: 978  TNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFIS 1037
             NK+IHWLTPKPKSQLDF F D DI  DIL LA+ FI HT+ YSN +KERLKD L+ FI 
Sbjct: 1041 NNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIG 1100

Query: 1038 LFFSIPLEKIEKALQFHK----ENVXXXXXXXXXXXXXXRKRPYQQEMSLLDILHRNRYQ 1093
            LFFSIP  +I+K L        E                +KR  + ++ L D+L + +YQ
Sbjct: 1101 LFFSIPSSEIDKKLSGKNDEKFEKGSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQ 1160

Query: 1094 KLKR---------SNDEEGKIPQLSEPLDXXXXXXXXX-XXXXXXARNPWLTGNLVEEAN 1143
            K+K          SN+ + +  +  E L                  + PWL G+++++ +
Sbjct: 1161 KIKEKVINELENNSNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTS 1220

Query: 1144 SQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLD 1203
              G+I+NR IFNLFANTNIY+FFRHWTTIYERLLE+KQ+N K+T+E+N+R    FAKDL 
Sbjct: 1221 EHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLG 1280

Query: 1204 LLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKV 1263
            L+S QL  MGLDF   D+YK++L L++RLI  D+EHQWFEESLRQAYNNKAFKLYT DKV
Sbjct: 1281 LISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKV 1340

Query: 1264 TQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIEL 1323
             Q+LVKHA++++ D K +EIMALF KDR   +T+ +DQIIYRLQ R++M+N ENMFRIE 
Sbjct: 1341 IQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEF 1400

Query: 1324 NKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLER--- 1380
            N+ + HV +QYIA++DLTLK     ++ W+YYVTSY LPHPTEG+  E LK+PFLE+   
Sbjct: 1401 NENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLN 1460

Query: 1381 -LIEFGQD----TDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNK 1435
              +E  QD    T+  E  E+ SPEGIS S L+IKI   TY L +E GS+DVF+RK++NK
Sbjct: 1461 LELENAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNK 1520

Query: 1436 YPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQE 1480
            +PT A     +  + +K+   ++FL +     N       +G++E
Sbjct: 1521 FPTDAKK--IESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEE 1563

 Score =  293 bits (750), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/274 (58%), Positives = 192/274 (70%), Gaps = 9/274 (3%)

Query: 219 DEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 278
           +EDP+YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

Query: 279 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV-------NNNVSPSGRGTV 331
           +GYP+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T        N NVSP+   TV
Sbjct: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVSPT-LPTV 383

Query: 332 DGQEPSSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSXXXXXXX 391
                    + + +     +N    P  V+     Q+Q Q+    A++   +        
Sbjct: 384 QPLLQQPQPQGNNDTTNVINNAANQPQQVHAQTHLQEQTQAQ-TPADADAQAQAEVQAQV 442

Query: 392 XXXXXLQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQ 451
                 Q Q+    +   +N +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+
Sbjct: 443 QAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREE 502

Query: 452 KPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSAS 485
           KPI+EVY QVT LF +APDLLEDFKKFLP++ A+
Sbjct: 503 KPISEVYEQVTVLFNDAPDLLEDFKKFLPETPAN 536

 Score = 40.8 bits (94), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 22/143 (15%)

Query: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291
           A++Y+ ++K +++ +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 292 LPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPDGNAIQPFH 351
           LP+                 TP     V    +      +  + PS   +   + + PF 
Sbjct: 530 LPE-----------------TPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYPFS 572

Query: 352 NLPMVPSNVYRSEQSQDQKQSLP 374
           N   VPS  Y+  Q     Q+LP
Sbjct: 573 NNGPVPSGFYQIPQ-----QNLP 590

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  244 bits (624), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 210/365 (57%), Gaps = 37/365 (10%)

Query: 694  IGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVG-YQEKTKCIE 752
            + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+  L + F N +  Y++      
Sbjct: 214  VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKD------ 267

Query: 753  NIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGH 803
              +H++ +      D D  E F    GPSYKRL   +T   C GRD +C E+LNDEWVGH
Sbjct: 268  --IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 804  PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESE 863
            PVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF+    L +++ L     + E   +  
Sbjct: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----LLSVEHLIVKFTEYEKSLQLS 381

Query: 864  KSDFKL--------PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKR 915
            K D +          P +   S+T  +KVIR++Y  E G  +IDA+  +P    P +LK 
Sbjct: 382  KDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKT 439

Query: 916  LKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKV 975
             K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK A+K+ L  KQL+ E  S K 
Sbjct: 440  AKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQ 499

Query: 976  DQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYF 1035
            D+  K+ H+       +  ++F DK + YD+  +    +   ++ S   K     + + F
Sbjct: 500  DKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAF 554

Query: 1036 ISLFF 1040
              L F
Sbjct: 555  FDLLF 559

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 97/325 (29%), Positives = 159/325 (48%), Gaps = 21/325 (6%)

Query: 1150 NRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNT--RSTVTFAKDLDLLSN 1207
            NR   N+F + NI   F +  T+YER  ++K     I K++ T  R     AK L LL  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1208 QLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSL 1267
            QL + GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + NKA+KLYTID+V +++
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1268 VKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRS 1327
            +    T+       +I+ L V +    TT+   Q+ YR +VR  M  + +MFR+E+ + S
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1328 LHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF-----LERLI 1382
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+     L+R  
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR-- 856

Query: 1383 EFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIAND 1442
                     E +  F    I    L + I P+ Y + I  GS D+ +   + K  +    
Sbjct: 857  --------EEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKS---- 904

Query: 1443 DVHKEMVVQKTALISRFLENAIRSR 1467
             +      Q  +LIS+  +N  + R
Sbjct: 905  SLKSSRKTQMASLISKIAKNRKQQR 929

>Suva_15.170 Chr15 (290805..291290) [486 bp, 161 aa] {ON}  YOL004W
           (REAL)
          Length = 161

 Score =  120 bits (300), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 77/115 (66%), Gaps = 14/115 (12%)

Query: 1   MSQVWHNSNSQPNDVATSNDAAASNERSDKEPPLXXXXXXXXXXXXXXXXITLPSLSALN 60
           MSQVWHN NSQ N+ +T+NDAA+SNER++KEPPL                ITLPSLSALN
Sbjct: 1   MSQVWHNPNSQSNEASTANDAASSNERTEKEPPL---QGAQPSFVQPQQRITLPSLSALN 57

Query: 61  ANDEDRRD-----------YNGAQPLASHATHILGYSPVHSNIIPSISTDSALKQ 104
           A DEDRR+               QPLASH+T ILGY P HSN++PSI+TDSALKQ
Sbjct: 58  AKDEDRREGNGNGNGNGQQQQQQQPLASHSTRILGYPPAHSNVMPSITTDSALKQ 112

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 693 YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQ---EKTK 749
           Y G K++Y ++LK+LN   QD   + D VE  D     + ++  +  N + YQ   E+ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 750 CIENIVHEK 758
            I+N +H K
Sbjct: 140 YIDNFIHSK 148

>Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W
           (REAL)
          Length = 756

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 687 FEKA-KRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQ 745
           FEK  K Y+G++  Y EF+K++  Y  D+   +D   K+   L +   L   F+ F+   
Sbjct: 124 FEKLLKNYLGSEEKYVEFIKVIKAY--DVFIFNDSFSKISTCLKTTFCLIEKFQKFIYRS 181

Query: 746 EKTKCIENIVHEKHRLDLDLCEA 768
             + C++ ++ E    D   C+A
Sbjct: 182 FPSPCLKFLLFEGSLKD---CKA 201

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
            Anc_5.88 YGR238C
          Length = 828

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (52%), Gaps = 20/116 (17%)

Query: 935  RELEQKVFFKSLD--HLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQ 992
            REL+Q +  K LD   L    +  +KKLL   +L ++IN +KV+  N+ + +     K+ 
Sbjct: 637  RELKQLLRSKLLDAKELNKIIELQNKKLLEASKLKAKINLLKVE--NQTLKYENDTLKNA 694

Query: 993  LDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIE 1048
            ++ D  DK++F           +HT AYS    E+L++ L+ FIS   + P+  +E
Sbjct: 695  INSDVQDKELF-----------THTKAYS----EQLEN-LENFISNTKASPISLLE 734

>TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.60
           YNL298W
          Length = 833

 Score = 33.9 bits (76), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 304 PDDPIRVTTPMGTTTVNNNVSPSGRGTVD----GQEPSSLSEPDGNAIQPFHNLPMVPSN 359
           P  PI V TP  T   N +   +G G ++    GQ   +   P G A+QP    P  P+ 
Sbjct: 438 PKPPISVVTPQHTNGPNRDPMSAGAGAMNQPGAGQPSPATQNPPGKALQPMRQAPKKPTA 497

Query: 360 VYRSE 364
            ++++
Sbjct: 498 EHKND 502

>Skud_11.220 Chr11 complement(402296..406747) [4452 bp, 1483 aa]
           {ON} YKL010C (REAL)
          Length = 1483

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/116 (19%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 863 EKSDFKLPPGLGHTSMTIYK-KVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKD- 920
           E +D ++P  +    + I+  + +   Y K +G  ++D L     V    + + L Q + 
Sbjct: 660 EFADMEIPDSVKPKKIFIHLFRALSLAYIKSKGMHLVDGLLSQMNVEQDAITEELHQIEN 719

Query: 921 -----EEWR---RAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLIS 968
                E++    + + +W ++W  L++ +F +  D  G  F         TK+++S
Sbjct: 720 VVSILEDFSTPDKTEEDWKRIWSVLKKCIFHEDFDVSGFEFTSTGLASSLTKRIMS 775

>KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 16/102 (15%)

Query: 1170 TTIYERLLE----IKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIG-----ED 1220
             T+Y +L E    +K +   I KEV   + V   K   L  NQ+ +  + F       + 
Sbjct: 214  ATLYRKLNECEDHLKGVYKDIEKEVGKNNKVEILKKFYLFGNQITDTDIRFYTTAIRFDS 273

Query: 1221 AYKQVLRLSRRLINGDLE--HQWFEESLRQAY-NNKAFKLYT 1259
            ++ Q L+ + R+I  D    H W    LR  Y N+KAF+L T
Sbjct: 274  SHAQHLKCNWRIIRDDYPYIHLW----LRNLYWNHKAFRLTT 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 162,435,577
Number of extensions: 7546453
Number of successful extensions: 25888
Number of sequences better than 10.0: 93
Number of HSP's gapped: 26685
Number of HSP's successfully gapped: 157
Length of query: 1555
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1432
Effective length of database: 39,377,481
Effective search space: 56388552792
Effective search space used: 56388552792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 73 (32.7 bits)