Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.691.82ON1946192686030.0
YNL271C (BNI1)1.82ON1953193575260.0
Smik_14.661.82ON1952194473410.0
Suva_14.711.82ON1948194472860.0
NCAS0A005901.82ON1946109729240.0
KAFR0D039501.82ON1957107929180.0
TDEL0C061901.82ON1879111926520.0
Kpol_2000.661.82ON1930111526290.0
KNAG0F004701.82ON2028111025280.0
CAGL0J08206g1.82ON189884825010.0
ZYRO0F16676g1.82ON1994107124510.0
NDAI0F042201.82ON202283624460.0
TPHA0B044901.82ON1940111722340.0
TBLA0A054401.82ON217062919950.0
SAKL0C02618g1.82ON198864119220.0
Kwal_33.133921.82ON196862618840.0
KLTH0F02376g1.82ON197662818320.0
AFR669W1.82ON191860017790.0
Ecym_10861.82ON209165217700.0
KLLA0C02321g1.82ON184258317090.0
SAKL0E15224g5.717ON13354987693e-82
NCAS0G001205.717ON13144777586e-81
Ecym_40045.717ON14544847421e-78
CAGL0H06765g5.717ON12944967292e-77
Ecym_5679na 1ON13064157264e-77
AFR301C5.717ON16554377271e-76
KLLA0F10912g5.717ON12834817202e-76
Smik_9.95.717ON13744927204e-76
Skud_9.85.717ON13744957152e-75
Kpol_416.105.717ON14914817143e-75
TDEL0F055605.717ON12924877095e-75
AGL364Cna 1ON12604137032e-74
Kwal_55.196205.717ON13894757026e-74
YIL159W (BNR1)5.717ON13754937017e-74
NDAI0F001605.717ON13494156882e-72
KNAG0L022505.717ON13674776849e-72
ZYRO0B16654g5.717ON14244186822e-71
KLTH0E00704g5.717ON13894146802e-71
TBLA0E018105.717ON14514936643e-69
TPHA0E001205.717ON16424756582e-68
Suva_9.265.717ON13754216509e-68
KAFR0D021205.717ON13244156382e-66
KAFR0K023306.223ON540112880.17
KLTH0H05214g6.171ON20055790.97
CAGL0C04917g7.494ON1113113792.7
Kwal_27.110966.171ON20155753.9
CAGL0C01529g6.171ON23645745.6
NCAS0H004107.494ON1117139757.9
Skud_4.6595.468ON62860749.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.69
         (1946 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...  3318   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...  2903   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...  2832   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...  2811   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1130   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....  1128   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...  1026   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...  1017   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     978   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   967   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   948   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           946   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   865   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   773   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   744   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   730   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   710   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   689   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   686   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   662   0.0  
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   300   3e-82
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      296   6e-81
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   290   1e-78
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   285   2e-77
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   284   4e-77
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   284   1e-76
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   281   2e-76
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   281   4e-76
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   280   2e-75
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   279   3e-75
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   277   5e-75
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   275   2e-74
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   275   6e-74
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   274   7e-74
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     269   2e-72
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   268   9e-72
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   267   2e-71
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   266   2e-71
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   260   3e-69
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   258   2e-68
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   254   9e-68
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   250   2e-66
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    39   0.17 
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    35   0.97 
CAGL0C04917g Chr3 (457506..460847) [3342 bp, 1113 aa] {ON} highl...    35   2.7  
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    33   3.9  
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    33   5.6  
NCAS0H00410 Chr8 complement(73436..76789) [3354 bp, 1117 aa] {ON...    33   7.9  
Skud_4.659 Chr4 (1166725..1168611) [1887 bp, 628 aa] {ON} YDR386...    33   9.5  

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score = 3318 bits (8603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1667/1926 (86%), Positives = 1667/1926 (86%)

Query: 21   GLLQNLKRLXXXXXXXXXXXXXXXXXXXXHSPMGQEXXXXXXXXXXFRNLNGPSRTTSIE 80
            GLLQNLKRL                    HSPMGQE          FRNLNGPSRTTSIE
Sbjct: 21   GLLQNLKRLANSNGTSANAASPTNATQQQHSPMGQESSTSPSSSSSFRNLNGPSRTTSIE 80

Query: 81   ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ 140
            ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ
Sbjct: 81   ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ 140

Query: 141  HTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSG 200
            HT               TNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSG
Sbjct: 141  HTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSG 200

Query: 201  DKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLSS 260
            DKQEALMGYSTEKKWLIVKQDLQNELKKMRAN              DHLPILTANSSLSS
Sbjct: 201  DKQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRTSVASDHLPILTANSSLSS 260

Query: 261  PKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLKKQPSLNNIYRGGSE 320
            PKSILMTSASSPTSTVY                      IVTGSLKKQPSLNNIYRGGSE
Sbjct: 261  PKSILMTSASSPTSTVYSNNLNHSTTLSSAGTSTSKSKKIVTGSLKKQPSLNNIYRGGSE 320

Query: 321  NNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIA 380
            NNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIA
Sbjct: 321  NNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIA 380

Query: 381  MANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL 440
            MANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL
Sbjct: 381  MANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL 440

Query: 441  FSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHL 500
            FSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHL
Sbjct: 441  FSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHL 500

Query: 501  TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLC 560
            TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLC
Sbjct: 501  TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLC 560

Query: 561  SCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNE 620
            SCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNE
Sbjct: 561  SCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNE 620

Query: 621  AFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM 680
            AFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM
Sbjct: 621  AFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM 680

Query: 681  DSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL 740
            DSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL
Sbjct: 681  DSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL 740

Query: 741  SEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRK 800
            SEKLSKAEHGLVGQLEDELHERDHILAKNQRVM                      VELRK
Sbjct: 741  SEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRK 800

Query: 801  MLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 860
            MLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL
Sbjct: 801  MLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 860

Query: 861  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLAR 920
            QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQI             NFLAR
Sbjct: 861  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLAR 920

Query: 921  AQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 980
            AQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGF
Sbjct: 921  AQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 980

Query: 981  GIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXX 1040
            GIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRI              
Sbjct: 981  GIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTKQE 1040

Query: 1041 XXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTG 1100
                 NGK             EVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTG
Sbjct: 1041 TKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTG 1100

Query: 1101 QNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQN 1160
            QNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQN
Sbjct: 1101 QNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQN 1160

Query: 1161 EHVNIPREXXXXXXXXXXXXDEIEKYDQEHVENKIQXXXXXXXXXXQPNSVLEAENSLTS 1220
            EHVNIPRE            DEIEKYDQEHVENKIQ          QPNSVLEAENSLTS
Sbjct: 1161 EHVNIPRELSPKKSLTSSTSDEIEKYDQEHVENKIQGSTTSTSTGGQPNSVLEAENSLTS 1220

Query: 1221 SSVLXXXXXXXXXXXXXXXXIELFGKSLVREKEIEDNAAKQNTTAGEAVXXXXXXXXXXX 1280
            SSVL                IELFGKSLVREKEIEDNAAKQNTTAGEAV           
Sbjct: 1221 SSVLPPPPPPPPPPPPPPVPIELFGKSLVREKEIEDNAAKQNTTAGEAVPPPPPPPPPPP 1280

Query: 1281 XXXXMALFGKXXXXXXXXXXXXXXXXXXATGAIXXXXXXXXXSQMKSAVTSPLLPQSPSL 1340
                MALFGK                  ATGAI         SQMKSAVTSPLLPQSPSL
Sbjct: 1281 PPPPMALFGKPTGGTPPPPPLPSVLSSSATGAIPPAPPMMPASQMKSAVTSPLLPQSPSL 1340

Query: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400
            FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460
            ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520
            TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580
            RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640
            GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700
            DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1701 EFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXX 1760
            EFESLMQTYGEDSG                NEYKKAQAQNLAGEEEERLYEKHKKLV   
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1761 XXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820
                        RSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820

Query: 1821 RKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMNTPEDL 1880
            RKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMNTPEDL
Sbjct: 1821 RKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMNTPEDL 1880

Query: 1881 PSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERASSETNTG 1940
            PSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERASSETNTG
Sbjct: 1881 PSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERASSETNTG 1940

Query: 1941 NKLSFN 1946
            NKLSFN
Sbjct: 1941 NKLSFN 1946

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score = 2903 bits (7526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1477/1935 (76%), Positives = 1565/1935 (80%), Gaps = 14/1935 (0%)

Query: 21   GLLQNLKRLXXXXXXXXXXXXXXXXXXXXHSPMGQEXXXXXXXXXXFRNLNGPSRTTSIE 80
            G+ QNLKRL                    HSP+G E          FR LN PSR+TS E
Sbjct: 22   GIFQNLKRLANSNATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTSTE 81

Query: 81   ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ 140
            ARPLNKKSTLNTQNLSQYM+GK+S DVP+SSQHARSHS+QSKYSYSKRNSSQASNKLTRQ
Sbjct: 82   ARPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQ 141

Query: 141  HTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSG 200
            HT               TNLSKFTTPDGKI+LEMPSDPYEVE+LFEDIMYKRNIFQSLS 
Sbjct: 142  HTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNIFQSLSE 201

Query: 201  DKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLSS 260
            DKQEALMGYS EKKWLIVKQDLQNELKKMRAN              DH PILTANSSLSS
Sbjct: 202  DKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDHHPILTANSSLSS 261

Query: 261  PKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLKKQPSLNNIYRGGSE 320
            PKS+LMTSASSPTSTVY                      +V+GSLKKQPSLNNIYRGG+E
Sbjct: 262  PKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKGKKLVSGSLKKQPSLNNIYRGGAE 321

Query: 321  NNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIA 380
            NN SASTLPGDRTNRPPIHYVQRILADKLT+DEMKDLWVTLRTEQLDWVDAFI+HQGHIA
Sbjct: 322  NNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIA 381

Query: 381  MANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL 440
            MANVLMNS+YKTAPR+NLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL
Sbjct: 382  MANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGL 441

Query: 441  FSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHL 500
            FSTKLAT+KMATEIFVCMLEKKNKSRFEAVLT+LDKKFRIGQNLHMIQNFKKMPQYFSHL
Sbjct: 442  FSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQYFSHL 501

Query: 501  TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLC 560
            TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASD+FKNGGGENAILEYCQWTMVFINHLC
Sbjct: 502  TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLC 561

Query: 561  SCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNE 620
            SCSDNINQRMLLRTKLENCG+LRIMNKIKLLDYDKVIDQI+LYDNNKLDDFNVKLEANN+
Sbjct: 562  SCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNK 621

Query: 621  AFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM 680
            AFNVDL DPLSLLKNLW ICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM
Sbjct: 622  AFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLM 681

Query: 681  DSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL 740
            DSLVTNVS+AS +DEE+N+NMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL
Sbjct: 682  DSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSL 741

Query: 741  SEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRK 800
            SEKLSKAEHGLVGQLEDELHERD ILAKNQRVM                      VELRK
Sbjct: 742  SEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRK 801

Query: 801  MLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 860
            MLTILNSRPEES + NEGTR ++ SLN SEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL
Sbjct: 802  MLTILNSRPEESFNKNEGTRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 861

Query: 861  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLAR 920
            QPNKRLKMLRMQMENIENEARQLEMTNFAEFEK+RLEPPI I               L +
Sbjct: 862  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVK 921

Query: 921  AQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 980
             QEAD+NKLNDLRRALA+IQMESN+ISKFNVEERVNELFNEKKSLALKRLKELETKYKGF
Sbjct: 922  PQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 981

Query: 981  GIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXX 1040
            GIDFNV++IM+SPKK +   E E DA Y+SLDPK YQKKLDEINRI              
Sbjct: 982  GIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEINRITDQLLDIQTQTEHE 1041

Query: 1041 XXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTG 1100
                 +G+             E+YQDASPT E+RSE+SELS+GSGPGSFLDALSQKYGTG
Sbjct: 1042 IQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFLDALSQKYGTG 1101

Query: 1101 QNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQN 1160
            QNVTASA   ++   SG+G   SKVEKTFMNRL++STV+SAPYLEELTQKVNKVEP EQN
Sbjct: 1102 QNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKVNKVEPYEQN 1161

Query: 1161 EHVNIPREX--XXXXXXXXXXXDEIEKYDQEHVENKIQ--------XXXXXXXXXXQPNS 1210
            E   + ++              D+ EK  ++HVEN  Q                  + N+
Sbjct: 1162 EDEGLDKKSLPENSTASAASAFDKAEKDMRQHVENGKQGRVVNHEEDKTADFSAVSKLNN 1221

Query: 1211 VLEAENSLTSSSVLXXXXXXXXXXXXXXXXIELFGKSLVREKEIEDNAAKQNTTAGEAVX 1270
               AE+  T SSVL                 +LFG+SL +EK+ ED+  KQ TT      
Sbjct: 1222 TDGAEDLSTQSSVLSSQPPPPPPPPPPVPA-KLFGESLEKEKKSEDDTVKQETTGDSPA- 1279

Query: 1271 XXXXXXXXXXXXXXMALFGKXXXXXXXXXXXXXXXXXXATGAIXXXXXXXXXSQMKSAVT 1330
                          MALFGK                    G I         SQ+KSAVT
Sbjct: 1280 --PPPPPPPPPPPPMALFGKPKGETPPPPPLPSVLSSSTDGVIPPAPPMMPASQIKSAVT 1337

Query: 1331 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEK 1390
            SPLLPQSPSLFEKYPRPHKKLKQLHWEKLD TDNSIWG+GKAEKFADDLYEKGVLADLEK
Sbjct: 1338 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEK 1397

Query: 1391 AFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQ 1450
            AFAAREIKSLA+KRKEDLQKITFLSRDISQQFGINLHMYSSLSV DLVKK+LNCDRDFLQ
Sbjct: 1398 AFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQ 1457

Query: 1451 TPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQL 1510
            TPSVVEFLSK+EIIEVSVNLARNYAPYSTDWEGVRNL+DAKPPEKDPNDLQRADQ+YLQL
Sbjct: 1458 TPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQL 1517

Query: 1511 MINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGN 1570
            M+NLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAV ALQ SDNLRNVFNVILAVGN
Sbjct: 1518 MVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGN 1577

Query: 1571 FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDV 1630
            FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKI+RLNYP+FNDFL ELEPVLDV
Sbjct: 1578 FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDV 1637

Query: 1631 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDL 1690
            VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR+KGDL
Sbjct: 1638 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDL 1697

Query: 1691 LKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLY 1750
            L+DEVKLTIMEFESLM TYGEDSG                NEYKKAQAQNLA EEEERLY
Sbjct: 1698 LEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLY 1757

Query: 1751 EKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTD 1810
             KHKK+V                S SPS EGNEEDEAEDRR VMDKLLEQLKNAGPAK+D
Sbjct: 1758 IKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSD 1817

Query: 1811 PSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLAT 1870
            PSSARKRALVRKKYLS+KD+APQLLNDLD EEGSILYSPEA  P   T +HAESPTPLAT
Sbjct: 1818 PSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLAT 1877

Query: 1871 RGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARK 1930
            RG+MNT EDLPSPSK  ALEDQEEISDRARMLLKELRGS+  VKQNS LDEHLEKLRARK
Sbjct: 1878 RGVMNTSEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRARK 1937

Query: 1931 ERASSETNTGNKLSF 1945
            ER+  E +TGN+LSF
Sbjct: 1938 ERSIGEASTGNRLSF 1952

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score = 2832 bits (7341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1465/1944 (75%), Positives = 1551/1944 (79%), Gaps = 33/1944 (1%)

Query: 21   GLLQNLKRLXXXXXXXXXXXXXXXXX-XXXHSPMGQEXXXXXXXXXXFRNLNGPSRTTSI 79
            GL QNLKRL                     HSP+  E          FR LNGPSR+ S 
Sbjct: 22   GLFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAATSPASSSSFRKLNGPSRSIST 81

Query: 80   EARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTR 139
            EARPLNKKSTLNTQNLSQYM+GK+SADVP+SSQHARSHS+QSKYSYSKRNSSQASNKLTR
Sbjct: 82   EARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTR 141

Query: 140  QHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLS 199
            QHT               TNLSKFTTPDGKIHLEMPSDPYEVE+LFEDIMYKRNIFQSLS
Sbjct: 142  QHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLS 201

Query: 200  GDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLS 259
            GDKQEALM YSTEKKWLIVKQDLQNELKK+RAN              DH PILTANSSLS
Sbjct: 202  GDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDHHPILTANSSLS 261

Query: 260  SPKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLKKQPSLNNIYRGGS 319
            SPKS+LMTSASSPTSTVY                      ++ GSLKKQPSLNNIYRGGS
Sbjct: 262  SPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQPSLNNIYRGGS 321

Query: 320  ENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHI 379
            ENN SASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFI+HQGHI
Sbjct: 322  ENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHI 381

Query: 380  AMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEG 439
            AMANVLMNS+YKTAPRD+LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEG
Sbjct: 382  AMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEG 441

Query: 440  LFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSH 499
            LFST+LAT+KMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSH
Sbjct: 442  LFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSH 501

Query: 500  LTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHL 559
            LTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASD+FKNGGGENAILEYCQWTMVFINHL
Sbjct: 502  LTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHL 561

Query: 560  CSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANN 619
            CSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKV+DQI+LYDNNKLDDFNV+LEANN
Sbjct: 562  CSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANN 621

Query: 620  EAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKL 679
            +AFNVDLQDPLSLLKNLW ICKGTENEKLLVSLVQHLFLSSSKLIEENQN SKLTKQLK+
Sbjct: 622  KAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQLKV 681

Query: 680  MDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDS 739
            MDSLVT+VSIAS +DEESN+NMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDS
Sbjct: 682  MDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDS 741

Query: 740  LSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELR 799
            LSEKLSKAEHGLVGQLEDELH RD ILAKNQRVM                      VELR
Sbjct: 742  LSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELR 801

Query: 800  KMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMT 859
            KMLTILNSRPEE+S INEG R  + SLN SEKANIQKVLQDGLSRAKKDYKDDSKKFGMT
Sbjct: 802  KMLTILNSRPEENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMT 861

Query: 860  LQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLA 919
            LQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK+ LEPPIQI               ++
Sbjct: 862  LQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLIS 921

Query: 920  RAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKG 979
            R QE DMNKLNDLRRALA+IQMESN+ISKFNVEERVNELFNEKKSLALKRLKELETKYKG
Sbjct: 922  RPQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKG 981

Query: 980  FGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXX 1039
            FGIDFNVE+IMESPKK S  + +E  A YSSLDP+ YQ KLDEINRI             
Sbjct: 982  FGIDFNVEEIMESPKKNSANERKEDGANYSSLDPRTYQNKLDEINRI----TDQLLDLQA 1037

Query: 1040 XXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGT 1099
                   G              +VYQDA P  E+RSENSELS  SG GSFLDALSQKYGT
Sbjct: 1038 QTKQDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSGSFLDALSQKYGT 1097

Query: 1100 GQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQ 1159
            GQN T S GLRDS YVS +GH PSKVEKTFMN+L++ST +SAPYLEELTQKVNKVE  EQ
Sbjct: 1098 GQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKVNKVESYEQ 1157

Query: 1160 NE---------HVNIPR---------EXXXXXXXXXXXXDEIEKYDQEHVENKIQXXXXX 1201
            +E           N PR         +              ++  ++E V+N  +     
Sbjct: 1158 DEDEVRSKESSSKNAPRNAVPVIDKVKESFRGHVESREEGRLDTKEEEIVKNDEETITTN 1217

Query: 1202 XXXXXQPNSVLEAENSLTSSSVLXXXXXXXXXXXXXXXXIELFGKSLVREKEIEDNAAKQ 1261
                   ++V  A++  T SS L                 ELFG SL +E+E +D++ KQ
Sbjct: 1218 LSAVCGSDNVANAKSITTVSSTLPPPPPPPPPPPVPV---ELFGNSLEKEEESKDDSVKQ 1274

Query: 1262 NTTAGEAVXXXXXXXXXXXXXXXMALFGKXXXXXXXXXXXXXXXXXXATGAIXXXXXXXX 1321
            +T  G A                MALFGK                  A GAI        
Sbjct: 1275 DTGNGAAP-------PPPPPPPPMALFGKNMGGTPPPPPLPSVLRSSAAGAIPPAPPMMP 1327

Query: 1322 XSQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYE 1381
             SQ+KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWG+GKAEKFADDLYE
Sbjct: 1328 ASQVKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYE 1387

Query: 1382 KGVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKV 1441
            KGVLADLEKAFAAREIKSLATKRKEDL+KITFLSRDISQQFGINLHMYSSLSV DLVKK+
Sbjct: 1388 KGVLADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKI 1447

Query: 1442 LNCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQ 1501
            LNCDRDFLQTPSVVEFLSK EIIEVSVNLARNYAPYSTDWEGV+NL DAKPPEKDPNDLQ
Sbjct: 1448 LNCDRDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQ 1507

Query: 1502 RADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNV 1561
            RADQ+YLQLM+NLESYWGSRMRAL VVTSYE+EYNELL KLRKVDKAVGALQ SDNLRNV
Sbjct: 1508 RADQIYLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNV 1567

Query: 1562 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFL 1621
            FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDT NSMTFLNYVEKIIRLNYP+FNDFL
Sbjct: 1568 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFL 1627

Query: 1622 KELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVL 1681
            KELEPVLDVVKVSIEQLVNDC+DFSQSIVNVERSVEIGNLSDSSKFHPLDK+LIKTLPVL
Sbjct: 1628 KELEPVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVL 1687

Query: 1682 PEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNL 1741
            PEAR+KGDLL+DEVKLTIMEFESLM TYGEDSG                NEYKKAQ+QNL
Sbjct: 1688 PEARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNL 1747

Query: 1742 AGEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQL 1801
            A EEEER+YEKHKK+V                S S S EGNEEDEAEDRR VMDKLLEQL
Sbjct: 1748 AAEEEERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQL 1807

Query: 1802 KNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVH 1861
            KNAGP K+DPSSARKRALVRK+YLSDKD++ QLLNDLDNEEGSILYSPEA  PD    +H
Sbjct: 1808 KNAGPGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIH 1867

Query: 1862 AESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDE 1921
            AESPTPL TRG +N PEDLPSPSKA  LEDQEEISDRA+MLLKELRGS+  VKQNS LDE
Sbjct: 1868 AESPTPLTTRGTLNIPEDLPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDE 1927

Query: 1922 HLEKLRARKERASSETNTGNKLSF 1945
            HLEKLRARKER   E + GNKLSF
Sbjct: 1928 HLEKLRARKERTIGEGSAGNKLSF 1951

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score = 2811 bits (7286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1462/1944 (75%), Positives = 1562/1944 (80%), Gaps = 37/1944 (1%)

Query: 21   GLLQNLKRLXXXXXXXXXXXXXXXXXXXXHSPMGQEXXXXXXXXXXFRNLNGPSRTTSIE 80
            GL QNLKRL                    H P+GQE          FR LNGPSR+TS E
Sbjct: 22   GLFQNLKRLANSSASNNNATSPNNASEHQHPPVGQETSTSSASSSSFRRLNGPSRSTSTE 81

Query: 81   ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ 140
            ARPLNKK+TLNTQNLSQYM+GK+S D P SSQHARSHSVQSKYSYSKR SSQASNKLTRQ
Sbjct: 82   ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNKLTRQ 141

Query: 141  HTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSG 200
            HT               TNLSKFTTPDGKIHLEMPSDPYEVE+LFEDIMYKRNIFQSLSG
Sbjct: 142  HTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSG 201

Query: 201  DKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLSS 260
            DKQE LM YSTEKKWLIVKQDLQNELKK+RAN              D  PILTANS+LSS
Sbjct: 202  DKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQHPILTANSTLSS 261

Query: 261  PKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXX---XXXXXIVTGSLKKQPSLNNIYRG 317
            PKS LMTSASSPTSTVY                          + G LKKQPSLN+IYRG
Sbjct: 262  PKSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGLKKQPSLNSIYRG 321

Query: 318  GSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQG 377
            G E N SASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFI+HQG
Sbjct: 322  GPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQG 381

Query: 378  HIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA 437
            HIAMANVLMNS+YKTAPR++LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA
Sbjct: 382  HIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA 441

Query: 438  EGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF 497
            EGLFSTKL T+KMATEIFVCMLEKKNK+RFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF
Sbjct: 442  EGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF 501

Query: 498  SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFIN 557
            SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASD+FKNGGGENAILEYCQWTMVFIN
Sbjct: 502  SHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFIN 561

Query: 558  HLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEA 617
            HLCSCSDN+NQRMLLRTKLENCG+LRIMNKIKLLDYDKVIDQI+LYDNNKLDDFNVKLEA
Sbjct: 562  HLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEA 621

Query: 618  NNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQL 677
            +N+AFNVDL+DPLSLLKNLW ICKGT+NEKLLVSLVQHLFLSSSKLIEENQN SKL+KQL
Sbjct: 622  SNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQL 681

Query: 678  KLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAER 737
            KLMDSLVTNVS+AS ADEESN+NMAIQRLYDAMQTDEVARRAILESR LTKKLEEIQAER
Sbjct: 682  KLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAER 741

Query: 738  DSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVE 797
            DSLSEKL KAEHGLVGQLE+ELH RD ILAKNQRVM                      VE
Sbjct: 742  DSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVE 801

Query: 798  LRKMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFG 857
            LRKMLTILNSRPEESSD+++GT++I+PSLN SEKANIQKVLQDGLSRAKKDYKDDSKKFG
Sbjct: 802  LRKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG 861

Query: 858  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNF 917
            MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPI+I               
Sbjct: 862  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKS 921

Query: 918  LARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKY 977
              + Q ADMNKLNDLRRALA+IQMESN+ISKFNVEERVNELFNEKKSLALKRLKELETKY
Sbjct: 922  SVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY 981

Query: 978  KGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXX 1037
            KGFGIDFNVE+ +E+PKK SV  + E DA Y SLDPKAYQ KLDEINRI           
Sbjct: 982  KGFGIDFNVEEFIETPKKFSV--DEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQV 1039

Query: 1038 XXXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKY 1097
                    + +             E+YQDASP+ E R E SELSAGSGPGSFLDALSQKY
Sbjct: 1040 KQETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKY 1099

Query: 1098 GTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPC 1157
            GTGQNVTASAGLRD+    G GH PS VEK+F+NRL++ST +SAPYLEELTQKVNKVEP 
Sbjct: 1100 GTGQNVTASAGLRDN---RGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEPF 1156

Query: 1158 EQNEHVNIPREXXXXX--XXXXXXXDEIEKYDQEHVENKI-----------QXXXXXXXX 1204
            +QN+  ++ ++              D++    Q+H++NK+           +        
Sbjct: 1157 KQNKDEDLVKDLSTENDIADGTFVSDKVGGDVQKHIKNKVRKRLDDKEEEEEGVTTDTSH 1216

Query: 1205 XXQPNSVLEAENSLTSSSVLXXXXXXXXXXXXXXXXIELFG---KSLVREKEIEDNAAKQ 1261
                +S +EAEN  T+SS L                + LFG   +S  +EKE ED+    
Sbjct: 1217 VSDSDSEVEAENPSTTSSTL--HPPPPPPPPPPPIPLRLFGTVNQSPDKEKETEDD---- 1270

Query: 1262 NTTAGEAVXXXXXXXXXXXXXXXMALFGKXXXXXXXXXXXXXXXXXXATGAIXXXXXXXX 1321
              TAGEA                M LFG+                    GAI        
Sbjct: 1271 --TAGEAA---AAPPPPPPXXXXMGLFGQNNGGTPPPPPLPFVLSSTGPGAIPPAPPMMP 1325

Query: 1322 XSQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYE 1381
             SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEK+DSTDNSIWGSGKAEKFADDLYE
Sbjct: 1326 ASQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYE 1385

Query: 1382 KGVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKV 1441
            KGVLADLEKAFAAREIKSLATKRKEDLQK+TFLSRDISQQFGINLHMYSSLSV DLVKK+
Sbjct: 1386 KGVLADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKI 1445

Query: 1442 LNCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQ 1501
            L CDRDFLQTPSVVEFLSK EI EVSVNLARNYAPYSTDWEG+R+L+DAKPPEKDPNDLQ
Sbjct: 1446 LKCDRDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQ 1505

Query: 1502 RADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNV 1561
            RADQ+YLQLM+NLE YWGSRMRALTVVTSYE+EYNELLAKLRKVD+AVGALQ SDNLRNV
Sbjct: 1506 RADQIYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNV 1565

Query: 1562 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFL 1621
            FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDT NSMTFLNYVEKIIRLNYP+FNDFL
Sbjct: 1566 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFL 1625

Query: 1622 KELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVL 1681
            KELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVL
Sbjct: 1626 KELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVL 1685

Query: 1682 PEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNL 1741
            PEARRKGDLL+DEVKLTIMEFESLMQTYGEDSG                NEYK+AQ+QNL
Sbjct: 1686 PEARRKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNL 1745

Query: 1742 AGEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQL 1801
            A EEEERLYEKHKK+V                SA P   GNEE+E EDRR VMDKLLEQL
Sbjct: 1746 AAEEEERLYEKHKKMVEEQQKRAQDKEKHREHSALPE--GNEEEETEDRRAVMDKLLEQL 1803

Query: 1802 KNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVH 1861
            KNAGPAK+DPSSARKRALVRKKY+SDKD++ Q+LNDL++EEGSILYSPEATTPDT T +H
Sbjct: 1804 KNAGPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIH 1863

Query: 1862 AESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDE 1921
            AESPTPLATRG MNTPEDLPSPSKA ALEDQEEI+DRARMLLKELRGS+  VKQNS LDE
Sbjct: 1864 AESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDE 1923

Query: 1922 HLEKLRARKERASSETNTGNKLSF 1945
            HLEKLRARKERA+ ETNTGNKLSF
Sbjct: 1924 HLEKLRARKERANGETNTGNKLSF 1947

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1097 (55%), Positives = 751/1097 (68%), Gaps = 55/1097 (5%)

Query: 74   SRTTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQA 133
            S T S+  +PLNKK++LNTQNLSQY++ K S       QH RS SVQS   YS    S +
Sbjct: 65   SHTNSL--KPLNKKTSLNTQNLSQYINDKHSP------QHTRSASVQSSSKYSYSRRSSS 116

Query: 134  S------NKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFED 187
                   N++ RQHT               TNLSKF  PDGKI+LEMP DP EVE+LFED
Sbjct: 117  QTLGSTLNQIARQHTNQSSASILSQGSF--TNLSKFIAPDGKINLEMPRDPNEVEVLFED 174

Query: 188  IMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXD 247
            IM KRNI QSL  DKQ  LM Y  EKKWLIVKQDLQNE+KKMR                 
Sbjct: 175  IMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRS 234

Query: 248  HL-PILTANSSLSSPKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLK 306
             + P  ++  +L+SP ++ M    SP   +                         TG + 
Sbjct: 235  SMSPENSSTINLNSPATMQM----SPHHHIGSNSNSSINSHHTPITISKRP----TGPIS 286

Query: 307  KQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 366
                  ++Y+    N  S+S    D+TNRPPIHYV+RI+AD +T++EMKDLWVTLRTEQ+
Sbjct: 287  NPIPNADMYKLSMRNTSSSSM--SDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQI 344

Query: 367  DWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEF 426
            DWVDAFIEHQGHIAMAN+LM S+YKT+       +LLEKEN+FFKCFRVLSMLSQGL EF
Sbjct: 345  DWVDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREF 404

Query: 427  STHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHM 486
            + H +M+ TVA GLFS  L+T++MATEIFVCMLEKKN  RF+ +L ALD+KF+IG N HM
Sbjct: 405  TRHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHM 464

Query: 487  IQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAIL 546
             QN K  P YF+HLTL+S LK+ QAWLFAVE TLDGRGKMGSLVGASDDFKN GGENAIL
Sbjct: 465  TQNIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAIL 524

Query: 547  EYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNN 606
            EYCQW+M+FINHLCSCS NINQRMLLRTKLENCG+LRIMNK+K LDYDKVI+QIDLY+NN
Sbjct: 525  EYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENN 584

Query: 607  KLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEE 666
            KLDD N  LE+NN+  N++LQDP S+L+NLW  CKGTENEKLL+SL+QHLFLSSS+ IEE
Sbjct: 585  KLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEE 644

Query: 667  NQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRAL 726
             ++  KL++QLKL+DSLVTNVS+ S+ D+E+++NMAIQRLYDAMQTDEVARR+ILESR L
Sbjct: 645  KKDPVKLSRQLKLLDSLVTNVSV-SSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTL 703

Query: 727  TKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXX 786
            TKKLEE+QAERD LS+KL  AEHGLVGQL+DEL +RD IL+KNQRVM             
Sbjct: 704  TKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKK 763

Query: 787  XXXXXXXXXVELRKMLTILNSRPE--ESSDINEGTRNIDPS-LNFSEKANIQKVLQDGLS 843
                     VELRKMLTILN+RPE  E +  ++ T+  +PS L+ S+K +IQ+ LQDGLS
Sbjct: 764  HLLEKHEQEVELRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLS 823

Query: 844  RAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIX 903
            R KKDY  D++ FGMT+QPNKRLK+LRMQME+IENEAR+LEMTNF E+EK +LE P +I 
Sbjct: 824  RTKKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIK 883

Query: 904  XXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKK 963
                               +  +NKLNDLR+ LA+IQMESN+ISKFNV+ERVNELFN+K+
Sbjct: 884  KPKKVATKKEI--------DPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKR 935

Query: 964  SLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVA-DEREGDARYSSLDPKAYQKKLDE 1022
              ALKRL++LETKYK FGIDFN++++++S  K     +++ GD  YSSLDPKAYQ+KLDE
Sbjct: 936  ITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNNQQSGD--YSSLDPKAYQRKLDE 993

Query: 1023 INRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSA 1082
            +NR+                   + +                 D     E +   S  S 
Sbjct: 994  LNRLTDELLRVKNKVNASDNNLSSRRPSASSSSESASSSSDSDDGESLIERQDTQSNFSG 1053

Query: 1083 GS-GPGSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSA 1141
             S GPGSFL+AL+QKY TGQ    SA  RD         +    +  F+NR+K++ V + 
Sbjct: 1054 TSAGPGSFLEALTQKYATGQ---KSASPRD--------QSTRMKDNIFINRIKQTNV-AP 1101

Query: 1142 PYLEELTQKVNKVEPCE 1158
            P+L+ELT KV +  P E
Sbjct: 1102 PFLDELTDKVAEAPPVE 1118

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/626 (67%), Positives = 501/626 (80%), Gaps = 15/626 (2%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            K  + SPLLPQS SLFE YPRP KKLKQLHWEKLD+TDNSIW + KAEKFADDLYEKGVL
Sbjct: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
             DLEKAFAAREIKSLA+K+KEDL KI+FLSRDISQQFGINLHMY++L V D+VKK+L CD
Sbjct: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RDFL TPSV+EFLSK EI+EVSVNLARNYAPYSTDWEGV++++DAK PEKDPN+LQRADQ
Sbjct: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YLQL+INL+SYWGSRMRALTV+T++++EYNELL KLRKVDKAV +LQ S+NL+NVFNVI
Sbjct: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R NYP+FNDFL ELE
Sbjct: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERSVE GNLSDSSKFHP D+VL K LP+LP+AR
Sbjct: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +KG+LL DEVKLTIMEF  LMQ YGEDS                  EYKKAQ QN+  EE
Sbjct: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEE 1692

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEE---DEAEDRRDVMDKLLEQLK 1802
            EE++YE+HKK+V                + S   E  EE   D++ DRR +MDKLL+QLK
Sbjct: 1693 EEQVYERHKKMV-----EDQQKKLQEQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLK 1747

Query: 1803 NAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHA 1862
            NAGP+KTDPSSARKRALVRKK +++   +  LL D++ E+ SI+YSPE   P     V  
Sbjct: 1748 NAGPSKTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNP-FVNPVDL 1803

Query: 1863 ESPTPLATRGLMNTP-EDLPSPSKAPAL--EDQEEISDRARMLLKELRGSEISVKQNSTL 1919
            ++P   +   + ++P +   SPS+   L  +DQ+E++DRA+ LL ELRGS    K+NS L
Sbjct: 1804 DTPHDESEMDVSSSPIQRSLSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLL 1863

Query: 1920 DEHLEKLRARKERASSETNTGNKLSF 1945
            DEH EKLRAR+ + +S+ ++G +L F
Sbjct: 1864 DEHKEKLRARRRKTNSDLHSGTRLQF 1889

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1079 (55%), Positives = 741/1079 (68%), Gaps = 54/1079 (5%)

Query: 82   RPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQH 141
            +PLNKKSTLNTQNLSQYM    S+    +S    S S +S    S   +S++  +L+RQH
Sbjct: 83   KPLNKKSTLNTQNLSQYMDHARSSSTNSASASKYSSSRRSSTQVS---TSESLRRLSRQH 139

Query: 142  TXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGD 201
            T                N SKF TPDGK +LEMP DP E+E LFE+IMYKRNI Q+LS +
Sbjct: 140  TGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVE 199

Query: 202  KQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLSSP 261
            KQ  LM Y   KKWLIVKQD+QNE K++RA                       NSSL + 
Sbjct: 200  KQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNG-----------------PKNSSLVNV 242

Query: 262  KSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLKKQPSLNNIYRGGSEN 321
            + ++ +  ++ T+                          +T    K+P+ + +Y+  +E+
Sbjct: 243  EQLVYSPTTTTTNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSHELYQL-TES 301

Query: 322  NISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAM 381
            N S STL  D+TNRPP  YV++I+ADKL+ DEM+DLWVTLRTEQLDWVD+F+E+QGHIAM
Sbjct: 302  NASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAM 361

Query: 382  ANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLF 441
            AN+LM  +YKT P+D+L+ +LLEKENSFFKCF+VLSMLSQG+YEFS H+LMTDT+A GLF
Sbjct: 362  ANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLF 421

Query: 442  STKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLT 501
            ST+L T+KMA EIFVCMLEK+NKSRFEA+L +LD+ FRIG N HM QN KK+PQYF HLT
Sbjct: 422  STRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLT 481

Query: 502  LESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCS 561
             +SHLK++QAWLF++E T+DGRGKMGSLVGAS D KN GGENAILEYC WTMVF+N LC+
Sbjct: 482  PDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCN 541

Query: 562  CSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEA 621
             S  I QRMLLRTKLEN G LRIMNKIKLL+Y+KVID+I+ Y+NNKLDDFN+ LE+ N+ 
Sbjct: 542  ASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKN 601

Query: 622  FNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMD 681
             NV+LQDP+SLL NLW  CKGTENEKLL+SL+QHLFLSSS+LIEE  + +KL+KQLKLMD
Sbjct: 602  SNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMD 661

Query: 682  SLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 741
            SLVTNVS +S ADEES +NMAIQRLYD+MQTDEVARRAILESR LTKKLEE+QAE+D L 
Sbjct: 662  SLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLH 721

Query: 742  EKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKM 801
            EKLSKAE+GLVGQLE++L+ERD ILAKNQRV                       VELRKM
Sbjct: 722  EKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKM 781

Query: 802  LTILNSRPEESSDINEGTRNID------PSLNFSEKANIQKVLQDGLSRAKKDYKDDSKK 855
            LTILN+R    S  N+G + ID        LN  +  NIQKVLQDGL RAK D+  D+KK
Sbjct: 782  LTILNTR----SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKK 837

Query: 856  FGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXX 915
            FGMT+QPNKRLKMLRMQME+IENEARQLEMTNF EFE+++LEPP+++             
Sbjct: 838  FGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIE 897

Query: 916  NF---LARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKE 972
                  +  Q++ +NKLNDLR ALA+IQ ESNNISKFN+EERVNELFNEKK  AL+RLKE
Sbjct: 898  KINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKE 957

Query: 973  LETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXX 1032
            LETKYK FGI+F ++  +E+ K      E   +  Y SLDPK Y+KKLD+I+R+      
Sbjct: 958  LETKYKDFGINFEMKDFLEN-KPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLN 1016

Query: 1033 XXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDA 1092
                         +                V   +S             AGSG  SFL+ 
Sbjct: 1017 LQKTQELREESSSSYSSSESDEENDDDEIFVASSSSK-----------PAGSGTRSFLET 1065

Query: 1093 LSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKV 1151
            LS+KYGTGQ   A     +S  V       ++ EK F++R++RS+  +AP+L+ELT+KV
Sbjct: 1066 LSEKYGTGQKNVAMTATPNSRIV-------TQSEKQFLDRMRRSST-AAPFLQELTEKV 1116

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/626 (64%), Positives = 487/626 (77%), Gaps = 19/626 (3%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            KS  +SPLLPQSPSLFE+YPR  KK+KQLHWEK+++TDNSIW +GKAE+FADDL+EKGV 
Sbjct: 1285 KSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVF 1344

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            ++LEKAFAARE+KSLA+KRK+DL KITFLSRDISQQFGINLHMYSSLSV DLV K+L CD
Sbjct: 1345 SNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCD 1404

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RDFL TPSV+EFLSK EI EVSVNLARNY+PY+TDWEG+++++DAKPPEKDPNDLQRADQ
Sbjct: 1405 RDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQ 1464

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YLQLM+NL+ YW SRMRAL ++T+YE+EYNELL KLRKVDKAVG+LQ S+NLRNVFNVI
Sbjct: 1465 IYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVI 1524

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MNDTSKQAQGFKLSTLQRLTFIKD+TNSMTFLNYVEKIIR+NYP+FN FL+ELE
Sbjct: 1525 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELE 1584

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVL+VVK+SIEQL NDCK+F QS+ NVERS+EIGNLSDSSKFHPLD+VL K LP LP+ R
Sbjct: 1585 PVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVR 1644

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +KGDLL DEV LT+MEF+ LMQ YGED+                 NEY+KAQ QN+  EE
Sbjct: 1645 KKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEE 1704

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAE--DRRDVMDKLLEQLKN 1803
            EE  YE+HK++V                +     + NE+D+ E  DRR  MDKLLEQLKN
Sbjct: 1705 EEEAYERHKRMVEEQQRKAERKEAKNQNNI----DENEDDDQERTDRRGTMDKLLEQLKN 1760

Query: 1804 AGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAE 1863
             GP++ DPSSARKRAL RKK L+DK+    +++DL+ E  SI+YSP+           A 
Sbjct: 1761 VGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDN---------KAI 1811

Query: 1864 SPTPLATRGLMNTPEDLPSPSKAPALED---QEEISDRARMLLKELRGSEISVKQNSTLD 1920
              TP    G  +  ++    S +    D   +EEIS+RA+ LL  LRG+    K+NS LD
Sbjct: 1812 GSTPFGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLD 1871

Query: 1921 EHLEKLRARKERASSETNTG-NKLSF 1945
            EH EKLRAR+ R +++  +G NKL F
Sbjct: 1872 EHKEKLRARRRRTNNDLPSGSNKLKF 1897

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1119 (52%), Positives = 728/1119 (65%), Gaps = 98/1119 (8%)

Query: 68   RNLNGPSRTTSI-EARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--KYS 124
            R ++ PSR ++  + RPLNKKST+NTQNLS YM+GK SA+  +SS H+RS SVQS  KY+
Sbjct: 55   RKVSVPSRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAE-SLSSNHSRSPSVQSSTKYT 113

Query: 125  YSKRNSSQAS-----NKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPY 179
            YS+R+SS  S     + LTR+ T               +NL+ F TPDGKI L+MPS  +
Sbjct: 114  YSRRSSSHLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPSS-H 172

Query: 180  EVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXX 239
            EVE LFED+MYKRNI Q+LS DKQ+ LM Y  +KKWLIVKQDLQN+ KK+ A        
Sbjct: 173  EVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAA-- 230

Query: 240  XXXXXXXDHLPILTANSSLSSPKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXX 299
                    H  I ++NS             SSP S++                       
Sbjct: 231  --------HAAISSSNSDSLP----SSLKVSSPRSSMTYES------------------- 259

Query: 300  IVTGSLKKQPSLNNIYRGGSENNIS-----------ASTLPGDRTNRPPIHYVQRILADK 348
             +  ++K   + N    G + NN S            STL  ++ NRPPIHYV+RI+ADK
Sbjct: 260  -IQQAIKFNKTNNGSSSGPASNNKSKLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADK 318

Query: 349  LTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENS 408
            LT +EM DLWVTLRTEQLDWVD F+EHQGHIAMANVL  S+YKT P   L+ +LLEKE++
Sbjct: 319  LTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHA 378

Query: 409  FFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFE 468
            FF+CFRVLS+L+QGLYE S H +M +TVA GLFS +LAT+KMATEIFVCMLEKKNK RFE
Sbjct: 379  FFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFE 438

Query: 469  AVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGS 528
            AVL ALDKKF+IG+NLHM+   K  PQ+FSH T +S  KI+Q+WLFAVEQ+L+GRGKMGS
Sbjct: 439  AVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGS 498

Query: 529  LVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKI 588
            LVGAS+DFK  GGENAILEY QWTMVFINH C+ +D INQR+LLRT+LEN G LRIMN+ 
Sbjct: 499  LVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQF 558

Query: 589  KLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKL 648
            KLLDYDKV++ ++ Y+N KLDD N  LE    A ++D+ D  SLLK L+  CKGTE+EKL
Sbjct: 559  KLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKL 618

Query: 649  LVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYD 708
            L SLV+HLFLS+S+L+E+NQ+ +KL+KQL+LMDSLVTNVS+ SA DE S++NMAIQRLYD
Sbjct: 619  LNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSV-SAVDESSSINMAIQRLYD 677

Query: 709  AMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAK 768
            +MQTDEVARRAILESR LTKKLEE QAERD LS+KLSK  +GLVGQLE E+ +RD IL K
Sbjct: 678  SMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEK 737

Query: 769  NQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPE-ESSDINEGTRNIDPS-L 826
            NQRV                       VELRKMLTILNSRPE + S          P  L
Sbjct: 738  NQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGDLSRKGSVHSKAQPGIL 797

Query: 827  NFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMT 886
            +  +K+ IQ+ LQDGL + KKD   DSK+FG+T+QPNKRLKMLR+QME+IE EAR+LEMT
Sbjct: 798  DPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMT 857

Query: 887  NFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNI 946
            NFA+  K  L+ P+++                 RA+E   NKL++LR+ALADIQ ESN +
Sbjct: 858  NFADHNKAVLQAPVKVESSNYVRKENEL-----RAKELKANKLSELRKALADIQKESNGV 912

Query: 947  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDA 1006
            SKFNVEERVNELF +KK  AL RL +LE  YK +GID +    ++   + S   E+  + 
Sbjct: 913  SKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEG 972

Query: 1007 RYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQD 1066
              S+LDP+AYQ KLDEI+RI                     K              + + 
Sbjct: 973  P-STLDPRAYQAKLDEIDRI--------------------SKELIEMKSELKNDKALRRH 1011

Query: 1067 ASPTH------EIRSENSELS---AGSGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSG 1117
             SP+       EI+   S ++     SG  SFL++LSQKYGTG+N T             
Sbjct: 1012 ESPSKQDTDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSER 1071

Query: 1118 LGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEP 1156
             GH+     ++FM R+K+ +   A YLEEL  KV K  P
Sbjct: 1072 KGHS----RQSFMERMKKPSGVPA-YLEELPLKVPKAPP 1105

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/624 (64%), Positives = 480/624 (76%), Gaps = 26/624 (4%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            ++AV SPLLPQSPSLF  YPR  KKLKQLHWEKLD+TDNSIW SGKAEKFA DLYEKGVL
Sbjct: 1236 RTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVL 1295

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
             DLEKAFAAREIKSLATK++EDL KITFLSRD+SQQFGINLHMYS LSV +LV K+L C+
Sbjct: 1296 EDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCE 1355

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RDF+ TPSV+EFLSK EIIEVS NLARNY+PYSTDW+GV  ++DAK PEKDP +LQRADQ
Sbjct: 1356 RDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQ 1415

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YLQL+ NL+ YWGSRMRAL V+TSYEREY+EL+ KLRKVDKAV  +Q S NLRNVFNVI
Sbjct: 1416 LYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVI 1475

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MND++KQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP+FNDFL++L+
Sbjct: 1476 LAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQ 1535

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVLDVVK+SIEQL++DCK+FSQSI NVERS++IGNL+DSSKFHPLDKVL+K LPVLPEA 
Sbjct: 1536 PVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEAS 1595

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            ++ +LL +EVKL+IMEFESLMQ YGEDS                 NEYK+AQAQNL  EE
Sbjct: 1596 KRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEE 1655

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805
            EERLY+ HKK+V               RS + + E   E E EDRR +MDKLLEQLKNAG
Sbjct: 1656 EERLYQTHKKMV----EEQQKRAEEKERSENATEEDASE-ENEDRRAMMDKLLEQLKNAG 1710

Query: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESP 1865
            P K DP SARKRA++RKK L+D ++   +L+ +  E+ S++YSPE               
Sbjct: 1711 PVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPE--------------- 1755

Query: 1866 TPLATRGLMN-TPEDLPSPSKAPA--LEDQEEISDRARMLLKELRGSEISVKQNSTLDEH 1922
                  G+ N T +   SPSK  A   +D+EEI+DRA+ LL  LRG E   K+N+ L+ H
Sbjct: 1756 ---KQEGITNPTGDSSQSPSKGAANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGH 1812

Query: 1923 LEKLRARKERASSETNTGNKLSFN 1946
             EKLRAR+ + +++ +      FN
Sbjct: 1813 KEKLRARRRKTNTDMSPEGSFLFN 1836

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1115 (51%), Positives = 729/1115 (65%), Gaps = 69/1115 (6%)

Query: 73   PSRTTSIEARPLNKKSTLNTQNLSQYMSG-KMSADVPI-----SSQHARSHSVQS--KYS 124
            P + TS E RPLNKKSTLNTQNLSQY+SG K+  D P      ++ H R+HS QS  KYS
Sbjct: 54   PKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYS 113

Query: 125  YSKRNSSQASN-KLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEI 183
            YS+R+S+     KL+RQ T               TNL K+   DGKI+LEMP DP+EVE 
Sbjct: 114  YSRRSSTATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEA 173

Query: 184  LFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXX 243
            LFED+MYKRNIFQ+L  DKQ+ LM Y   KKW +VKQDLQNE+KK+ +            
Sbjct: 174  LFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSS-------- 225

Query: 244  XXXDHLPILTANSSLSSPKSIL------------MTSASSPTSTVYXXXXXXXXXXXXXX 291
                + P   + SS S+    L               ++SP + ++              
Sbjct: 226  ----YHPTEGSYSSASNSNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINL 281

Query: 292  XXXXX---XXXIVTGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADK 348
                          GS       N++    SENN S S++  DR NRPPIHYV++I+AD+
Sbjct: 282  NNGNIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADR 341

Query: 349  LTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENS 408
            LT++EM DLWVTLRTEQLDWVDAF+EHQGHIAMANVLMN++YK AP   LT EL EKE+S
Sbjct: 342  LTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHS 401

Query: 409  FFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFE 468
            FFKCFRVLSMLSQGLYEF+ H+LM+DT+A GLFS++LAT+KMATE+ VCM+EK+N  RFE
Sbjct: 402  FFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFE 461

Query: 469  AVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGS 528
             VL +LD+ FR  +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGS
Sbjct: 462  VVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGS 521

Query: 529  LVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKI 588
            LVGASDD+++  GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+
Sbjct: 522  LVGASDDYRS-AGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKL 580

Query: 589  KLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKL 648
            K LDY+K+ +QI+LYDNNKLDDFN  LE  ++   V++Q+P SL++NLW  CKG++NEKL
Sbjct: 581  KRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKL 640

Query: 649  LVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYD 708
            L+SL+QHL+LSSSKL+ E ++ +KL+KQLKL+DSL+TNV+  S  DEES++N+AIQRLYD
Sbjct: 641  LLSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYD 699

Query: 709  AMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAK 768
            +MQTDEVARRAILESR LTKKLEE  AERD LS KLS AE+GLVGQLE +L +RD+IL K
Sbjct: 700  SMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEK 759

Query: 769  NQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSR-PEESSDINEGTRNIDPSLN 827
            NQRVM                      VELRKMLTILNSR   ++ D+++ T  +DP   
Sbjct: 760  NQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSRNGTQNPDVDDVTITLDP--- 816

Query: 828  FSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTN 887
             ++K +IQK L+  L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTN
Sbjct: 817  -NKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTN 875

Query: 888  FAEFEKERLEPPIQIXXXXXXXXXXX-XXNFLARAQEADMNKLNDLRRALADIQMESNNI 946
            FA+ ++  L+ P+ +                  +  E    KL  LR+ALA IQ E+N+I
Sbjct: 876  FADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDI 935

Query: 947  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDA 1006
            SKFNVE RVNE+F +KK  AL+RLK+LE KYK F I F+         +     E + + 
Sbjct: 936  SKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFD-------ELQDLDDRELDDEQ 988

Query: 1007 RYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQD 1066
            ++S+LDP   QKK++E++ I                   NG                  D
Sbjct: 989  QHSTLDPTYLQKKINELDEI-----SDELYLMNYDSDANNGNTSDSSSSSEA-------D 1036

Query: 1067 ASPTHEIRSENSELSAG-SGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKV 1125
               T  +RS ++  S G S  GSFL++LSQKYGTGQN  +S     +   S      S+ 
Sbjct: 1037 GDGTDSMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSP----TSITSPNERIASQG 1092

Query: 1126 EKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCEQN 1160
            EK+FMNRLKR T+ +AP+LEELTQKVN     + N
Sbjct: 1093 EKSFMNRLKRQTM-AAPFLEELTQKVNDTSSIDDN 1126

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/629 (61%), Positives = 466/629 (74%), Gaps = 24/629 (3%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            KS V  P L Q  +  ++ PRP KKLKQLHW+KLDSTD+SIW  G AE+FADDLYEKGVL
Sbjct: 1254 KSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVL 1312

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
             +LEKAFAAREIKS+ T++KEDL KI+FLS DISQQFGINLHMY SL+VP+L++KVL CD
Sbjct: 1313 RNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            R+ + TPSV+EFL+K+EI+EVSVNLARNYAPY+TDWEGV++L   K         QR  Q
Sbjct: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQ 1424

Query: 1506 V-------YLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNL 1558
            +       ++  M+NL+SYW SRMRAL V+TSYEREYNEL+ KLRKVDKAVGA+Q S+NL
Sbjct: 1425 MTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENL 1484

Query: 1559 RNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFN 1618
            +NVFNVILAVGN+MNDTSKQAQGFKLSTLQRLTFIKD TNSMTFLNYVEKI+R NYP+FN
Sbjct: 1485 KNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFN 1544

Query: 1619 DFLKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTL 1678
            DF+ +LEPVLDVVK+S+EQL++DC +FSQSIVNVERS+EIGNLSDSSKFHP DKVL K L
Sbjct: 1545 DFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVL 1604

Query: 1679 PVLPEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQA 1738
            PVLPEA +K  LL DEVKLTIMEFE+LM+ YGED+G                 EYKKAQ+
Sbjct: 1605 PVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQS 1664

Query: 1739 QNLAGEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLL 1798
            QNL  EEEER YEKHK+++                  S   EG   +E  DRR +MDKLL
Sbjct: 1665 QNLKQEEEERAYEKHKRMIEEQQHKQDLEEER-----SREVEGEPGEEQSDRRAMMDKLL 1719

Query: 1799 EQLKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYT 1858
            E+LKNAGP K DPSSARKRALVRKK L+DK+    +L D+D  + SI+YSP   T +   
Sbjct: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPN 1779

Query: 1859 AVHAESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNST 1918
             +H  SPTP     L+         S A  + + E ISDRA+ LL ELRGSE ++K+NS 
Sbjct: 1780 DIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSE-NMKRNSQ 1838

Query: 1919 LDEHLEKLRARKERASSETN--TGNKLSF 1945
            L+E  EKL+AR+ R  ++T   + NKL F
Sbjct: 1839 LEEQKEKLKARRSRRRTQTESISSNKLFF 1867

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1110 (49%), Positives = 722/1110 (65%), Gaps = 80/1110 (7%)

Query: 82   RPLNKKSTLNTQNLSQYMSGKMS----ADVPISS---QHARSHSVQ-SKYSY---SKRNS 130
            +PL+KK+T+N+QNLS Y SG  +     D  ++S    H+R+ S Q S++SY   S+R+S
Sbjct: 152  KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 131  SQASNKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTP-DGKIHLEMPSDPYEVEILFEDIM 189
            S A  KL + HT               T  ++F +P DGK+ LEMP DP EVE+L+EDIM
Sbjct: 212  SDA--KLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIM 269

Query: 190  YKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHL 249
            YKRNI Q+L  DKQ  LM Y  +KKWLIVKQDLQNE KK++                  +
Sbjct: 270  YKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKTSSHQQTVQSAP---FM 326

Query: 250  PILTANSSLSSP-------KSILM-TSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIV 301
             +   +SS S P       +S++  TS+  PT+                         + 
Sbjct: 327  NLQDTSSSASLPGQGFHDQQSVVSETSSRVPTTNDAASILSSATPSLRHPSRRKQQYTLT 386

Query: 302  TGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTL 361
                   P+     R  S    S+STL  D+TNR PIHYV++I+AD+L+ DE+ DLWVTL
Sbjct: 387  NKQHTVYPANGTAERHAS----SSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTL 442

Query: 362  RTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQ 421
            RTEQLDWVDAF+++QGHIAMANVLM S+YKT+P  +L+  LL+KE S+FKCF+VLSML+Q
Sbjct: 443  RTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQ 502

Query: 422  GLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIG 481
            GL EF+ HRL+TDT+A GLFS++L T+KMATEIFVCMLE KN++RF+AV+T+LD+ F+IG
Sbjct: 503  GLREFTDHRLITDTIARGLFSSRLPTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIG 562

Query: 482  QNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGG 541
             N HM+ N +KMP YF HL L+S LK++QAWLFA++QTLDGRGKMGSLVGASD+FK   G
Sbjct: 563  SNAHMVNNLQKMPDYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDG 622

Query: 542  ENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQID 601
            EN++LEYCQWT+VF+N  C  S+N+NQRMLLRTKLEN G LRIMNK+KLLDY+K+ DQI+
Sbjct: 623  ENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIE 682

Query: 602  LYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSS 661
             Y+  KLDDFN  LE+ N+  N+D+Q+PLSLL+NLW  C+GT++E LLVSLVQHLFLSS+
Sbjct: 683  FYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSST 742

Query: 662  KLIEENQNSSKLTKQLKLMDSLVTNV--SIASAADEESNLNMAIQRLYDAMQTDEVARRA 719
            +LI+ N++ ++L KQLKL+DSLVTNV  S+++ ADEE+ ++M IQRL+D+MQTDEVARRA
Sbjct: 743  RLIQNNKDPTQLAKQLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRA 802

Query: 720  ILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXX 779
            I+ESR LTKK+EE+QAE+D L +KLSKAE GLVG+L+ ++ ERD ILAKNQRV       
Sbjct: 803  IIESRTLTKKMEELQAEKDRLGDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENE 862

Query: 780  XXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDINEGT---RNIDP----SLNFSEKA 832
                            VELRKMLTI+NS+   +   N      ++ DP    SL   +++
Sbjct: 863  LEELKRKTLMEKHEHEVELRKMLTIINSKASPNLAQNPSASVLKSHDPKNKESLLSEQQS 922

Query: 833  NIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFE 892
             IQKVLQDGL+R KKD+ +D+KKFGMT+QPNKRL++LRM++E+IENEARQLEMTNFA+ E
Sbjct: 923  KIQKVLQDGLTRTKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIE 982

Query: 893  KERLEPPIQIXXXXXXXXXXXXXNFL-----ARAQEADMNK----LNDLRRALADIQMES 943
            K     P+ +                      RA + + N+    LN LR AL  IQ ES
Sbjct: 983  KN--ATPVILTKGTKKKKSKKKLKTAQPDKKQRANQRNENQKIEALNKLRMALTAIQSES 1040

Query: 944  NNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADERE 1003
            N+ISKFNVEE VNELF E+K  AL+RL++LE+K+ G   +FN++ I+ S +K   A    
Sbjct: 1041 NDISKFNVEEHVNELFTERKFKALQRLRDLESKFNGLNTNFNIDDIIASTEKALTA---- 1096

Query: 1004 GDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEV 1063
             D  Y SLDP+    KLDEI R+                                   E 
Sbjct: 1097 TDDGY-SLDPRRADNKLDEIERLTNDLSKLHDSMKEQEQATLQ-----SDNSSESSDSES 1150

Query: 1064 YQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPS 1123
             +  +    ++S+ SE + GS  GSFL +LSQKY TGQ                  ++P 
Sbjct: 1151 VESDNEGSTVQSDVSEPTVGS--GSFLASLSQKYETGQKQP---------------NSPV 1193

Query: 1124 KV-EKTFMNRLKRSTVNSAP-YLEELTQKV 1151
             V +K FM RLKRS+   AP YL+EL++K+
Sbjct: 1194 TVNQKAFMTRLKRSS--GAPLYLQELSKKI 1221

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/649 (63%), Positives = 502/649 (77%), Gaps = 20/649 (3%)

Query: 1309 ATGAIXXXXXXXXXSQMK-SAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIW 1367
            ++GAI         +  K S + SPL  QS S+FEKYPRP KKLKQLHWEKLDST+NSIW
Sbjct: 1341 SSGAIPPPPPPPQATSAKNSPIPSPLFSQS-SIFEKYPRPQKKLKQLHWEKLDSTNNSIW 1399

Query: 1368 GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLH 1427
             + KAEKFADDLYEKGVL++LEKAFAARE+KSL++K+ +D  KITFL+RD+SQQFGINLH
Sbjct: 1400 SASKAEKFADDLYEKGVLSNLEKAFAAREVKSLSSKKGDD-SKITFLTRDVSQQFGINLH 1458

Query: 1428 MYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNL 1487
            M+ +LSV +LV K+L CDR+ L +PSV+EFLSK E++EVSVNLARNY+PYSTDWEGV+ +
Sbjct: 1459 MFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQEVVEVSVNLARNYSPYSTDWEGVKRI 1518

Query: 1488 DDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDK 1547
            +DAK PEKDPN+LQRADQ+Y+ LM+NL+ YW SRMRAL V+T+YEREY ELL KLRKVDK
Sbjct: 1519 EDAKAPEKDPNELQRADQLYMSLMVNLQPYWSSRMRALKVITTYEREYAELLEKLRKVDK 1578

Query: 1548 AVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVE 1607
            AVG+LQ S+NL+NV NVILAVGN+MNDTSKQAQGFKL+TLQRLTFIKDTTNSMTFLNYVE
Sbjct: 1579 AVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDTTNSMTFLNYVE 1638

Query: 1608 KIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKF 1667
            KI+R NYP FNDFL EL+PVLDVVK+SI+QLV+DC++FS S+VNVERS+EIGNLSDSSKF
Sbjct: 1639 KIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSDCQEFSGSVVNVERSIEIGNLSDSSKF 1698

Query: 1668 HPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXX 1727
            HP D+VL+K LPVLPEAR+K DLL DEVKLT++EF +LMQTYGEDS              
Sbjct: 1699 HPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLEFNNLMQTYGEDSADKFAKNSFFKKFA 1758

Query: 1728 XXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNE---- 1783
                EYKKAQ QN+A EEEE+ YE+HKK+V                SASP     E    
Sbjct: 1759 DFIQEYKKAQVQNVAAEEEEQQYERHKKIV-EEQQRQGEEARKRLESASPDATNGEDTTA 1817

Query: 1784 -EDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEE 1842
             +DE +DRR +MDKLLEQLKNAG  K DPSSARKRAL R+K L DKD+A  LL+D+D ++
Sbjct: 1818 VDDETKDRRAIMDKLLEQLKNAGTVKADPSSARKRALARRKLLGDKDAASALLHDIDTDD 1877

Query: 1843 GSILYSPEATTPDTYTAVHAESPTPLATRGLMNTP-EDLPSPSKAPALEDQEEISDRARM 1901
             S++YSP+ T   +   +   SPTP   + L +TP ++L SP+   A +D E+++DRA+ 
Sbjct: 1878 DSLVYSPD-TKRQSVGHLIGGSPTP-GDKLLGSTPTKELSSPT---AGQDDEDVTDRAKA 1932

Query: 1902 LLKELRGSEIS-VKQNSTLDEHLEKLRARK---ERASSET-NTGNKLSF 1945
            LL ELRG + S +K+N+ LDE  E++R+R+   E A +E    GNKLSF
Sbjct: 1933 LLMELRGGQSSPMKKNAFLDEQRERIRSRRRRNELAGTEPLRGGNKLSF 1981

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/848 (60%), Positives = 627/848 (73%), Gaps = 35/848 (4%)

Query: 319  SENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGH 378
            +E N S+ST+  D+ NRPPIHYV++I+ DKL+ DEMKDLWVTLRTEQLDWVDAF+E+QGH
Sbjct: 308  AERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGH 367

Query: 379  IAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAE 438
            IAMAN+LM S+YKT P+D +++ LL+KEN+FFKCFRVL++LSQGL+EF+ H LMTDT+A+
Sbjct: 368  IAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQ 427

Query: 439  GLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFS 498
            GLFS +LAT+KMATEIFV +LEKKNK RFE+VL++LDK F IGQN HM +++KK+PQYF+
Sbjct: 428  GLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFT 487

Query: 499  HLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINH 558
            HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+D+KN GGENAILEYCQWTMVFINH
Sbjct: 488  HLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINH 547

Query: 559  LCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEAN 618
            LCS S+NINQR LLR KLENCG+LRIMNKIKLLDY+KVIDQI+LY+NNKLDDFN  LE+N
Sbjct: 548  LCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESN 607

Query: 619  NEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLK 678
             +  NVDLQDP+SL+KNL   CKGTENEK LVSLVQH+FL +SKL++E Q+ +K+TKQLK
Sbjct: 608  KKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLK 667

Query: 679  LMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERD 738
            LMDSLVTNVS+ S  +E SN+NMAIQRLYD+MQTDEVARRAILESR LTKKLEE++AERD
Sbjct: 668  LMDSLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERD 726

Query: 739  SLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVEL 798
             L EKLSKAEHGLVGQLE E+ ERD ILAKNQRVM                      VEL
Sbjct: 727  MLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVEL 786

Query: 799  RKMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGM 858
            RKMLTILNSRP ++    E  + I  S+  SEK ++Q+ LQ GL +AKKD+KDDSKKFGM
Sbjct: 787  RKMLTILNSRPAKTK---EQKKKIG-SIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGM 842

Query: 859  TLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFL 918
            T+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK+ L+PP  +                
Sbjct: 843  TIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELN----- 897

Query: 919  ARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYK 978
               +E  + KLN+LR  L  IQMESN++SKFNV+ERVNELFN+KK  AL+RLKELETKYK
Sbjct: 898  ---KEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYK 954

Query: 979  GFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXX 1038
            GFGIDF VE         S     EG   YSSLDPK YQ KLDEI +I            
Sbjct: 955  GFGIDFKVEDFTHE----STDSSNEG---YSSLDPKVYQDKLDEITKISEELLQQKNELE 1007

Query: 1039 XXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYG 1098
                                   E     +   +I   +S +S     GSFLD L+QKYG
Sbjct: 1008 TTQTSSSESNSDSESSSDSDDSMEDA--LTNNKDINGTSSNVS-DLASGSFLDTLTQKYG 1064

Query: 1099 TGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKV--NKVEP 1156
            TGQ              S +GH  ++ EK+F++R+KR++     Y+EEL++K+  NK   
Sbjct: 1065 TGQAEPIQ---------SPVGHYSNRNEKSFVDRMKRNS-RVPSYVEELSKKMRGNKDHE 1114

Query: 1157 CEQNEHVN 1164
             E+++H N
Sbjct: 1115 FEEDDHKN 1122

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/622 (66%), Positives = 490/622 (78%), Gaps = 3/622 (0%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            K  V+SPLLPQSPSLFE YPRP KKLKQLHWEK++STDNSIWGS KAEKFADDLYEKGVL
Sbjct: 1240 KKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVL 1299

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            ++LEKAFAAREIKSLAT++KEDLQKI+FLS DISQQFGINLHMYS+L+V   V+KVL C+
Sbjct: 1300 SELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCE 1359

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RDF+ TPSV+EFLSK EI+EVS NLARNYAPYSTDWEG++ ++DAK PEKDPN+LQRADQ
Sbjct: 1360 RDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQ 1419

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YLQLM+NL+SYW SRMRA+ ++TSYEREYNELLAKL +VDKAVG+LQGSDNL+N+FNVI
Sbjct: 1420 IYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVI 1479

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGNFMND++KQA+GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP FN+FL ELE
Sbjct: 1480 LAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELE 1539

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVL+VVKVSIEQLVNDC DF Q I NVERS+EIGNLSDSSKFHPLDKVL+K LP L EAR
Sbjct: 1540 PVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEAR 1599

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +KG+LL DE+KLTIMEFE +MQTYGED G                 EYKKAQAQN+  EE
Sbjct: 1600 KKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEE 1659

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805
            EE  YE+HKK+V                ++S +   +EE+E+EDRR VMDKLLEQLKNAG
Sbjct: 1660 EEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAG 1719

Query: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESP 1865
              KTDP+SARKRAL+RKK  S ++S    L ++     S++YSP+A        +H  SP
Sbjct: 1720 QVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDA-KEQIELEIHMASP 1778

Query: 1866 TPLATR-GLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLE 1924
            TP     G + T E+    S    + + EEI DRA+ LL ELRGS+  + +N+ LDEH E
Sbjct: 1779 TPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKE 1838

Query: 1925 KLRARKERA-SSETNTGNKLSF 1945
            +LRAR++R  S++  + N+L F
Sbjct: 1839 RLRARRKRTDSNKIPSSNRLKF 1860

 Score =  173 bits (438), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/169 (56%), Positives = 112/169 (66%), Gaps = 11/169 (6%)

Query: 74  SRTTSI-EARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--KYSYSKRNS 130
           SR  SI ++RPLNKKSTLN+QNLSQY++   +      S H R+ S QS  KYSYS+R+S
Sbjct: 66  SRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSS 125

Query: 131 SQASN--------KLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVE 182
            Q S          LTR +T               TNLS+F TPDGKI+L MPSDPYEVE
Sbjct: 126 GQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVE 185

Query: 183 ILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231
            LFEDIMYKRNI QSL  +KQ  LM YS EKKWLIVKQDLQNE K+++A
Sbjct: 186 SLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKA 234

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1071 (49%), Positives = 665/1071 (62%), Gaps = 108/1071 (10%)

Query: 117  HSVQSKYSYSKRNSSQASN--------------------KLTRQ-----HTXXXXXXXXX 151
             S  SKY+Y KR SS  +                     +L+RQ     H          
Sbjct: 101  QSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASV 160

Query: 152  XXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYST 211
                  TNL +F  PDGK+ L+MP D +EVE LFEDIMYKRNI Q+L  +KQ+ L  Y  
Sbjct: 161  LSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDI 220

Query: 212  EKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXXDHLPILTANSSLSSPKSI--LMTSA 269
            +KKWLIV+QDL ++LKKM A                 L    ++   S   SI  + T+A
Sbjct: 221  DKKWLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTISSHDYSDATSIRHMKTNA 280

Query: 270  SSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLKKQPSLN-NIYRGGSENNISASTL 328
            SS                                      SLN N+Y   + N+ S +T+
Sbjct: 281  SSK-------------------------------------SLNSNLYSNANANS-SNTTV 302

Query: 329  PGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNS 388
              ++ NRPP +YV++I+AD LT DE+ DLWVTLRTEQLDWVDAF+EHQGHIAMANVLM S
Sbjct: 303  NTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKS 362

Query: 389  MYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATK 448
            +YKT     LT++ LE+E S+FKCFRVL ML+QGLYEF+ H +M +TVA  LFS +L T+
Sbjct: 363  LYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTR 422

Query: 449  KMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKI 508
            KMATEIFVCMLEKKNKSRF+ +LTALDKKF IG+NLHM+Q  K  PQ F HL  +S  KI
Sbjct: 423  KMATEIFVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKI 482

Query: 509  IQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQ 568
            +QAWL  +E  L GRGKMGSLVGAS++ +  GGEN+ILEY QWTMVFINHLC  +D +NQ
Sbjct: 483  VQAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQ 542

Query: 569  RMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQD 628
            R+LLRT+LEN G LRIMN+ KLLDYDK+  QI+ Y+N KLDD N  LE+      V++QD
Sbjct: 543  RVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQD 602

Query: 629  PLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVS 688
            P+ +L+ +W  CKGTENEK  +SL++HLFLSSSK+ ++  + SKL KQLKLMDSLV NVS
Sbjct: 603  PMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVS 662

Query: 689  IASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAE 748
            + SA DEES++N+AIQRLYDAMQTDEVARRAILESR LTK+LEEIQAERD L +KL+   
Sbjct: 663  V-SAVDEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTG 721

Query: 749  HGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSR 808
             G+VG+LE+EL +RD ILAKNQRV                       VELRKMLTILN+R
Sbjct: 722  DGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNAR 781

Query: 809  PEE-----SSDINEGTRNIDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPN 863
            P++     S+ + +    +DP      + +IQK LQDGL R +KD   DSK+FG+T+QPN
Sbjct: 782  PDDENLAKSTKVTKSVNGLDP----DRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPN 837

Query: 864  KRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLARAQE 923
            KRL+MLRM+ME IE EAR+LEMTNFAE E+++LE P+                     ++
Sbjct: 838  KRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGT----------------GTKKK 881

Query: 924  ADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGID 983
            A + KL++LR+ L+DIQ E+N ++KFNVEERV ELFN+K+  ALKRLKELET YKGFGID
Sbjct: 882  AGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGID 941

Query: 984  FNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXX 1043
            FN   ++ES       D    D      D +  Q+K+DE++RI                 
Sbjct: 942  FNANALLESKG----GDIHWNDDEIDGQDLQGAQEKMDEMDRI-----ANELTAMKMKVE 992

Query: 1044 XXNGKXXXXXXXXXXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNV 1103
              N +             +         +  SE S+ S GSG GSFL+ALSQKYG GQN 
Sbjct: 993  IQNQQQHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNT 1052

Query: 1104 TASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKV 1154
            T S     +    G+    S    +F NR+K+S  N+ PY +ELT+KV K 
Sbjct: 1053 TIS-----NSPFPGVDRKSSNHRTSFANRMKKS--NATPYFDELTRKVAKA 1096

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/634 (63%), Positives = 486/634 (76%), Gaps = 30/634 (4%)

Query: 1331 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEK 1390
            S  L ++P+  + YP+PHKKLKQLHWEKLD+T++SIW SG AEKFA DLYEKGVLA LEK
Sbjct: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305

Query: 1391 AFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQ 1450
            AFAAREIK+LATK+KEDL+KITFLS D SQQFGINLHMYS +SV DLV K+L CDRDF+Q
Sbjct: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365

Query: 1451 TPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQL 1510
            TPSV+EFLSK+EI EVSVNLARN++PYSTDW+G+++L+DAKPPEKDPNDLQRADQ+YLQL
Sbjct: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425

Query: 1511 MINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGN 1570
            + NL++YWGSRMRA+ V+TSY++EY EL+ KLRKVDKAVGA+  S+NL N+FNVILAVGN
Sbjct: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485

Query: 1571 FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDV 1630
            FMNDT+K+AQGFKLSTLQRLTFIKDT NSMTFLNYVEKIIR NYP+FNDFLKELEPVL+V
Sbjct: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545

Query: 1631 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDL 1690
             K+SI+QLVNDC ++ Q++ NVERS+EIGNLSDSSKFHPLD+VLIK LPVLPEAR+K DL
Sbjct: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605

Query: 1691 LKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLY 1750
            L DEV+L+IMEFE+LMQ YGED+G                 EYKKAQ QNL  EEEER+Y
Sbjct: 1606 LDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVY 1665

Query: 1751 EKHKKLVXXXXXXXXXXXXXXXRSASPSPEGN---------EEDEAEDRRDVMDKLLEQL 1801
            E+HKK+V               R  +PS   +          +D+ +DRR +MDKLL+QL
Sbjct: 1666 ERHKKMV----------EEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQL 1715

Query: 1802 KNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVH 1861
            KNAGP  +DPSSARKRAL+R+K  +DKD+A  L++DLD+ E SI+YSP A+   +  A  
Sbjct: 1716 KNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEE 1775

Query: 1862 AESPTPLATRGLMNTP--EDLPSPSKAPALEDQ------EEISDRARMLLKELRGSEISV 1913
            A SPT        N P   DL SP KA    D+      EEISD+A+ LL EL G+    
Sbjct: 1776 A-SPTVHKGSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAPT 1834

Query: 1914 KQNSTLDEHLEKLRARKE--RASSETNTGNKLSF 1945
            ++   L+ H E+LRAR+   +   E  + NKL+F
Sbjct: 1835 RREELLNGHKERLRARRRRTQGHGELISSNKLAF 1868

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/836 (59%), Positives = 601/836 (71%), Gaps = 33/836 (3%)

Query: 331  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMY 390
            D+TNR PI YV++I++D LT++EMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLM S+Y
Sbjct: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391

Query: 391  KTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKM 450
            KT P + LT +LLEKENSFFKCFRVLSMLSQGL EF+ H LM  T+A GLFST L+T+KM
Sbjct: 392  KTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKM 451

Query: 451  ATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQ 510
            ATEIFVCML KKN  RF+ +L  LD+KF+IGQNLHM  N KK  +YF  LTL+S+LK+ +
Sbjct: 452  ATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTR 511

Query: 511  AWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRM 570
            AWLFAVE +LDGRGKMGS VGASDD+KN GGENA LEYCQW+M+FINHLC CSDNINQRM
Sbjct: 512  AWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRM 571

Query: 571  LLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPL 630
            LLR KLE CG++RIMN+IK L Y+KVI+QID+Y+N+KLDD N  LE +N+  N++L DP 
Sbjct: 572  LLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPT 631

Query: 631  SLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIA 690
            SL+KNLW  CKGTENEKLL+SLVQHLFLSSS+LIE+ Q++++L+KQLKLMDSLVTNVS+A
Sbjct: 632  SLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVA 691

Query: 691  SAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHG 750
            S  D+ES +NMAIQRLYDAMQTDEVARR+ILESR LTKKLEE QAE D LS+KL  AEHG
Sbjct: 692  S-TDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750

Query: 751  LVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPE 810
            LVGQL+DEL +RD + AKNQR+                       VELRKMLTILN+R +
Sbjct: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARSD 810

Query: 811  ESSDINEGTRN---IDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLK 867
            +     + ++    I  S   S+K NIQKVLQ+GL+R KKD+  DSK FGMT+QPNKRLK
Sbjct: 811  KGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLK 870

Query: 868  MLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIXXXXXXXXXXXXXNFLARAQEADMN 927
             LRMQME+IENEAR+LEMTNFAEFEK++LEP                     + ++  + 
Sbjct: 871  ALRMQMEDIENEARELEMTNFAEFEKKKLEP----APKIKKLKQKKQNKNEKKEEDDKIK 926

Query: 928  KLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVE 987
            KLN+LR+ LA+IQ ESN+ISKFNVEERVNELFNEK+S AL+RLKELETKYK FGI+FN++
Sbjct: 927  KLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID 986

Query: 988  KIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNG 1047
             I E  K   + +  +    YSSLDP AYQ KLDE+NRI                   + 
Sbjct: 987  DISE--KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLNEKNLKDSSN 1044

Query: 1048 KXX------XXXXXXXXXXXEVYQDASPTHEIRSEN--SELSA---GSGPGSFLDALSQK 1096
            K                       D     +I+S +  SE+SA    S  GSFL+ALSQK
Sbjct: 1045 KSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQK 1104

Query: 1097 YGTGQNVTASAGLRDSGYVSGLGHTPSKVEK-TFMNRLKRSTVNSAPYLEELTQKV 1151
            Y  GQN   S+  RD          P K  +  F+NR++++ + +  +LEEL+ KV
Sbjct: 1105 YAMGQN-NPSSPQRDR---------PVKASQYDFINRVRKNNI-TPQFLEELSGKV 1149

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/632 (63%), Positives = 490/632 (77%), Gaps = 24/632 (3%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            K  ++SPLLPQSPSLFE YPRPHKKLKQLHWEK+++TDNSIW + KAE+FADDLYEKGVL
Sbjct: 1331 KKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVL 1390

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            ++LE AFAAREIKSLA+K+K+DLQKITFLS D+SQQFGINLHMY+SL VPDL+ K+L CD
Sbjct: 1391 SELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCD 1450

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RDFLQTPSV+EFLS+ EI++VSVNLARNYAPY  DWEG++N++DAKPPEK+PN+LQRADQ
Sbjct: 1451 RDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQ 1510

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YLQLM+NL+SYWGSRMRAL V+T++E+EYNELL KLRKVD+AV +LQ S+NL+NVF VI
Sbjct: 1511 IYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVI 1570

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+TN+MTFLNYVEKI+R NYP FN FL ELE
Sbjct: 1571 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELE 1630

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERS+EIGNLSDSSKFHP D+VL K LP LP+AR
Sbjct: 1631 PVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDAR 1690

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +KG+LL DEVKLTIMEF  LMQ YGEDSG                 EYKKAQ QNL  EE
Sbjct: 1691 KKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEE 1750

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805
            EE++YE+HKK+V                S +   + ++ED   D R +MD LLEQLKN  
Sbjct: 1751 EEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTK-DDEDGPGDGRAIMDTLLEQLKNVT 1809

Query: 1806 PA-KTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAES 1864
            P  KTDPSSARKRALVRKK +   +S   +L D+D E+ SI+YSP+A  P   T   A +
Sbjct: 1810 PTNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANT 1867

Query: 1865 PTPLATRGLMNTPEDLPSPSK---AP--------ALEDQEEISDRARMLLKELRGSEISV 1913
                     + +  D+ SP++   +P          E++EEI +RA+ LL +L GS    
Sbjct: 1868 --------TLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPT 1919

Query: 1914 KQNSTLDEHLEKLRARKERASSETNTGNKLSF 1945
            K++S L+EH E+LRAR+ R ++E  +G KL F
Sbjct: 1920 KRHSLLNEHKERLRARRRRTTNEFVSG-KLQF 1950

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 99/157 (63%), Gaps = 3/157 (1%)

Query: 77  TSIEARPLNKKSTLNTQNLSQYMSGKMSAD--VPISSQHARSHSVQSKYSYSKRNSSQAS 134
           +S E +PL K +TLNTQNLSQY++ K   D     S Q +  +S  S+ + S+ N S   
Sbjct: 74  SSNEIKPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTNPSVTG 133

Query: 135 NKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNI 194
            KL RQ+T               +NLSKF T DGK++LEMP+DP E+E L+++IM KRNI
Sbjct: 134 YKLDRQYTNQSSAVSVLSQGSY-SNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNI 192

Query: 195 FQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231
            QSL G KQ+ LM Y   KKWLIVKQDLQNE KK ++
Sbjct: 193 LQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS 229

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1117 (44%), Positives = 682/1117 (61%), Gaps = 112/1117 (10%)

Query: 82   RPLNKKSTLNTQNLSQYMSGKMSADVPISSQ-----------------------HARSHS 118
            +PLNK+++LN QNLSQY++GK+      SS                        H RS S
Sbjct: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128

Query: 119  VQSK---YSYSKRNSSQASNKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMP 175
            VQS        + ++S A+ +L+RQ T                NLSK+   +G+++L+MP
Sbjct: 129  VQSSAKYSYSRRSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188

Query: 176  SDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXX 235
            +D +E+E LFE++MYKRNI Q+LS DKQ  +M Y T+KKW+IVKQDLQNELK+++     
Sbjct: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNN 248

Query: 236  XXXXXXXXXXXDHLPILTANSSLSSPKSI---------LMTSASSPTSTVYXXXXXXXXX 286
                         +P    +S++S   S+         + T+AS+P              
Sbjct: 249  INNSDTTI-----IPSSMPSSNISERSSVNTMDNNLRTIDTNASNP--------RIHRKG 295

Query: 287  XXXXXXXXXXXXXIVTGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILA 346
                           +G   +   + +I     + NI+            PIHYV++IL+
Sbjct: 296  QKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIA------------PIHYVRKILS 343

Query: 347  DKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKE 406
            D L+ +E+ DLWVTLRTEQLDWVDAF+EHQGHIA+AN L+  +YKTAP  NL+ EL+EKE
Sbjct: 344  DTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKE 403

Query: 407  NSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSR 466
              FFKCFRVL+ML QGLYEF+ H+LM DT+A GLFST+++T+KMA EI V ++ KKN  R
Sbjct: 404  YGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQR 463

Query: 467  FEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKM 526
            FE+V+ +LD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKM
Sbjct: 464  FESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKM 523

Query: 527  GSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMN 586
            GS VGASDDFK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M 
Sbjct: 524  GSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMT 583

Query: 587  KIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENE 646
            K+KL+DY+K+  Q++ Y+++KLDDFN  LE  + +  +++QDP SL+ +LW +CKGTENE
Sbjct: 584  KLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENE 643

Query: 647  KLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRL 706
            KLL+SL+QHLFLSSSKL+++ +  +KL+KQLKLMDSL+TN++ AS  DE++++N+AIQRL
Sbjct: 644  KLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRL 702

Query: 707  YDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHIL 766
            YD+MQTD+VARRAILE+R L+KKLEE+ AE++ L EKLSKAE+GLVGQLE EL +RD+IL
Sbjct: 703  YDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQLELELEQRDNIL 762

Query: 767  AKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDINEGTRNIDPSL 826
             K+QRV                       VELRK+LTI+N+  +  + +N  +       
Sbjct: 763  TKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNTDADASLNNSS------- 815

Query: 827  NFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMT 886
               +K NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEMT
Sbjct: 816  --DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMT 873

Query: 887  NFAEFEKERLEPPIQI----------XXXXXXXXXXXXXNFLARAQEADMNKLNDLRRAL 936
            NF+E +K  LE P  +                       N   RA      KL +LRR L
Sbjct: 874  NFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAIKKQKLLELRRDL 933

Query: 937  ADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKL 996
            A IQ E+N++SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+       P   
Sbjct: 934  AMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFD-------PNDF 986

Query: 997  SVADEREGDARYSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXX 1056
              A + + +A Y SLDP    KK+ +I+RI                              
Sbjct: 987  KQA-QLDSNASYESLDPNFVTKKITDIDRIADELDAFSGDGTSSYSSSSLSDSEKN---- 1041

Query: 1057 XXXXXEVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNV--TASAGLRDSGY 1114
                   Y +++    I  +   L  GS   SFL++LS+KYGT QN   T+ + L     
Sbjct: 1042 -------YYESNAVPTIGPQKG-LIDGS---SFLESLSEKYGTAQNTEGTSLSPLSPQNR 1090

Query: 1115 VSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKV 1151
            ++ LG      EK+FMNR KR   +S  +LEEL+QKV
Sbjct: 1091 IASLG------EKSFMNRFKRKP-SSMQFLEELSQKV 1120

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/631 (60%), Positives = 458/631 (72%), Gaps = 34/631 (5%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            +S   S +L +SPSL+ KYPRP KKLKQLHW+KLD ++ SIW S  AE+FADDLYEKGVL
Sbjct: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
             +LEKAFAAREIKSLA K+KEDL KI+FLSRDISQQFGINLHM+ SL+V +LV K+L C+
Sbjct: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            RD + TPSV+EFLSK EI +VS+NLARNYAPY TDWEGV++++DAK PEK  + LQRADQ
Sbjct: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +Y+QLM+NL+SYW SRMRA+ V+TSYE+EY EL+ KLR++D AV A+Q SDNL N+FNVI
Sbjct: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDKV+ K LPVLPEA 
Sbjct: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +K DLL DEVKLT MEFE+LMQ +GEDSG                NEYKKA+AQNL  EE
Sbjct: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805
            E R YE+HK++V                +     E  E     D R  MDKLL QLKNAG
Sbjct: 1665 EVRKYERHKQMVEEQQRKAKEQEKNYMETGVSDSESAE--AKGDNRGHMDKLLAQLKNAG 1722

Query: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAE-- 1863
            PA++DPSSARKRA++RKK LS+KDS   +L+DL+  +GSI+YSP  TT         E  
Sbjct: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSP--TTDKVVDTSLGEDE 1780

Query: 1864 ----SPTPLATRGL------------------------MNTPEDLPSPSKAPALEDQEEI 1895
                SPTP +   L                         N   D+     +    + E I
Sbjct: 1781 MILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVI 1840

Query: 1896 SDRARMLLKELRGSEISVKQNSTLDEHLEKL 1926
            +DRA+ LL ELRGS+   K+NS LD+  EKL
Sbjct: 1841 TDRAKALLMELRGSQTPSKKNSHLDDQREKL 1871

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/629 (62%), Positives = 474/629 (75%), Gaps = 15/629 (2%)

Query: 1330 TSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLE 1389
            ++P    SP+ FEKYPR  KKLKQLHWEKLD TDNSIW +GKAE+FADDL+EKGVL  LE
Sbjct: 1425 SAPDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLE 1484

Query: 1390 KAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFL 1449
             AFAAREIKSLA+K+KED  KIT+LSRDISQQFGINLHM+S+L+V  L++K++ CDR  L
Sbjct: 1485 SAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSIL 1544

Query: 1450 QTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQ 1509
             TPSV++FLSK EI+EVSVNLAR+YAPYSTDWEGV+++ DAKPPEKDPN+LQRADQ+YLQ
Sbjct: 1545 NTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQ 1604

Query: 1510 LMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVG 1569
            LM+NL+SYWGSRM AL VVTSYE++++EL+ KLR+VD AVG++Q S+NL+NVFNVILAVG
Sbjct: 1605 LMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVG 1664

Query: 1570 NFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLD 1629
            NFMND SKQAQGFKL+TLQRLTFIKD+TN+MTFLNYVE IIR NYP FNDFL EL+PVLD
Sbjct: 1665 NFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLD 1724

Query: 1630 VVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGD 1689
            VVKVSIEQLV DCK+FSQ I+NV RSVEIG LSDSSKFHP DKVLIK LPVLPEA +K D
Sbjct: 1725 VVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKAD 1784

Query: 1690 LLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERL 1749
            LL DEVKL+IMEFE+LMQ +GEDS                 NEYK+AQ QNL  EEEER+
Sbjct: 1785 LLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERI 1844

Query: 1750 YEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKT 1809
            YE HKK +                  + + +G EE+E EDRRDVMDKLLEQLKN GP KT
Sbjct: 1845 YENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKT 1904

Query: 1810 DPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEAT--TPDTYTAVHAESPTP 1867
            DP+SARKRA+VRKK  ++K++A Q+L + +  E SI+YSP  +  TP   +  + +SPTP
Sbjct: 1905 DPTSARKRAMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSKITPKKVSNEYLQSPTP 1964

Query: 1868 LATRGLMNTPEDLPSPSKAPALEDQ-----------EEISDRARMLLKELRGSEISVKQN 1916
                 L +        +     + +           +EI DRA+ LL ELRGS+   ++N
Sbjct: 1965 GEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTRKN 2024

Query: 1917 STLDEHLEKLRARKERASSETNTGNKLSF 1945
            S L+E  EKLRAR+   S    T NKL F
Sbjct: 2025 SVLEERKEKLRARRRNTSDL--TSNKLKF 2051

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/875 (50%), Positives = 567/875 (64%), Gaps = 67/875 (7%)

Query: 321  NNIS--ASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGH 378
            NNI+  AS L  DRTNR P  Y++ IL D+L+ DEM DLWVTLRTEQL WV+ F+E QGH
Sbjct: 404  NNINNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGH 463

Query: 379  IAMANVLMNSMYKTAPRDN-LTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVA 437
            IAMAN LM S+Y+     N L+  L++KE +FFKCFRVLSMLSQGL EF  H+LMTDT+ 
Sbjct: 464  IAMANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLV 523

Query: 438  EGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYF 497
            +GLFST+LAT+K+ATEIFV ML+K N      +LT  DK F I +NL+M+   K +P  +
Sbjct: 524  QGLFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKY 583

Query: 498  SHL--TLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVF 555
             +L  T  + +K++ +WL+AVE TLDGRGKMGSLVGAS DFK  GGENAILEYCQWTMV 
Sbjct: 584  HYLNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVL 643

Query: 556  INHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKL 615
            IN LC+ S  INQR+LLRTKLEN G +RIMNK+K LDY+K+ +Q++ Y+N KLDD N  L
Sbjct: 644  INRLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLL 703

Query: 616  EANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTK 675
            E + ++ +VDL +P+SLL +L  +CK TE E+ L S++QHL+LSSSKL ++  + +KL+K
Sbjct: 704  EQDTKS-SVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSK 762

Query: 676  QLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQA 735
            QLKLMDSL+T+ ++ S  D ES +NMAIQ LYD+M TD+VARRAILESR LTKKLEE+QA
Sbjct: 763  QLKLMDSLMTDATL-STVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQA 821

Query: 736  ERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXX 795
            ERD LS +LS+AE+GLVG+LE+EL +RD ILAKNQRV                       
Sbjct: 822  ERDFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHE 881

Query: 796  VELRKMLTILNSRPEES-----SDINEGTRN---IDPSLNFSEKANIQKVLQDGLSRAKK 847
            VELRKMLTILNSRPE       S I+   RN   I+       K  I+K LQDGL + KK
Sbjct: 882  VELRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKK 941

Query: 848  DYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAE-------FEKER----- 895
            D   DSK+FG+T+QPNKRL+ LR+QME+IENEARQLEMTNF +        +++R     
Sbjct: 942  DLSLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNK 1001

Query: 896  ---LEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVE 952
               L+P I I               +A+ Q+    KL +LR+ALADIQ E+N+IS+FNVE
Sbjct: 1002 HPSLKPGIPIAKKNKDRSEE-----MAKKQQ----KLAELRKALADIQQETNDISRFNVE 1052

Query: 953  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDA-RYSSL 1011
            E VNELFN KK  A++RLKELET Y+ FG+DFN+E+ +E  K  +   E + D+  Y +L
Sbjct: 1053 EHVNELFNAKKIQAMERLKELETMYQNFGVDFNMEEFLE--KNNTSTKELDPDSPAYETL 1110

Query: 1012 DPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTH 1071
            DP  +  K+DE+++                    N                   D     
Sbjct: 1111 DPNLFIDKMDELDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDE 1170

Query: 1072 EIRSENSEL--------------SAGSGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSG 1117
            E  +EN+ L              S  SG  SFL++LSQKYGTGQN   ++G   S   + 
Sbjct: 1171 E--NENTALSNNVNDNSSTFSHQSTTSGGSSFLESLSQKYGTGQN---ASGPMSSNTPNV 1225

Query: 1118 LGHTPSKVEKTFMNRLKRSTVNSAP-YLEELTQKV 1151
              + P   E+ FM+R+K+   ++ P Y+ EL QKV
Sbjct: 1226 SHYNP---ERKFMSRMKKQ--HATPNYIRELNQKV 1255

 Score =  122 bits (307), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 102/174 (58%), Gaps = 27/174 (15%)

Query: 83  PLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--------KYSYSKRNSSQ-- 132
           PLN +++L   N++QY++   + +   ++ H+R+ S+ S        KYSYS+R S+Q  
Sbjct: 95  PLNMRNSLTNPNMNQYVTSPYTHEY--NNSHSRNTSINSVNSNPLSTKYSYSRRGSNQIL 152

Query: 133 -------------ASNKLTRQHTXXXXXXXXXXXXXXXT--NLSKFTTPDGKIHLEMPSD 177
                        ++    ++++               +  NL KF TPDGK++LEMP++
Sbjct: 153 SPSPTGNSSNNNTSNINPQQRYSVHSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEMPNN 212

Query: 178 PYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231
           P EVE L+EDIMYKRNI Q+L  DKQ  LM Y   KKWLIVKQDLQ+ELKKMR+
Sbjct: 213 PAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRS 266

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/641 (61%), Positives = 481/641 (75%), Gaps = 35/641 (5%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            ++A  SPLLPQSPSLFE+YPRP KKLKQLHWEK++ T NSIW   KAEK+ADDLYE+GVL
Sbjct: 1292 RAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVL 1351

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            A LEKAFAAREIK LA +RKEDL K+TFLSRD+SQQFGINLHMY++LSV ++V K+L CD
Sbjct: 1352 AQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCD 1411

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            +DFL + SV++FL K EI+EVS NLARN+APYST+WEGV ++D+AK PEKDP +LQRADQ
Sbjct: 1412 KDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQ 1471

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YL++M+NL+ YW SRMRAL V+T+YE+EY++LL KLR +DKAV ++Q SDNLR+VF VI
Sbjct: 1472 LYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVI 1531

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MND+SKQA GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELE
Sbjct: 1532 LAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELE 1591

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PVLDVVK+S+EQL  DC++FSQ+IVNVERS+E+GNLSDSSKFHP D+VL+K LPVLPEAR
Sbjct: 1592 PVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEAR 1651

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            ++ DLL DEVKLT+MEF+ LMQ +GED+                  EYKKAQA N+  EE
Sbjct: 1652 KRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEE 1711

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAE---------DRRDVMDK 1796
            EER YE+ KK+V               R+   + +G  +D +E           RDVMDK
Sbjct: 1712 EERAYERRKKMV----------EEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDK 1761

Query: 1797 LLEQLKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEG-----SILYSPEA 1851
            LLE+LKNAGP K+DPSSARKRAL RKK L  K S+  +L++ + +E      S++YSPE 
Sbjct: 1762 LLEKLKNAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPE- 1820

Query: 1852 TTPDTYTAVHAESPTPLATR-------GLMNTPEDLPSPSKAPALEDQEEISDRARMLLK 1904
            TT     A HAESPTP A+R       G   TP  L SPSK  A    E+++DRAR LLK
Sbjct: 1821 TTLKAANAAHAESPTPKASRQGSVAGSGATATPL-LESPSKQ-ASAGPEDVADRARNLLK 1878

Query: 1905 ELRGSEISVKQNSTLDEHLEKLRARKERASSETNTGNKLSF 1945
            ELRG E S K+   L++H EK+RAR+ R +   ++ NKL F
Sbjct: 1879 ELRGPE-SEKRKPLLEDHREKMRARRRRVNEGASSENKLVF 1918

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/894 (43%), Positives = 549/894 (61%), Gaps = 70/894 (7%)

Query: 312  NNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDA 371
               Y  G++N+ S +TL  D  +  P +YV++I++DK++T ++KDLWV+LRTEQLDWV  
Sbjct: 277  GGFYESGNQNS-STATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVG 335

Query: 372  FIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRL 431
            F++ QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G  E    +L
Sbjct: 336  FLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKL 395

Query: 432  MTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFK 491
            +   + +GL S +++T+++A+E+ V + +         V+  LD++  +  N+H+     
Sbjct: 396  VVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLL 455

Query: 492  KMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGEN 543
               +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS+DFK+ GGEN
Sbjct: 456  SANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGEN 515

Query: 544  AILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLY 603
            AILEY   T++ +N LC+   ++NQR LLR++ ++CG+ RIM K++LL+YDK+ +Q+ ++
Sbjct: 516  AILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIF 575

Query: 604  DNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKL 663
            ++   DD+N  + + +   NVD+++PLSLL+NLW   KGT  EK LVSLVQHLF++SSK+
Sbjct: 576  EDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKV 635

Query: 664  IEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILES 723
             +E  + ++ +KQLKL+DSLV+NV++ S+ D ES+ N AIQRLYD+MQTDEVARRAI+E+
Sbjct: 636  QDEGDDPTEASKQLKLIDSLVSNVTM-SSIDTESSFNGAIQRLYDSMQTDEVARRAIMEA 694

Query: 724  RALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXX 783
            R LT+K EE++AERD L EKLSKAE GLVGQL++EL +RD IL KNQRV           
Sbjct: 695  RELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEEL 754

Query: 784  XXXXXXXXXXXXVELRKMLTILNSRPEESSDINE---GTRNIDPS--LNFSEKANIQKVL 838
                        VELRK+LTILNSRP+ SS + E   GT +      L+   K  IQK L
Sbjct: 755  KKKHLLEKHEHEVELRKLLTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKAL 814

Query: 839  QDGLSRAKKDYKDDSKK----FGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKE 894
            QD L + KKD   +SK+     G TL+PN+RLK+LR +ME+IENEAR+LEMTNFA+ +++
Sbjct: 815  QDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQ 874

Query: 895  RLEPPIQIXXXXXXXXXXXXXNFLARAQ--EADMNKLNDLRRALADIQMESNNISKFNVE 952
             +E    +                A+ Q  E  + KL +LR+ LA +Q ESN++SKFNVE
Sbjct: 875  TVEEQTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVE 934

Query: 953  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEK-----IMESPKKLSVADEREGDAR 1007
            ER+NELFN+KK  AL RLKELETKYKGFGIDF  +      + ++P +   A  ++G A 
Sbjct: 935  ERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHA--KDGQA- 991

Query: 1008 YSSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDA 1067
            + SLDPK   +K++E+++I                   NG              E+ QD 
Sbjct: 992  HPSLDPKHLSRKIEEMSKI-------VDELTAFKKEIENGP---PSSSSSSSDEELEQDD 1041

Query: 1068 SPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNVTASAGL-----RDSGYVSGLGHTP 1122
              +  I S N+        GSFL+ LSQKYGTGQN   +A       R+S Y  G G+  
Sbjct: 1042 RAS--IHSGNAST------GSFLETLSQKYGTGQNAGPTASSRAMVGRESNY-PGRGYH- 1091

Query: 1123 SKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCE-----------QNEHVNI 1165
                ++FM R+K+S  ++AP+L ELTQKV    P +           + EH+ I
Sbjct: 1092 ---RRSFMERVKKS--DAAPFLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGI 1140

 Score =  123 bits (309), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 18/160 (11%)

Query: 81  ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS----KYSYSKRNSSQASN- 135
            +PL+K++TLNTQNLS Y+      + P    H RS S  S    KYSYS+R+S  ++  
Sbjct: 68  GKPLSKQTTLNTQNLSSYVD----MNTP---HHNRSPSGMSGSPTKYSYSRRSSQWSNGN 120

Query: 136 ------KLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIM 189
                 +L+RQ T               TNL+KF   DGK+ L+ PS+P E+E LF ++M
Sbjct: 121 NIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELM 180

Query: 190 YKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKM 229
           +KRN FQSL    Q+ LM Y  +KKWL+VKQDLQ+ELKK+
Sbjct: 181 HKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL 220

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/626 (58%), Positives = 464/626 (74%), Gaps = 20/626 (3%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            ++   SP+LPQSPSLFE+YPRP KKLKQLHWEK+D  ++SIW + KAE+FADDLYEKG+L
Sbjct: 1300 RTTTPSPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGIL 1359

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            + LEKAFAAREIKSL +++K+D  K+TFLSRD+SQQFGINLHMYSSLSV ++V K+L CD
Sbjct: 1360 SRLEKAFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCD 1419

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            +DFL TPSV+EFLSK EI+EVS NLARN+APY+TDWEG+ N+ DAKPPEKDP++LQRAD+
Sbjct: 1420 KDFLTTPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADR 1479

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +YL+L +NL+ YW SRMRAL V+TSYE+EY++L+ KLR +DKA  A+Q S+NLRNV +VI
Sbjct: 1480 LYLELFVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVI 1539

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YP FN FLKELE
Sbjct: 1540 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELE 1599

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            PV+  VK+SIEQ+  DCK+FSQS++NVERSV+IGNLSDSSKFHPLD+ L+K LPVLPEAR
Sbjct: 1600 PVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEAR 1659

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +KGDLL DE+KLT++EF++LM+ +GED+                  EYKKAQ  N+  EE
Sbjct: 1660 KKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEE 1719

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDE--AEDRRDVMDKLLEQLKN 1803
            EE+ YE+ KK+V                    S +GN +D   A   RDVMD+LLE+LKN
Sbjct: 1720 EEKAYERRKKMVEEQQRRARESNEQEN-----SVDGNADDNTAASGDRDVMDRLLEKLKN 1774

Query: 1804 AGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNE--EG-SILYSPEATTPDTYTAV 1860
            AGP K+DPSSARKRA+ R+K L    S   +L++ + E  EG S++YSPE  T  + +  
Sbjct: 1775 AGPGKSDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPEQVTL-SNSVD 1833

Query: 1861 HAESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLD 1920
            H+ +P      G     E   S S         +++DRAR LL ELRG E   ++ S+ D
Sbjct: 1834 HSPTPDVRKREGQSTASEVQTSESS--------DLTDRARNLLIELRGPESPSRRASSKD 1885

Query: 1921 EHLEKLRA-RKERASSETNTGNKLSF 1945
            + + KLRA RK   S  + + N L+F
Sbjct: 1886 QRISKLRARRKNDGSGNSGSDNHLNF 1911

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1108 (37%), Positives = 616/1108 (55%), Gaps = 119/1108 (10%)

Query: 76   TTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQ-----SKYSYSKRNS 130
            T     +PL+K+STLN  NLS Y          ++S H RS S       +KYSYS+R S
Sbjct: 65   TGEFSHKPLSKQSTLNIANLSAYTD--------VASTHNRSSSAASNSSPTKYSYSRRAS 116

Query: 131  SQASN-------KLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEI 183
              +SN       KL+RQ T               +NLSKF  PDG I LE P DP E+E 
Sbjct: 117  QWSSNGGTAPSTKLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEE 176

Query: 184  LFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXX 243
            LFE+++YKRN++QSL    Q+ L  Y  EKKWL+V+QDLQ+E+KK   N           
Sbjct: 177  LFEEVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNNKS--------- 227

Query: 244  XXXDHLPILTANSSLSSPKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTG 303
                      + S  ++   I + +  SP++  +                        + 
Sbjct: 228  ---------VSKSPAAASTGISLIAPESPSTGHFASNSSINESLAGS-----------SR 267

Query: 304  SLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRT 363
            S  + P  ++ + G +    S +TL  D ++  P +YV++I+ + ++   + DLWV+LRT
Sbjct: 268  SRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSLRT 327

Query: 364  EQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGL 423
            EQLDWV  F+E QG +A+ANV++ + Y+ +P + L  E+L+KE ++FKC +    L +G 
Sbjct: 328  EQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEGA 387

Query: 424  YEF---STHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRI 480
             E    ++ +++   + EGL S ++AT+++A+E+ V + +      F  V+ ALD++ R 
Sbjct: 388  DEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWALPHGFTHVMNALDQESRF 447

Query: 481  GQNLHM-------IQNFKKMPQYFSHLTLESH----LKIIQAWLFAVEQTLDGRGKMGSL 529
              N+H+         N +      S L  +++    ++  + W+  VE TLDGRGKMGSL
Sbjct: 448  CDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGKMGSL 507

Query: 530  VGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIK 589
            VGAS+DF+  GGENAI+EY   T++ +NHLC    ++ QR +LR +L+N G+ RI+NK+K
Sbjct: 508  VGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRILNKMK 567

Query: 590  LLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLL 649
             L+Y+KV +Q+ +++++  DDF+           +++QDP+S+ +NLW +CKGTE E+ L
Sbjct: 568  RLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQNLWDLCKGTEAEEHL 627

Query: 650  VSLVQHLFLSSSKL-IEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYD 708
            +SL+Q+L +S+ +L     ++ ++ TKQLKL+D+LV+NVS+AS  D +S+ N AIQRLYD
Sbjct: 628  MSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVSMAS-VDLQSSFNSAIQRLYD 686

Query: 709  AMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAK 768
            AMQTDE+ARRAILE+R   K+ EEI+AER++L EKLS AE GLVGQL++EL +RDHIL K
Sbjct: 687  AMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDHILEK 746

Query: 769  NQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDINEGTRNIDPS-LN 827
            +QRV                       VELRK LT LNS+     DI        P  L 
Sbjct: 747  SQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSK---GGDIQLTEDGGQPKPLK 803

Query: 828  FSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTN 887
                  IQ+ LQ  L +  K+   +S + G++L+PNKRL++LR +ME IEN+AR+LEMTN
Sbjct: 804  PERMLAIQRALQIKLEKTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQARELEMTN 863

Query: 888  FAEFEKERLEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNIS 947
            F+E+ +E  +  I++               +   Q++++ KL  LRR LA +Q ESN+IS
Sbjct: 864  FSEY-REDADKEIEMAHEGTHMYPSDVD--VGTTQDSNL-KLEQLRRKLASLQNESNDIS 919

Query: 948  KFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDAR 1007
            KFNVE R +E+F+++K  AL RLK+LE  Y GFGI+++     ESP   S+  E+  D  
Sbjct: 920  KFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGINYDP---AESP---SLKQEQGQDVN 973

Query: 1008 YS-SLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQD 1066
             S +LDPK     +DE                       N               +V+  
Sbjct: 974  KSRTLDPKGPNNSVDE---------------SQLETDRANASIDSSPASESLEEEDVHLT 1018

Query: 1067 ASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQ----NVTASAGLRDSGYVSGLGHTP 1122
             S T EI             GSFL+ LSQKYG GQ    N  +  G R++ Y     H  
Sbjct: 1019 KSTTEEI------------GGSFLERLSQKYGKGQANLSNRNSVVG-RENSYPGSGYH-- 1063

Query: 1123 SKVEKTFMNRLKRSTVNSAPYLEELTQK 1150
                K+FMNR+K+S  ++ PYLEEL+ K
Sbjct: 1064 ---RKSFMNRVKKS--DNVPYLEELSGK 1086

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/628 (58%), Positives = 467/628 (74%), Gaps = 14/628 (2%)

Query: 1323 SQMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEK 1382
            S+ KSA  SP+LPQSPSLF++YPRP KKLKQLHWEK+D  ++SIW   KAEKFADDLYEK
Sbjct: 1314 SRNKSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEK 1373

Query: 1383 GVLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVL 1442
            GVL+ LEKAFAAREIKSLA+++K+D  K++FLSRD+SQQFGINLHMYSSLSV ++V K+L
Sbjct: 1374 GVLSRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKIL 1433

Query: 1443 NCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQR 1502
             CDRDFL TPSV++FLSK EI+EVS NLARN+APY+ DWEGV ++++AKPPEKDP +LQR
Sbjct: 1434 RCDRDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQR 1493

Query: 1503 ADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVF 1562
            AD++YL+L +NL++YW SRMRAL V+T+YE++Y++L+ KL  +DKA  ++Q S+NLRNV 
Sbjct: 1494 ADRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVL 1553

Query: 1563 NVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLK 1622
            +VILAVGNFMND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIIR  YP FNDFLK
Sbjct: 1554 DVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLK 1613

Query: 1623 ELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLP 1682
            ELEPV+  VK+SIEQ+  DC++FSQS++NVERSV+IGNLSD +KFHP D+VL+K LP LP
Sbjct: 1614 ELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLP 1673

Query: 1683 EARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLA 1742
            EAR+KGDLL DE+KLT++EF++LM+ +GED+                  EYKKAQ  NL 
Sbjct: 1674 EARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLK 1733

Query: 1743 GEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLK 1802
             EEEER YE+ KKLV                +     +    +  ED RDVMD+LLE+LK
Sbjct: 1734 LEEEERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNED-RDVMDRLLEKLK 1792

Query: 1803 NAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEG---SILYSPEATTPDTYTA 1859
            NAGPAK+DPSSARKRA+ RK+ L    S   +L++ D E+    S++YSP+  + +    
Sbjct: 1793 NAGPAKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLN 1852

Query: 1860 VHAESPTPLATRGLMNTPEDLPSPSKAPALED--QEEISDRARMLLKELRGSEISVKQNS 1917
                SPTP   R + +      S + +PA  D    +++DRAR LL ELRG E    + S
Sbjct: 1853 EADTSPTP--ERRVRD------SNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMS 1904

Query: 1918 TLDEHLEKLRARKERASSETNTGNKLSF 1945
               + L KLRAR++  SS + + N+L+F
Sbjct: 1905 AQHQRLSKLRARRKNDSSSSGSENRLNF 1932

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1124 (37%), Positives = 640/1124 (56%), Gaps = 98/1124 (8%)

Query: 76   TTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--KYSYSKR----- 128
            T     +PL+K+STLN  +LS Y        V   ++ A + SV S  KYSYS+R     
Sbjct: 66   TGEFSHKPLSKQSTLNMASLSAYTDA-----VGAHNRSASNASVGSPTKYSYSRRASQWS 120

Query: 129  --NSSQASNKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDPYEVEILFE 186
              NS+ + +KL+RQ T               +NLSKF  PDG + LE P DP E+E LFE
Sbjct: 121  NNNSAVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFE 180

Query: 187  DIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANXXXXXXXXXXXXXX 246
            +++YKRN++QSL    Q  L  Y  EKKWL+V+QDLQ+E+KK   +              
Sbjct: 181  EVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSS 240

Query: 247  DHLPILTANSSLSSPKSILMTSASSPTSTVYXXXXXXXXXXXXXXXXXXXXXXIVTGSLK 306
              +P         SP +   TS++SP  +                        I T S+ 
Sbjct: 241  SAVP--------DSPSASNFTSSTSPNGSF----------------TGLSRPKISTSSVN 276

Query: 307  KQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 366
                  +   G S    S +TL  D ++  P +YV++I+ + ++   + DLWV+LRTEQL
Sbjct: 277  TSEQFYSSNLGTS----STTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQL 332

Query: 367  DWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEF 426
            DWV  F+E QG +A+ANV++ + Y+ +P + L  E+L+KE ++FKC +    L +G  E 
Sbjct: 333  DWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEA 392

Query: 427  ---STHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQN 483
               ++ R++   + EGL S ++AT+++A+E+ + + +      F  V+ ALD++ R   N
Sbjct: 393  VMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFCDN 452

Query: 484  LHM-----IQNFKKMPQYFSHLTL------ESHLKIIQAWLFAVEQTLDGRGKMGSLVGA 532
            +H+      Q+  K P+  S +        +  ++  + W+  VE TLDGRGKMGSLVGA
Sbjct: 453  VHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGA 512

Query: 533  SDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLD 592
            S+DF+  GGENAI+EY   T++ INHLC    ++ QR +LR +L+N G+ RI+NK+KLL+
Sbjct: 513  SEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLN 572

Query: 593  YDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSL 652
            Y+KV +Q+  +D++  DDF+      +    VD++DP+S+ +NLW +CKGT+ E+ L SL
Sbjct: 573  YEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSL 632

Query: 653  VQHLFLSSSKLIEENQNS-SKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQ 711
            +Q+L +S+ +L  +N++  ++ TKQLKL+D+LV+NVS+AS  D +S+ N AIQRLYDAMQ
Sbjct: 633  LQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMAS-VDMQSSFNSAIQRLYDAMQ 691

Query: 712  TDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQR 771
            TDE+ARRAILE+R   K+ EEI+A+RD+L EKLS AE GLVGQL+DE+ +RDHIL K+QR
Sbjct: 692  TDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQR 751

Query: 772  VMXXXXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDINE--GTRNIDPSLNFS 829
            V                       VELRK LT +NS  E S ++ +  G+ N  P L   
Sbjct: 752  VNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRP-LRPE 810

Query: 830  EKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFA 889
             K  IQK LQ  L +  K+   +SK+ G++L+PNKRLK+LR +ME+IEN+AR+LEMTNF+
Sbjct: 811  RKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFS 870

Query: 890  EFEKERLEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNISKF 949
            +++K+ ++ P ++                 +AQ+    KL +LR+ LA +Q ESN+ISKF
Sbjct: 871  DYQKDDIKEP-EVSNEDDHKAVSESEE---KAQQISALKLEELRKKLASLQQESNDISKF 926

Query: 950  NVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADER-EGDARY 1008
            NVE R +E+F+ +KSLAL RLK+LET YKGFGI+F+     +SP   ++A +    D + 
Sbjct: 927  NVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDP----DSPLGQALAGKSVSSDDKA 982

Query: 1009 SSLDPKAYQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDAS 1068
             +LDPK     ++E++ I                   +                   D+S
Sbjct: 983  RTLDPKEALNIVEEVSNI---------------LSGLDSSKAAEKSNETPLRTATSSDSS 1027

Query: 1069 PTHEIRSENSELSAGSG--PGSFLDALSQKYGTGQNVTASAGLRDSGYVS--GLGHTPSK 1124
                      +++A S     SFL++LSQKYG  QN  ++      G ++  G G+    
Sbjct: 1028 EDEMDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYH--- 1084

Query: 1125 VEKTFMNRLKRSTVNSAPYLEELTQKVNK---VEPCEQNEHVNI 1165
              K+FMNR+KR+   + PYL EL+ K+     ++P E  E+V I
Sbjct: 1085 -RKSFMNRVKRT--GAVPYLGELSGKIGSSSYIKPSEAEENVGI 1125

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/600 (58%), Positives = 433/600 (72%), Gaps = 47/600 (7%)

Query: 1331 SPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEK 1390
            SPLLPQSPSLFE+YPRP KKLKQLHWEK+D  DNSIW + +AEKFADDLYEKGVL++LEK
Sbjct: 1357 SPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEK 1416

Query: 1391 AFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQ 1450
            AFAAREIKS   ++K++  KITFLSRDISQQFGINLHMYSSL V  +V K+L CD+DFL 
Sbjct: 1417 AFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLS 1476

Query: 1451 TPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQL 1510
            T S +EFLSK EI+EVS N+AR++APY+TDWEGV +++DAK PEKDP++LQR+DQ++L L
Sbjct: 1477 TQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNL 1536

Query: 1511 MINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGN 1570
            ++NL+SYW SRMR L ++T+YE++YN+L+ KLR +DKAVGA+Q S+NLRNVF+VILAVGN
Sbjct: 1537 IVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGN 1596

Query: 1571 FMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDV 1630
            +MNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYP+FN FL+ELEPVL V
Sbjct: 1597 YMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQV 1656

Query: 1631 VKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDL 1690
            VK+SIEQL NDC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LP+LPEAR+K +L
Sbjct: 1657 VKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANL 1716

Query: 1691 LKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLY 1750
            L DEV+L++MEFE+LM+ +GED+                  EYK+AQ  N   +EEER Y
Sbjct: 1717 LADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAY 1776

Query: 1751 EKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAE--------DRRDVMDKLLEQLK 1802
            E+ K ++               R A    EG+E   A         D RDVMDKLLE+LK
Sbjct: 1777 ERRKLMI-----------QEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLK 1825

Query: 1803 NAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHA 1862
            NAGP+K DPSSARKRAL RKK +  ++ +  L       EG  +   ++  PD    V  
Sbjct: 1826 NAGPSKGDPSSARKRALARKKLMGGREGSIIL-------EGLDVDDLQSAAPD----VQP 1874

Query: 1863 ESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEH 1922
            ++P   A+           SP   PA       +DRAR LL ELR  E    + S LDEH
Sbjct: 1875 DTPLRAAS----------ASPPPDPA-------ADRARHLLLELRNGEHPESRKSMLDEH 1917

 Score =  502 bits (1293), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 313/723 (43%), Positives = 451/723 (62%), Gaps = 62/723 (8%)

Query: 337  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRD 396
            P HYV++I++D++T  E+ DLW++LRTE +DWV  FI+ QG +A+AN L+    K   R+
Sbjct: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLL----KFVQRE 351

Query: 397  NLT----KELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMAT 452
            +L      + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S++L+T+++AT
Sbjct: 352  SLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVAT 411

Query: 453  EIFVCMLE----KKNKSRFEAV---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 505
            E  + ML     K   +  +A+   L ALD++ +   N+H+     +  +  S  T  + 
Sbjct: 412  ETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRAD 471

Query: 506  LKII----QAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCS 561
              ++    + WL+ +E TLDGRG+MGSLVGASDD+K  GGEN +LEY  ++M+ +N LCS
Sbjct: 472  FHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCS 529

Query: 562  CSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEA 621
               ++ QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + +    
Sbjct: 530  NHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVD 589

Query: 622  FNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMD 681
              VD++DP +L ++ W   +GTE E  L+SL+QHL    S+   E ++ ++  KQLKL+D
Sbjct: 590  SAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHL-FLWSRAFAEYRDPAESIKQLKLLD 648

Query: 682  SLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 741
            +LVTNV+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+
Sbjct: 649  ALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLA 707

Query: 742  EKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXVELRKM 801
             KLS+A++GLVGQL+ E+ + + IL K+ RV                       VELRKM
Sbjct: 708  SKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKM 767

Query: 802  LTILNSRPE----ESSDINEGTRNIDPS-LNFSEKANIQKVLQDGLSRAKKDYKDDSKKF 856
            LTILNS+P      S ++N  T    PS L   +K  IQK LQD L + +KD   DSK+ 
Sbjct: 768  LTILNSKPHGENGGSPEVNTST----PSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRL 823

Query: 857  GMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKER--------LEPP-IQIXXXXX 907
                 PN+RLKMLR +M+ IE EAR LEMTNFA+F+KE         L PP IQ      
Sbjct: 824  NTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPPKIQRSL--- 880

Query: 908  XXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLAL 967
                        R ++  + +L  LR+ LA IQ ESN +SKFNVEERVNELF EKK+ AL
Sbjct: 881  ------------RGEQ--VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKAL 926

Query: 968  KRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREG---DARYSS-LDPKAYQKKLDEI 1023
             RL++LE KYKGFGIDFN +  + S +  + + + +G   D   S+ LDP     K++E+
Sbjct: 927  DRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEM 986

Query: 1024 NRI 1026
             +I
Sbjct: 987  TKI 989

 Score = 77.0 bits (188), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (67%)

Query: 160 LSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVK 219
           L K T  DG + LE P DP E+E L+++++ KRNI QS+S      LM Y  +KKWL+VK
Sbjct: 173 LHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVK 232

Query: 220 QDLQNELKKMR 230
           QDLQ E KKM+
Sbjct: 233 QDLQTEYKKMK 243

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 12/77 (15%)

Query: 1087 GSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKV----------EKTFMNRLKRS 1136
             SFL+ LSQKYGTG   + +A +  S ++ G+ +   +            K+F+NR+KR+
Sbjct: 1086 ASFLETLSQKYGTGSQ-SGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRT 1144

Query: 1137 -TVNSAPYLEELTQKVN 1152
             T  S+ +LEELTQKV+
Sbjct: 1145 ITPTSSNFLEELTQKVS 1161

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/652 (56%), Positives = 462/652 (70%), Gaps = 38/652 (5%)

Query: 1324 QMKSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKG 1383
            + K +  SPLLPQSPSLFEKYPRP K+LKQLHWEK+D  DNSIW + +AEKFADDLYE+G
Sbjct: 1383 KYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERG 1442

Query: 1384 VLADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLN 1443
            VL +LEKAFAAREIKSL + RK+D  K+TFLSRDISQQFGINLHMYSSL+V  +V K+L 
Sbjct: 1443 VLTELEKAFAAREIKSLIS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILK 1501

Query: 1444 CDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRA 1503
            CD+DFL T S +EFLSK EI+EVS+N+AR +APY+TDWEGV ++++AK PEKDPN+LQRA
Sbjct: 1502 CDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRA 1561

Query: 1504 DQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFN 1563
            DQ+YL L++NL+SYW SRMRAL ++T+YE++YN+L+ KLR +DKAVGA+Q S+NLRNVF+
Sbjct: 1562 DQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFD 1621

Query: 1564 VILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKE 1623
            VILAVGN+MND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+E
Sbjct: 1622 VILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQE 1681

Query: 1624 LEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPE 1683
            LEPVL VVK+SIEQL NDC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LPVLPE
Sbjct: 1682 LEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPE 1741

Query: 1684 ARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAG 1743
            AR++ +LL DEV+L++MEFESLM+ +GEDS                  EYK+AQ  N   
Sbjct: 1742 ARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKM 1801

Query: 1744 EEEERLYEKHKKLVXXXXXXXXXX---XXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQ 1800
            EEEER YE+ K ++                  R  S     +     +D RDVMD+LLE+
Sbjct: 1802 EEEERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDD-RDVMDRLLEK 1860

Query: 1801 LKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEE-GSILYSPEATTPDTYTA 1859
            LKNAGP+K DPSSARKRAL RKK +  K S   +L+ LD EE  +I         D+  A
Sbjct: 1861 LKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPA 1920

Query: 1860 VHAESPTPLATRGL------MNTPEDLPS--------------------PSKAPALEDQE 1893
            +     +P +T G       +N   DLPS                    PSK   + D++
Sbjct: 1921 ILG---SPTSTVGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSK--KILDED 1975

Query: 1894 EISDRARMLLKELRGSEISVK-QNSTLDEHLEKLRARKERASSETNTGNKLS 1944
             ++ RAR LL+ELR S+   + + S LDEH EK+R R+ +   E + GN  S
Sbjct: 1976 AVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027

 Score =  541 bits (1395), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 325/755 (43%), Positives = 465/755 (61%), Gaps = 62/755 (8%)

Query: 310  SLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWV 369
            S N   R  S+N+     +  D ++  P HYV++I++D++T  E+ DLWV+LRTE +DWV
Sbjct: 265  SSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWV 324

Query: 370  DAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTH 429
              FI+ QG +A+AN L+    + +    L  +LLEKE +++KC RVL+ L +G+    + 
Sbjct: 325  IGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSS 384

Query: 430  RLMTDTVAEGLFSTKLATKKMATEIFVCMLE----KKNKSRFEA---VLTALDKKFRIGQ 482
            +L+   V EGL S +L T+++ATE  + ML     K   + F+A   VL ALD++ +   
Sbjct: 385  KLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSS 444

Query: 483  NLHMIQNFKKMPQYFSHLTLESHLKII----QAWLFAVEQTLDGRGKMGSLVGASDDFKN 538
            ++H+     +  +  S  T  + L +I    + WL+ +E TLDGRG+MGSLVGAS+D+KN
Sbjct: 445  SIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN 504

Query: 539  GGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVID 598
            G  EN +LEY  ++M+ IN LCS   +++QR LLR++L++ G+ R++ K++LL Y  + +
Sbjct: 505  G--ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALEN 562

Query: 599  QIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFL 658
            ++  +++  LDD+N  + ++    +VD++DP SL  N W   KGTE+E  L+SL+QHLFL
Sbjct: 563  EVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFL 622

Query: 659  SSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARR 718
             SSK   E+ + ++ +KQLKL+D+LV+NV+  S+ D ES  N AIQRLYDAMQTDEVARR
Sbjct: 623  WSSKAFSESTDPAEGSKQLKLLDALVSNVTF-SSIDTESGFNGAIQRLYDAMQTDEVARR 681

Query: 719  AILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXXXXX 778
            AILESR LTKK EE++AERD L  KL++A+ GLVGQL+ E+ +   IL K+ RV      
Sbjct: 682  AILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKA 741

Query: 779  XXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSD---INEGTRNIDPS-LNFSEKANI 834
                             VELRKMLTILNS+P ++S+     +G  N  PS L   +K  I
Sbjct: 742  DLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAI 801

Query: 835  QKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKE 894
            QK LQD L + +KD   DS++FG    PN+RLKMLR +M++IE EA  LEMTNFAEF+KE
Sbjct: 802  QKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKE 861

Query: 895  -------RLEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNIS 947
                   RL+ P +I                 R+++  + +L  LR+ LA IQ ESN IS
Sbjct: 862  TKVEDLPRLQSPPKIERN-------------VRSEK--VKELAALRQRLAVIQQESNEIS 906

Query: 948  KFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDAR 1007
            KFNVEERVNELF EKK+ AL RL++LE KY+ FGIDFN+E       +L +  +REGD  
Sbjct: 907  KFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNME------SELLIETDREGDGD 960

Query: 1008 YS----------------SLDPKAYQKKLDEINRI 1026
             S                 LDP     K++E+ +I
Sbjct: 961  ASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKI 995

 Score = 89.4 bits (220), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 89/174 (51%), Gaps = 16/174 (9%)

Query: 73  PSRTTSIEARPLNKKSTLNTQNLSQYM---------SGKMSADVPISSQHARSHSVQSKY 123
           PS      A+PL+K STLNT +LSQY          SG +S   P    +++  S  S  
Sbjct: 69  PSSLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSSQWSGG 128

Query: 124 SYSKR-----NSSQASNKLTRQHTXXXXXXXXXXXXXXXTNLSKFTTPDGKIHLEMPSDP 178
           + +K+         + + L+RQ T               T L K T  DG + LE P  P
Sbjct: 129 NSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSV--TLLQKITDSDGNLSLEKPKYP 186

Query: 179 YEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRAN 232
            E+E L+++++ KRNI  S+S      LMGY  +KKWL+VKQDLQ ELK+M+ N
Sbjct: 187 QEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNN 240

 Score = 44.7 bits (104), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 28/106 (26%)

Query: 1067 ASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNV-----------------TASAGL 1109
             SP+  +  E S+    +   SFL++LSQKYGTG N+                    +  
Sbjct: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQ 1148

Query: 1110 RDSGYVSGLGHTPSKVEKTFMNRLKR-STVNSAPYLEELTQKVNKV 1154
            R+SGY     H      K+F+NR+K+ ST  S+ +++E++QK+  V
Sbjct: 1149 RNSGY-----H-----RKSFVNRMKKNSTPKSSSFVDEVSQKMTPV 1184

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/583 (59%), Positives = 430/583 (73%), Gaps = 22/583 (3%)

Query: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385
            K+ VTSPLLPQSPSLFE+YPRP KKLKQLHWEK+D+  +SIW + +AEK ADDL+E+GVL
Sbjct: 1211 KATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVL 1270

Query: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445
            + LEKAFAARE KSL  K KE  +KITFLSRD+SQQFGINLHM+S+L V D+V KV+ CD
Sbjct: 1271 SQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCD 1330

Query: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505
            R+FL TPSV+EFLSK  IIEV+ NLAR + PYSTDWEGV ++DDAKPPEKDPN+LQRADQ
Sbjct: 1331 REFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQ 1390

Query: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565
            +Y++ MINL+ YWGSRMRA+T++T+YE++Y++L+ KLRK+D+AV  ++ S++LR+VF+VI
Sbjct: 1391 LYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVI 1450

Query: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625
            LAVGN+MND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKIIR NYP ++ F++ELE
Sbjct: 1451 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELE 1510

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
            P+  V K+SIEQLV DCK+FSQS++NVERS+EIGNLSD SKFHPLD+VL K +PVLPEAR
Sbjct: 1511 PIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEAR 1570

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
            +K DLL DE+KL+++EFE+LM+ +GED+                  E+KKA+  N+  EE
Sbjct: 1571 KKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEE 1630

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805
            EER YE+ KK++                S + +   +   E  D RD ++KLL++LKNA 
Sbjct: 1631 EERAYERRKKMIEDQQRKQQEAD-----SKATAKNLSTSQEPSDDRDDIEKLLDKLKNAA 1685

Query: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESP 1865
            P+K DPSS RKRAL RKK L  K  A   + D    + +I    EA      T    ESP
Sbjct: 1686 PSKGDPSSTRKRALARKKLLDGKSGAS--IFDNITADSTI----EAFVEQNRTLT--ESP 1737

Query: 1866 TPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRG 1908
            T   +  L  T E L S  + PA        DRAR LL ELRG
Sbjct: 1738 TAKKSASLPET-ESLSSSKQDPA--------DRARNLLLELRG 1771

 Score =  555 bits (1431), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 346/867 (39%), Positives = 506/867 (58%), Gaps = 67/867 (7%)

Query: 311  LNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVD 370
            LN  Y G    N S  +L    ++ PP +YV++I++ K+   E+ DLWV+LRTE LDWV 
Sbjct: 243  LNTQYEGMLHTNESQGSLLSP-SHFPPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVI 301

Query: 371  AFIEHQGHIAMANVLMNSMYK--TAPRDNLT-KELLEKENSFFKCFRVLSMLSQGLYEFS 427
            +F+E QG +A+AN+++ SM++  T  ++ +T  + LE+E + FKC RVL  + + L E  
Sbjct: 302  SFLEAQGQVAIANLIITSMHQDTTDNQNAVTDPQFLERETALFKCLRVLLNIRECLEEAV 361

Query: 428  THRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKN--KSR------FEAVLTALDKKFR 479
               L+T+ + EGL STK+ T+++ATE  + ++ K    KSR      F  V+ +L+ +  
Sbjct: 362  NSTLVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETS 421

Query: 480  IGQNLHMIQNFKKM----PQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDD 535
            + QN+HM   F       P+  S+  L    KI+Q WL+ VEQTLDGRGKMGSLVGASD+
Sbjct: 422  LVQNIHMKAKFSTNDSTDPE--SNPQLYQVCKILQQWLYVVEQTLDGRGKMGSLVGASDE 479

Query: 536  FKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDK 595
            ++N  GEN+I EY   ++V I+ LC  ++++ +R ++RT+L++ G+ RI+ K++LLDY  
Sbjct: 480  YRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPP 539

Query: 596  VIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQH 655
            +   +  +++  +DD+N  +++     NVD+ DP+S+L+ L    KGTE E  L+S++Q+
Sbjct: 540  LSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQN 599

Query: 656  LFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEV 715
            LFLSS+K  +E+ +  K  +QLKL+DSL++NV+I +  D ESN N+AIQRLYD+MQTDE+
Sbjct: 600  LFLSSNKNAQESDDPGKNVQQLKLIDSLISNVAI-TTLDSESNFNVAIQRLYDSMQTDEI 658

Query: 716  ARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMXX 775
            ARRAILESR LTKKLEE++AERD L++K+SKAE+GLVGQL+ EL ERD IL K QRV   
Sbjct: 659  ARRAILESRELTKKLEEVKAERDYLNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQ 718

Query: 776  XXXXXXXXXXXXXXXXXXXXVELRKMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQ 835
                                +ELRKMLTI+NS+  +  +     +N    LN   K  IQ
Sbjct: 719  LQSELEELKKRHLLEKHEHEIELRKMLTIVNSKTSDDLESGSTVQNDPKPLNPERKTAIQ 778

Query: 836  KVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKER 895
             VLQ  L + ++D  ++S++ G  +    RLK+LR +ME+IEN+AR+LEMTNFA+ + ++
Sbjct: 779  NVLQRSLQKTEQDLLNESRRLGTAVGSKSRLKLLRSKMEDIENQARELEMTNFADVKPKQ 838

Query: 896  LEPPIQIXXXXXXXXXXXXXNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERV 955
                                 F  + +     KL +LR+ LA IQ ESN+I+KFN+E RV
Sbjct: 839  ------------------NQKFKEQVKGQQATKLAELRKKLAIIQNESNDITKFNIEARV 880

Query: 956  NELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKA 1015
            NELF +KK  AL RLK+LE KY GF IDF  +  +   K+L       G     SLDP  
Sbjct: 881  NELFQDKKLAALDRLKDLENKYNGFHIDFADDPEL---KELLTQSSNGG----PSLDPTI 933

Query: 1016 YQKKLDEINRIXXXXXXXXXXXXXXXXXXXNGKXXXXXXXXXXXXXEVYQDASPTHEIRS 1075
             Q+K++E+N I                   +               +    +  +H    
Sbjct: 934  VQRKVEEMNSIIDELNALKEEMKNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASH---- 989

Query: 1076 ENSELSAGSGPGSFLDALSQKYGTGQNVTASAG----LRDSGYVSGLGHTPSKVEKTFMN 1131
             +  +S GS   SFL++LSQKY TGQ    S       R++ Y     H      K+F+N
Sbjct: 990  GSDIVSNGS---SFLESLSQKYSTGQQTATSTNGGRVGRETRYPGSGYH-----RKSFLN 1041

Query: 1132 RLKRSTVNSA-------PYLEELTQKV 1151
            RLK +TVN         P+L EL  KV
Sbjct: 1042 RLKNTTVNPTATSEHLPPFLTELKSKV 1068

 Score =  102 bits (255), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 89/153 (58%), Gaps = 10/153 (6%)

Query: 81  ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNKLTRQ 140
           ++PLNK S+LNT NLS Y    M  +    SQ A   +  +KYSYS+R+S     +LTR 
Sbjct: 76  SKPLNKISSLNTHNLSHYT---MDPEANSRSQSASLLTSPTKYSYSRRSS-----QLTRS 127

Query: 141 HTXXXXXXXXXXXXXXXTN--LSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNIFQSL 198
            T               +   L++F T DG + L+ P +P E+  LF D++ KRN+F S+
Sbjct: 128 STNKSIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSV 187

Query: 199 SGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231
           S   Q+ ++ Y  EKKWL+VKQDLQ+E K++++
Sbjct: 188 SSQDQKDMLNYPIEKKWLMVKQDLQSEFKRLKS 220

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  300 bits (769), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 173/498 (34%), Positives = 295/498 (59%), Gaps = 29/498 (5%)

Query: 1350 KLKQLHWEKLDSTDNSIWGSGKAEKFADD-LYEKGVLADLEKAFAAREI---KSLATKRK 1405
            KL+Q+HW+ ++    + W   +  K     L E GV  ++E+ F  ++    K    K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1406 EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEIIE 1465
            ++L+K++FLSRD++QQFGINLHM+S+ +V +LV KVL+C+ + ++  SV+EF +K ++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1466 VSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRAL 1525
            +S ++ +N+ PYST      N+   + P KD ++L+RAD+++L+L  NL SYW +RMR L
Sbjct: 979  ISQSVKKNFEPYST------NVLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1526 TVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKLS 1585
             ++ +YE++Y ++L KL+K+D A  A++ S  L+ +  +I+ +GN+MN+  +QA+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1586 TLQRLTFIKDTTNS-MTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCKD 1644
            +L +L F+K +TN+ M+FL+Y+E+I+R  Y +    + +L  +  + K++++Q+  DC++
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1645 FSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFES 1704
            F++ I N+ERS + G+LS +  FHP D ++ KT   +P A+RK  LL D+ KLT+ + E 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1705 LMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXXXX 1764
            LM   GE+                  + +KKA  +N+  EE ER+YE+ KKL+       
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLL------- 1263

Query: 1765 XXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALVRKKY 1824
                    RS   + E    DE+ +  D +D L+ +L+     KT  +  R ++  R   
Sbjct: 1264 ----EIKERSCG-NMESQNSDESAENNDTVDVLIHKLRGVTFEKTKVNKDRGKS--RNND 1316

Query: 1825 LSDK--DSAPQLLNDLDN 1840
             SD        +LND+ N
Sbjct: 1317 YSDGLLSRTKTMLNDIQN 1334

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 117/247 (47%), Gaps = 37/247 (14%)

Query: 545 ILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIK-----LLD-----YD 594
           + +YC  T+  IN +   + +  ++ LL  K + CG+ R+  K K     LLD     Y 
Sbjct: 317 LTDYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYK 376

Query: 595 KVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQ 654
           +V +++    + +L  F            +D+    S+LK L    + T  E  L  L++
Sbjct: 377 EVEEEVITRSSPELPTF------------LDISYG-SILKTLILETRSTPLEHPLYQLLE 423

Query: 655 HLFLSSSKLIEENQNSSKLTKQLKLMDSLVT-----NVSIASAADEESNLNMAIQRLYDA 709
            +       I   + SS+  K  KL  S++           S    ES L  ++ ++ D+
Sbjct: 424 GVLQ-----ISVTRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDS 478

Query: 710 MQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLE---DELHERDHIL 766
           +Q+DE+ARRA+ E  +L + ++++ AE +SL E+    +  ++ QLE   + L ++D  L
Sbjct: 479 LQSDEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETL 538

Query: 767 AK-NQRV 772
            + N+R+
Sbjct: 539 KQLNERI 545

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  296 bits (758), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/477 (34%), Positives = 271/477 (56%), Gaps = 26/477 (5%)

Query: 1349 KKLKQLHWEKLDSTDNSIWGSGKA-EKFADDLYEKGVLADLEKAFAAREIKSLATKRK-- 1405
            KK+KQ+HWEK++  +N+ W + +  E+   +L   G+   +E  F  + +  +  K+K  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1406 -EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEII 1464
                + I+FLSRD++QQFGINLH++  LS  +LV KVL CD D L+  SV+EF  K E+ 
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1465 EVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRA 1524
             ++ +L R+  PYSTD+     ++    P K+P++LQRAD+++L+L  NL SYW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDY-----MNPESVPTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1525 LTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1584
            L ++ +YE++Y +LL KL+K+D A+  +  S+  +N+  +I+ +GNFMN  ++   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1585 STLQRLTFIK-DTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCK 1643
            S L +L FIK +  N+++FL+Y+E++IR++Y +   F+ +L  V ++ K+S++Q+   C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1644 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFE 1703
            +F   I  +  ++  G LSD  K HP D++L K    +  AR KG+LL D  KL+  +FE
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1704 SLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXXX 1763
             +M+ YGED                    +KK   +N+  EE ER+Y + KK++      
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIM------ 1224

Query: 1764 XXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820
                     R  S    G +  + E+    +D LL QL+     K +P   RK   V
Sbjct: 1225 -----EASTRKDSDVDSGTDNIDGENT--AVDSLLAQLRGVD-KKPEPLRTRKSVKV 1273

 Score = 37.7 bits (86), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 100/207 (48%), Gaps = 21/207 (10%)

Query: 545 ILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYD 604
           I +Y    +  IN +     +   +  +  +L+   V  ++  ++ +D + + +Q+ L+ 
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 605 NNKLDDFNVKLEANNEAFNVDLQDPL-SLLKNLWGICKGTENEKLLVSLVQHLFLSSSKL 663
           +    + N+ LE  +    V +  P  S+L+ L  +   T+ E  + SL+  +  S +K 
Sbjct: 399 DT---EENI-LEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK- 453

Query: 664 IEENQNSSKLTKQLKLMDSLVT----NVSIASAADEESNLNMAIQRLYDAMQTDEVARRA 719
               +  S+ +K L+ M+S +     N +       E+    ++  L D++Q+DE+A+RA
Sbjct: 454 ----KTYSESSKLLQFMESFLQYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRA 509

Query: 720 ILESRALTKKLEEIQAERDSLSEKLSK 746
           +LE       L+E Q++ + LS +L+K
Sbjct: 510 MLE-------LDEKQSQMNILSNQLTK 529

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  290 bits (742), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/484 (33%), Positives = 272/484 (56%), Gaps = 24/484 (4%)

Query: 1331 SPLLPQSPSL--FEKYPRPHKKLKQLHWEKLDSTDNSIWG--SGKAEKFADDLYEKGVLA 1386
            SP  P  P L        P  KLKQ+HW+K+D    ++W   S +  K + +L   G+  
Sbjct: 940  SPGAPDIPKLGNVTLLSAPKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQ 998

Query: 1387 DLEKAFAAREIK-----SLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKV 1441
            ++++ F           + A   K    K++ LSR+++Q+FGINLH++S  +V +L  KV
Sbjct: 999  EIDELFQLNPTSPAIANATANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKV 1058

Query: 1442 LNCDRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQ 1501
            LNCD + L+  SV+EF  K EI  +  ++ + +APYS       N    + P++DPN+L 
Sbjct: 1059 LNCDNEVLKNQSVIEFFCKEEINNIPKSVQQLFAPYSA------NYITGEQPDRDPNELD 1112

Query: 1502 RADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNV 1561
            RAD++YL+L  NL SYWG+R + L V+ +++++Y ++L KL ++D A  ALQ S  L+ +
Sbjct: 1113 RADRIYLELFYNLRSYWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKEL 1172

Query: 1562 FNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDF 1620
            F +I+ +GN+MN   +   G +LS+L +L F K +T N+M+F++ +E+I+R  YP+ +DF
Sbjct: 1173 FFIIVEIGNYMNQ--RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDF 1230

Query: 1621 LKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPV 1680
            ++ L+ +L+V  + ++ +  +  +F   I ++ER   IG LSD S+FHP DK ++KT   
Sbjct: 1231 VEGLDKILEVQNIIVQHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESK 1290

Query: 1681 LPEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQN 1740
            +  A++K DLLKD+  LT+ +FE LM  +GE+                    ++KA  +N
Sbjct: 1291 ILLAKKKADLLKDQCTLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKEN 1350

Query: 1741 LAGEEEERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQ 1800
               EE  R+YEK ++ +                S + S      D+   + D +D L+++
Sbjct: 1351 SEREEMTRIYEKRRRALEQSASSQRQRRRASRLSTAAS-----MDDGTQQEDAVDTLIKK 1405

Query: 1801 LKNA 1804
            L+N 
Sbjct: 1406 LRNV 1409

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 114/247 (46%), Gaps = 30/247 (12%)

Query: 512 WLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRML 571
           WL AVE T+    +    V +     N   +  +++YC  TM  IN L         +  
Sbjct: 289 WLEAVETTIKDETQWHDDVPS-----NQKPQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 572 LRTKLENCGVLRIMNKI----KLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEA-FNVDL 626
           L   L++ G+ RI ++I    +  D + ++D+I  Y + +  + N K   +     NV  
Sbjct: 344 LIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSRE-GEINSKFVIDTPTHLNVSF 402

Query: 627 QDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTN 686
           +   S +K +  + +GT  E  +      L L S + I  ++ S++ TK L+L  S+   
Sbjct: 403 K---SQIKTIVTLTQGTSLESYMT-----LVLDSIRQIVTSRTSAEATKLLQLFQSIFKY 454

Query: 687 VSIASAADEESNLNMAIQ----RLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSE 742
           +   S  DEE    +A+Q    +L D +Q+ +V +RA+ E       LEE++ + + +  
Sbjct: 455 LIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQE-------LEEMKVKMEEMKR 507

Query: 743 KLSKAEH 749
            ++K EH
Sbjct: 508 VIAKLEH 514

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  285 bits (729), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 280/496 (56%), Gaps = 35/496 (7%)

Query: 1345 PRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAF----AAREIKSL 1400
            P+   +LKQ+HWEK+D    ++W         D L ++GV + +EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460
            A    +   KI+FL+RDI+QQFGINLHMYS LSV + V KVL C+ D +Q  SV+ F +K
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520
             ++ ++   L R +APYST++      DD+  PEKDP +L+RAD +YL+L  NL SYW +
Sbjct: 934  EDLTQIPSGLERKFAPYSTNYLT----DDS--PEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580
            R   L V+T+YER+Y +L+ KL K+D+A+  L  S  ++ +  +I  +GN+MN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1581 GFKLSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLV 1639
            G KL++L +L+F+K ++  +++FL++VE+++R ++P+   F +++  V D+ KV++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1640 NDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTI 1699
             +C++F++ + +V  S+  G LSD +K HP D +  K    +  A+ K +LL ++ +LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1700 MEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXX 1759
                 LM+ YGE+                    +KK   +N+  EE  RLYE+ K L+  
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1760 XXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRAL 1819
                                   E++ ++D  + +D L+ +L++A   K  P+  R+R  
Sbjct: 1226 RNKKI-----------------EEQEHSDDEINAVDDLITKLRDA--KKQHPAPLRRRR- 1265

Query: 1820 VRKKYLSDKDSAPQLL 1835
              K  L++K +   LL
Sbjct: 1266 STKAVLNEKRAGEPLL 1281

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  284 bits (726), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 153/415 (36%), Positives = 247/415 (59%), Gaps = 16/415 (3%)

Query: 1350 KLKQLHWEKLDSTDNSIWGSGKAE-KFADDLYEKGVLADLEKAF-----AAREIKSLATK 1403
            KLKQ+HW+K+D    ++W   K     + +L   GV  ++E+ F     A +   ++ T 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1404 RKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEI 1463
            +     K+T LS D++QQFGINL+++S+ SV +LV+KVL CD + ++  SV+EF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1464 IEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMR 1523
              +  ++ R +APY T++           PEKD   L RAD++YL+L  NL SYW  R +
Sbjct: 935  NHIPQSIQRMFAPYETNYLT------GDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1524 ALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFK 1583
             L  + +YE++Y ++L KL+++D    A++ S  L+ +  +I+ VGN+MN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1584 LSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDC 1642
            LS+L +L F K +  N+++F++ +E I+RLNYP+ + F+ +LE +LDV  + ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1643 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEF 1702
            ++F + I  +ERS+ +G LSDSSKFHP DK LI T   +  A +K DLLK +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1703 ESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLV 1757
            + LM  +GED                    +KKA  +N+   E  R+ E  + L+
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLL 1220

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  284 bits (727), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/437 (35%), Positives = 260/437 (59%), Gaps = 30/437 (6%)

Query: 1337 SPSLFEKYPRPHK---KLKQLHWEKLDSTDNSIWGSGKAE-KFADDLYEKGVLADLEKAF 1392
            +P++  + P P     KLKQ+HW+K+++   ++W   +     + +L   G+  ++E+ F
Sbjct: 1149 APTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF 1208

Query: 1393 AAREIK--------SLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNC 1444
               EIK        + A+  K    +I+ LSR+++Q+FGINLH++S  +V +LV KVL+C
Sbjct: 1209 ---EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSC 1265

Query: 1445 DRDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDW-EGVRNLDDAKPPEKDPNDLQRA 1503
            D + ++   V+EF  K E   V  ++ R + PY T++  G R       PEKDP +L+RA
Sbjct: 1266 DSEVMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYLTGER-------PEKDPAELERA 1318

Query: 1504 DQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFN 1563
            D++YL+L  NL SYW +R   L V++++ER+Y ++L KL+++D A  A+Q S+ L+ +F 
Sbjct: 1319 DRIYLELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFF 1378

Query: 1564 VILAVGNFMNDTSKQAQGFKLSTLQRLTF---IKDTTNSMTFLNYVEKIIRLNYPNFNDF 1620
            +I+ +GN+MN   K  QG +LS+L +L F   IKD  N+++F++ +E+I+R  YP+ +DF
Sbjct: 1379 IIVEIGNYMNQ--KPVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDF 1434

Query: 1621 LKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPV 1680
            ++ +  +  V  + ++ +  +  +F   I N++RS+  G LSD SKFHP D+ L +T   
Sbjct: 1435 VEGINSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTK 1494

Query: 1681 LPEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQN 1740
            L +A++K  LL+D+  LTI +FE LM  +GE+                    ++KA  +N
Sbjct: 1495 LAQAKKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKEN 1554

Query: 1741 LAGEEEERLYEKHKKLV 1757
               EE +R YEK ++L+
Sbjct: 1555 TEREELDRTYEKRRRLL 1571

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  281 bits (720), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 158/481 (32%), Positives = 275/481 (57%), Gaps = 32/481 (6%)

Query: 1341 FEKYPRPH-KKLKQLHWEKLDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI- 1397
            F   P+P  K LKQ+HW+K++   +++W          +DL EKGV  ++   F  + + 
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1398 ---KSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSV 1454
               KS  T  K++ +K++ LSRD++QQFGINLHM+SS SV DL+ KVL CD D ++  SV
Sbjct: 852  MKKKSNVTASKKN-EKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSV 910

Query: 1455 VEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINL 1514
            +EF +K +   +  ++ R++ PY++DW+        K P++D + L+RAD++YL++  N+
Sbjct: 911  LEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNM 964

Query: 1515 ESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMND 1574
              YW  R  +L +  +YE++Y ++L +L+K+D     ++ S+ L+  F +++ +GNFMN+
Sbjct: 965  RYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN 1024

Query: 1575 TSKQAQGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKV 1633
              K+ QG KLS+L +L+ +K  ++ +++FL+ +E+IIR  YP+  DF ++L  + D+ K+
Sbjct: 1025 --KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKI 1082

Query: 1634 SIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKD 1693
            +IE + ++  ++ + I+ ++ S E G LS + K HP DK   K    LP A RK +LL +
Sbjct: 1083 NIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHN 1142

Query: 1694 EVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKH 1753
            + KLT+ +F S M+  GED                    + K   +N   E   R++E+ 
Sbjct: 1143 QCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQR 1202

Query: 1754 KKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSS 1813
            ++L+                S     E + +DEA D  D+   L+++L++  P +T P S
Sbjct: 1203 QQLLQKA-------------STETQVEKSADDEAADTIDI---LIKKLRSVDPQQTIPGS 1246

Query: 1814 A 1814
            +
Sbjct: 1247 S 1247

 Score = 33.9 bits (76), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 52/270 (19%), Positives = 120/270 (44%), Gaps = 33/270 (12%)

Query: 502 LESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNG----GGENAILEYCQWTMVFIN 557
           LES     ++W+ AVE TL               F N       +  +++Y   T++ + 
Sbjct: 271 LESLDLCYESWIQAVEMTLRNPEDYA--------FNNSLILPKPKELLVDYSISTLLLVQ 322

Query: 558 HLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEA 617
            +     + + ++    + +  G+ R+   +K LD   +   IDLY         ++L+ 
Sbjct: 323 SIQQLLPSNDLKLACFKRWKRAGIHRVFRLMKDLDSSALNQDIDLY-------IELELKV 375

Query: 618 NNEAFNVDLQDPLSL---LKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLT 674
            ++ F  +    +S    +K+L    K T  E  + ++++ +     +L+ E      + 
Sbjct: 376 QDKQFKNEFLSEISYGPQIKSLIEYTKDTPLETPICNIIETIL----ELVNERTTEGSI- 430

Query: 675 KQLKLMDSLVTNV---SIASAADE---ESNLNMAIQRLYDAMQTDEVARRAILESRALTK 728
           K   + +S++T +   ++  + DE   E     ++  + D +Q+ ++A+RA++E     K
Sbjct: 431 KLFYVFNSILTYLCEHTLDGSFDETNTEQVFMTSLDHIMDNLQSHQIAKRAMMELDEKKK 490

Query: 729 KLEEIQAERDSLSEKLSKAEHGLVGQLEDE 758
           + + IQ + D+L +    ++  L+ +LE++
Sbjct: 491 EFDGIQLQLDTLLQDKQVSKGDLLQKLENK 520

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  281 bits (720), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 161/492 (32%), Positives = 267/492 (54%), Gaps = 47/492 (9%)

Query: 1345 PRP-HKKLKQLHWEKLDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREIKSLAT 1402
            P P  K+LKQ+HW+K++   +++W  G + ++    L   G+ + +E  F  +    +A 
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1403 K---------------RKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRD 1447
            K                  +L+KI+FLSRD++QQFGINLHM+S LS  + V KVL CD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1448 FLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVY 1507
             +Q  ++++F  K E++ +  +L   Y PYS    G           K  +DLQRAD+++
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1508 LQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILA 1567
            L+L INL  YW  R ++L  +++YER+Y +L+ KL+ +D  +  L  SD  +N+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1568 VGNFMNDTSKQAQGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEP 1626
            +GN MN   +  +G KL +L +L F++ +T+ +M+FL+++EKIIR+ YP+   F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1627 VLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARR 1686
            V D+ K+S+E +  +C +F   I N+    + G LS+     P D+++ K    +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1687 KGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEE 1746
            K +LL D+ KLT+++   LM+ YGED                    +KK   +N+  EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1747 ERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAED-RRDVMDKLLEQLKNAG 1805
            ER+YE+ K L+                + +   +GN+E+E E+   D +D L+ +L+   
Sbjct: 1277 ERVYEQRKNLLEMRT------------NGNKKCDGNDENEGEEVNTDAVDLLISKLR--- 1321

Query: 1806 PAKTDPSSARKR 1817
              K DP   R+R
Sbjct: 1322 EVKKDPEPLRRR 1333

 Score = 43.1 bits (100), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 68/133 (51%), Gaps = 19/133 (14%)

Query: 628 DPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLV--- 684
           +P+ L K L    K +  E  +  ++  L+    K+++  +  S+  K LKLM+SL+   
Sbjct: 427 EPVCLEKCLLLKAKDSPVETPINEIIHSLW----KILDSQRPYSESIKLLKLMNSLLFYL 482

Query: 685 -------TNVS----IASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEI 733
                  TN S    I SA + +S    ++ +L D++Q+DE+ARRA+ E   L KK+  +
Sbjct: 483 IDSFQVPTNPSFDENIESAENADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKISHL 542

Query: 734 QAERDSLSEKLSK 746
             + D L E  SK
Sbjct: 543 NEKLD-LVENCSK 554

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/495 (32%), Positives = 267/495 (53%), Gaps = 46/495 (9%)

Query: 1345 PRPHKKLKQLHWEKLDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATK 1403
            P P ++LKQ+HW++++   +++W  + + ++   +L   GV + +E  F  R    +A+K
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1404 RK---------------EDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDF 1448
                              +L+K++FLSRD++QQFGINLHM+S LS  + V KVLNCD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1449 LQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYL 1508
            +Q  ++++F  K E+  +  +L   Y PYS   EG           K  +DLQRAD+++L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1509 QLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAV 1568
            +L INL SYW  R + L  +++YER+Y +LL KL+K+D  +  L  S   +N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1569 GNFMNDTSKQAQGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPV 1627
            GN MN   K  +G KL +L +L F++ + + +M+FL+++EKIIR+ YP+   F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1628 LDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRK 1687
             D+ K+S+E +  +C +F   I N+    + G LS      P D+++ K    +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1688 GDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEE 1747
             +LL  + KLT+++   LM+ YGED                    +KK   +N+  EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1748 RLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAED-RRDVMDKLLEQLKNAGP 1806
            R+YE+ K L+                + +    GN+E+E E+   D +D L+ +L+    
Sbjct: 1278 RVYEQRKSLLEMRT------------NNNKKSNGNDENEGEEVNTDAVDLLISKLRE--- 1322

Query: 1807 AKTDPSSARKRALVR 1821
             K DP   R+R   R
Sbjct: 1323 VKKDPEPLRRRKSTR 1337

 Score = 37.7 bits (86), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 68/133 (51%), Gaps = 39/133 (29%)

Query: 652 LVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVT------NVSIASAADEESNLNMA--- 702
           ++Q L+    K+++  +  S+  K LKL++SL+          I S+ DE  NL++A   
Sbjct: 452 IIQSLW----KILDSKKPYSESIKLLKLINSLLFYLIDSFQAPICSSFDE--NLDLAQNV 505

Query: 703 -------IQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQL 755
                  + +L D++Q++E+ARRA+ E   L  K+ +       L+EKL+  E+      
Sbjct: 506 DSVFQDSVNKLLDSLQSNEIARRAVTEIDDLNNKILD-------LNEKLNLVEN------ 552

Query: 756 EDELHERDHILAK 768
               + +DH++AK
Sbjct: 553 ----YSKDHLIAK 561

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  279 bits (714), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/481 (33%), Positives = 268/481 (55%), Gaps = 34/481 (7%)

Query: 1345 PRPH--KKLKQLHWEKLDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREI---K 1398
            P+P   K LKQ+HW+K+++ DN+IW    +  +   +L    +   +E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1399 SLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFL 1458
            S   K KE     +FLSRD++QQFGINLHMYS+ +  + +  VL+C  + ++  SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1459 SKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYW 1518
             K ++I +  +++RNYAPYS D+         + P KD ++L+RAD+++L+L  NL  YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1519 GSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQ 1578
              R + L ++ +YER+Y +L+ KL+K+D A+  L  S   R+   ++L +GN+MN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1579 AQGFKLSTLQRLTFIKDTTNS-MTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQ 1637
             +G K+S+L +L FIK ++N+ ++FL+++EK+IR  YP    F+ +L  V D+ KV++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1638 LVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKL 1697
            +  +C +F   + +V  SV  G LS S K HP D +L K    +  A+ K +LLKD+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1698 TIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLV 1757
            T  +   L+  YGED                  + +KK   +N+  EE ER+YE+ K ++
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1758 XXXXXXXXXXXXXXXRSASPSPEGNEEDEAEDR--RDVMDKLLEQLKNAGPAKTDPSSAR 1815
                             +    EG+  +E +D+   D +D LL +L+     K +P   R
Sbjct: 1405 ----------------ESQSKKEGDGINEEDDKSTSDAVDLLLSKLRGV-EGKPEPLRRR 1447

Query: 1816 K 1816
            +
Sbjct: 1448 R 1448

 Score = 43.1 bits (100), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 106/227 (46%), Gaps = 22/227 (9%)

Query: 540 GGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQ 599
           G +  I EY    +  IN +     N  ++  L   L+  G+  I + +K L    + +Q
Sbjct: 350 GFDKLIEEYLTTCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQ 409

Query: 600 IDLYDNNKLD-DFNVKLEANNEAF-NVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLF 657
           I +Y  +K++ D  + +  NN  F +V   + + LL       + T  E+ +  L+   F
Sbjct: 410 ISIY--SKIEQDIILSISNNNSMFIDVSYGNEIQLL---LSQSQKTPLEQPIGELLN--F 462

Query: 658 LSSSKLIEENQNSSKLTKQLK-----LMDSLVT-NVSIASAADEESNLNMAIQRLYDAMQ 711
           L+          S KL K        L+D     N ++ S    ES +  +I  L D +Q
Sbjct: 463 LNKILTSRTQSESMKLFKSFGSTLGYLLDHFYKDNDTLLSP---ESTVQNSINELMDRLQ 519

Query: 712 TDEVARRAILESRALTKKLEEIQAERDSLSE--KLSKAEHGLVGQLE 756
           +DE+ARRA+ E ++L + ++ +Q+E  SL E  +L K E  L+ QL+
Sbjct: 520 SDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGE--LIAQLK 564

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  277 bits (709), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 157/487 (32%), Positives = 270/487 (55%), Gaps = 33/487 (6%)

Query: 1346 RPHKKLKQLHWEKLDSTDNSIWG-SGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1404
            +P + LKQ+HWEKL+  + ++W    + ++   +L   G+ + +E++F  +E     TK 
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1405 KEDLQKI---TFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKT 1461
            K+  +K    +FL RD++QQFGINLHM+S  S    V KVL CD + +Q  + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1462 EIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSR 1521
            +++ V+ +L R + PYSTD+      +D   P KDP +L R D+++L+L  NL+ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1522 MRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQG 1581
               L  +T+YER+Y + + +L+K+D  +  L+     +++  +I+ +GN+MN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1582 FKLSTLQRLTFIKDTTNSMT-FLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640
             KLS+L +L F+K + +  T FL+++E+IIR+ YP+   F  +L  V D+ K+S++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700
            +C +F   I  V  +++ G LSD S+ HP D ++ K    +  A+ K DLL+D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1701 EFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXX 1760
            + + LM  +GED                    +KK   +N+  E+ +R+YE+ K ++   
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNML--- 1206

Query: 1761 XXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820
                        R+AS     N + + ED  D +D LL +L+     +  P   R+R + 
Sbjct: 1207 --------ESRQRTAS---NHNSDLQGED-EDAVDVLLAKLRG---TEEKPGLVRRRKIT 1251

Query: 1821 RKKYLSD 1827
            R  Y +D
Sbjct: 1252 R--YTAD 1256

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  275 bits (703), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/413 (36%), Positives = 236/413 (57%), Gaps = 29/413 (7%)

Query: 1350 KLKQLHWEKLDSTDNSIWG--------SGKAEKFADDLYEKGVLADLEKAFAAREIKSLA 1401
            KLKQ+HW+K+D+   ++W         S K E F       GV  ++E  F         
Sbjct: 771  KLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVVPATPKT 823

Query: 1402 TKRKEDLQ-----KITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVE 1456
                   Q     KI  LS D++Q FGINLH++S  S  +L+  VL C  + LQ   V+E
Sbjct: 824  ASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIE 883

Query: 1457 FLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLES 1516
            F SK +I  +  +  R +APY T      N    K P+KDP  L+RAD++YL+L  NL S
Sbjct: 884  FFSKDDINHIPQSTQRMFAPYET------NYLTGKTPDKDPAVLERADRIYLELFYNLRS 937

Query: 1517 YWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTS 1576
            YW +R + L V+ +YER+Y ++L KL+++D A  A++ S  L+ +F +I+ +GN+MN+  
Sbjct: 938  YWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN-- 995

Query: 1577 KQAQGFKLSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSI 1635
            KQA G +LS++ +L F K +  N+++F++ +E+IIR  YP  ++F ++LE V D+  + +
Sbjct: 996  KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIV 1055

Query: 1636 EQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEV 1695
            + +  + ++F + I N+ERS+ +G LSDSS+FHP D+ L KT   +  AR+K +LL D+ 
Sbjct: 1056 QHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQS 1115

Query: 1696 KLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEER 1748
             LT+ +FE L+  +GED+                   +KKA  +N+  EE  R
Sbjct: 1116 TLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIRR 1168

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  275 bits (702), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 163/475 (34%), Positives = 273/475 (57%), Gaps = 32/475 (6%)

Query: 1349 KKLKQLHWEKLDSTDNSIWGSGKA-EKFADDLYEKGVL---ADLEKAFAAREIKSLATKR 1404
            ++LKQ+HW+K++    +IW   +     A  L E G+L   +DL K   +   K+  T R
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKA-NTGR 977

Query: 1405 KEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEII 1464
              +   +  L RD++QQFGINLHM+S+LSV D V KVL+CDR  +   SV+EF ++ +++
Sbjct: 978  LNEEGPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1465 EVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRA 1524
             +  +L+  + PYS+D+         K P KD + L+RAD+++L L  NL SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1525 LTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1584
            L  + +YE++Y +++ KL++VD A+  ++ S  L++   +I+ +GN+MN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1585 STLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCK 1643
            S+LQ+L F+K + + +++FL+ VE+ +R+       F+ EL  VLD+  + + Q+  D +
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1644 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFE 1703
            ++ + I  V++S++ G LSDS  FHP D++LIK  P +  A RK  LL+++ KLT+   E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1704 SLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXXX 1763
            +LM+ YGED                   ++KKA  +N+  EE ER+Y   K+L+      
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELL------ 1323

Query: 1764 XXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRA 1818
                     +++S +   +EE+E     D +D L+++L++   +     S+ KRA
Sbjct: 1324 -----QQKTKASSKNDASSEEEED----DAVDILIQRLRDVNKSS---KSSTKRA 1366

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 103/213 (48%), Gaps = 12/213 (5%)

Query: 547 EYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNN 606
           +YC  ++  IN +   + ++ +++    +L+   + R+   +  L++ ++  +ID Y + 
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEIDKYKSL 407

Query: 607 KLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEE 666
           + +     ++  N  F   L   +S  K L  I   T ++  L   +  LF + SK +  
Sbjct: 408 EEE----VIQKTNPEFPQLLN--VSYGKFLTNIIHQT-HQNPLEHCMHQLFETLSKTLVA 460

Query: 667 NQNSSKLTKQLKLMDSLVTNVSIASAADEESNL----NMAIQRLYDAMQTDEVARRAILE 722
              S  L K L L  S++  +   S  +E  N+    N+++  L D +Q+DE+A+RA+ E
Sbjct: 461 RTMSDNL-KVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAMSE 519

Query: 723 SRALTKKLEEIQAERDSLSEKLSKAEHGLVGQL 755
                K++E +++E  +L +     + G++ +L
Sbjct: 520 LELAQKEIENLESEIRALRKDKEITKGGVLSEL 552

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  274 bits (701), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 273/493 (55%), Gaps = 46/493 (9%)

Query: 1343 KYPRPHKKLKQLHWEKLDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLA 1401
            K P   K+LKQ+HW+K++   +++W  + + ++   +L   G+ + +E  F  +    +A
Sbjct: 870  KPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIA 929

Query: 1402 TKR---------------KEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDR 1446
             KR                 +L+KI+FLSRD++QQFGINLHM+S LS  + V KVLNCD 
Sbjct: 930  NKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDN 989

Query: 1447 DFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQV 1506
            D +Q  ++++F  K E++ +  ++   Y PYS   +G           K  +DLQRAD++
Sbjct: 990  DIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRI 1038

Query: 1507 YLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVIL 1566
            +L+L INL  YW +R ++L  +++YER+Y +L+ KL+K+D A+  L  S   +++  +I 
Sbjct: 1039 FLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIIT 1098

Query: 1567 AVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELE 1625
             +GN MN   +  +G KL +L +L F++ + + +++FL+++EK+IR+ YP+   F+ +L+
Sbjct: 1099 EIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLK 1156

Query: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685
             + D+ K+S+E + ++C +F + I ++    ++G LS      P D+++ K    +  A+
Sbjct: 1157 NIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAK 1216

Query: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEE 1745
             K +LL  + KLT+++   LM+ YGED                    +KK   +N+  EE
Sbjct: 1217 TKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEE 1276

Query: 1746 EERLYEKHKKLVXXXXXXXXXXXXXXXRSASPSPEGNEEDEAED-RRDVMDKLLEQLKNA 1804
             ER+YE+ K L+                S++    G++E++ E   RD +D L+ +L+  
Sbjct: 1277 MERVYEQRKSLLDMRT------------SSNKKSNGSDENDGEKVNRDAVDLLISKLRE- 1323

Query: 1805 GPAKTDPSSARKR 1817
               K DP   R+R
Sbjct: 1324 --VKKDPEPLRRR 1334

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 77/155 (49%), Gaps = 35/155 (22%)

Query: 628 DPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLV--- 684
           +PL L   L    K +  E  +  ++Q L+    K+++  +  S+  K LKL++SL+   
Sbjct: 427 EPLCLENCLLLKAKDSPVEAPINEIIQSLW----KILDSQKPYSESIKLLKLINSLLFYL 482

Query: 685 -------TNVSIASAADEESNLNMAIQ----RLYDAMQTDEVARRAILESRALTKKLEEI 733
                  TN S     +   N++   Q    +L D++Q+DE+ARRA+ E       ++++
Sbjct: 483 IDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIARRAVTE-------IDDL 535

Query: 734 QAERDSLSEKLSKAEHGLVGQLEDELHERDHILAK 768
            A+   L+EKL+  E+          H++DH++AK
Sbjct: 536 NAKISHLNEKLNLVEN----------HDKDHLIAK 560

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  269 bits (688), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 247/415 (59%), Gaps = 14/415 (3%)

Query: 1349 KKLKQLHWEKLDSTDNSIW--GSGKAEKFADDLYEKGVLADLEKAFAAREI---KSLATK 1403
            KKLKQ+HW+K+++  N++W    G+ +   + L   G+   ++  F+ +++      A  
Sbjct: 857  KKLKQIHWDKIENVKNTLWDHADGRQDTILE-LEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1404 RKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEI 1463
             +E  + ++FLSRD SQQ  INLH+++ L+  ++++KVL CD D +Q  SV+EF  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1464 IEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMR 1523
            + +     R++ PYS D+     L+ ++ P K+P++L+RAD+++L L  NL  YW  R +
Sbjct: 976  VNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1524 ALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFK 1583
             L V+++YEREY ++L  L+K+D A+  ++ S+  +    +I+ +GN+MN  +K  +G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1584 LSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDC 1642
            L++L +L FIK   N + +FL++VEK++R++YP+   F+ +L  V D+ K++I+Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1643 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEF 1702
            +++   I  +  SV  G LSD ++ HP D++L K    +  A+ K +LL+ + KLT  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1703 ESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLV 1757
               M  YGED                  + ++K   +N+  EE +R YE+ KK+ 
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA 1263

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  268 bits (684), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 161/477 (33%), Positives = 267/477 (55%), Gaps = 10/477 (2%)

Query: 1346 RPHKKLKQLHWEKLDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI-----KS 1399
            +P KKLKQ+HW+K++  +++IW + +  +     L   GVL ++E  F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1400 LATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLS 1459
             AT+     + ++FLSRD++Q FGINLHM+S+LSV + VKKVL CD D ++   V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1460 KTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWG 1519
            + E+  +S +  R YAPY   +    +  +    E  P  L+R D+++L+L   L  YW 
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1520 SRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQA 1579
             R   L VV +YE++Y +++ KL+K++ A+  L+ S  L+N   +I+ +GN+MN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1580 QGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQL 1638
             G K+S+L +L FIK + N +++FL+Y+E++IR  YP+   F+ +L+ V D+ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1639 VNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLT 1698
              +C ++   I  +  +V+ G LSD +K +P D VL K       A  K  LL+ ++KL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1699 IMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVX 1758
              +   LM+ YGED                    +KK   +N+  EE +R+YE+ +KL+ 
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1759 XXXXXXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSAR 1815
                           +A  +    ++DE ED  D +DKLL++L+        P   R
Sbjct: 1284 DKQSSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKPRERR 1340

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  267 bits (682), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 237/418 (56%), Gaps = 14/418 (3%)

Query: 1346 RPHKKLKQLHWEKLDSTDNSIWGSG-KAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1404
            +P + LKQ+HWEK+D  + ++W    + E+   +L   G+   ++  F  +       K 
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1405 KEDLQKIT----FLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460
                +K T    FLSRD++QQFGINLHMYS   V + V KVL CD D LQ  SV+EF + 
Sbjct: 908  DNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFNN 967

Query: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520
             E+  +  +L+R++APYS D++      + K P  DPN+L+R D+++L+L  NL SYW  
Sbjct: 968  EELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWRE 1021

Query: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580
            R + L +  +YER+Y +L+ KL+ +D A+  ++ +  L+ +  +I+ +GN+MN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1581 GFKLSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLV 1639
            G +L++L +L+F+K +  N+++FL+++EK++R+ YP+   F  +L     +  +S + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1640 NDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTI 1699
            ++C+++   + +V R    G LS  S  HP D+++ K    +  A+ K  LL D+ KL  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1700 MEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLV 1757
             + + LM+ +GE+                    +KK   +N+  EE  R+YE+ KKL+
Sbjct: 1200 ADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLL 1257

 Score = 34.3 bits (77), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 93/210 (44%), Gaps = 27/210 (12%)

Query: 546 LEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVID-QIDLYD 604
           +++   T+  IN +     +  +++ L  +L+  G+ R    +K    +++ID QI++Y 
Sbjct: 387 IDFASTTLFLINSILQALTDKQRKLQLVKRLKENGIHRCFYLMKDNLKNEIIDEQIEIYI 446

Query: 605 NNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWG-----ICKGTEN---EKLLVSLVQHL 656
           N +                    D  SL    +G     I   T+N   E+   +L+Q +
Sbjct: 447 NTE------------HVLIAQFADKPSLADLFYGNALESIVANTKNTSLEQPFGTLIQSI 494

Query: 657 F-LSSSKLIEENQNSSKLTKQLKLM-DSLVTNVSIASAADEESNLNMAIQRLYDAMQTDE 714
             +  SK   E   S K+ K L +M   L +N+      D ES    +I  L D +++DE
Sbjct: 495 SEMLKSKTTSE---SVKVLKALIIMFQFLESNLYNNMEFDPESVFQDSINTLVDNLESDE 551

Query: 715 VARRAILESRALTKKLEEIQAERDSLSEKL 744
           +A+RA+ E   L   +  +Q E+  L EKL
Sbjct: 552 IAKRAMGEINFLQDAVRSLQEEKGQL-EKL 580

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  266 bits (680), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/414 (35%), Positives = 246/414 (59%), Gaps = 16/414 (3%)

Query: 1350 KLKQLHWEKLDSTDNSIWGS-GKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRKEDL 1408
            KLKQ+HW+KL+    +IW   G+ +  A  L   G L ++ + F  R  +SL  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1409 Q----KITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEII 1464
                 K++ L RD++QQFGINLHM+S+LSV + V KVL+CDRD +   SV+EF ++ ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1465 EVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRA 1524
             +  ++A    PY+TD +        + P  D   L+RAD+++L+L  NL SYW  R   
Sbjct: 1038 IIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1525 LTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKL 1584
            L  +++YE++Y +L+ KL++VD A+  ++ S  L++   +I+ +GN+MN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1585 STLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDCK 1643
            S+LQ+LTF+K + + +M+ L+ VE+ +R+   +   F+++L  VLD+  + + Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1644 DFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEFE 1703
            +++Q I  V++S+E G LS    FHP D++LIK  P +  A RK  LL+++  LT+   E
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1704 SLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLV 1757
            +LM+ YGED                  +++KK   +N   E  ER+Y + K+L+
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELL 1323

 Score = 36.2 bits (82), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 17/82 (20%)

Query: 696 ESNLNMAIQRLYDAMQTDEVARRAILESRA-------LTKKLEEIQAERD-------SLS 741
           ES +++++ +L D +Q+DE+A RA+ E +        L  +++ +Q ER        S  
Sbjct: 493 ESVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSEL 552

Query: 742 EKLSK---AEHGLVGQLEDELH 760
           EK+ K   A+  L+G+LE ELH
Sbjct: 553 EKIKKELFAKESLIGKLEKELH 574

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  260 bits (664), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 264/493 (53%), Gaps = 30/493 (6%)

Query: 1347 PHKKLKQLHWEKLDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAARE--IKSLATK 1403
            P K +KQ+HWEK+  T  S+W    +      +L   G+ +++E  F +++  IK    K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1404 RKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEI 1463
             +   + +T L R+++QQFGINLHM+S +S  DL +KVL CD    Q  SV+EF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1464 IEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMR 1523
              +  N+ R + PYS D++          P KD ++L R D ++L L  NL SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKT-----PGSKPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1524 ALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFK 1583
             L ++ +YE++Y +L+ KL ++D+A+ A++ S  L++V  +I+A+GNFMN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1584 LSTLQRLTFIKDTTNS-MTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDC 1642
            LS+L +LT+IK  + S  +FL+++E++IR+ YP    F  +L  V ++  V+++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1643 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEF 1702
             D S  I  V RS++ G LS+    HP D +L K    +  A  K  +L+D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1703 ESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXX 1762
            E L+  +GED                    ++K   +N+  EE +R+YE+ ++L+     
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSK-- 1376

Query: 1763 XXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALVRK 1822
                             + + ++  ED++D +D+LL++L+        P++A +R    K
Sbjct: 1377 ------------IQAQWDSSMDEIEEDQQDAVDQLLKKLRGVE----QPTTAVRRRKSSK 1420

Query: 1823 KYLSDKDSAPQLL 1835
            + L   D  P  L
Sbjct: 1421 R-LDQMDQIPSRL 1432

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  258 bits (658), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 260/475 (54%), Gaps = 28/475 (5%)

Query: 1349 KKLKQLHWEKLDSTDNSIWGSGKAEK-FADDLYEKGVLADLEKAFAAREI---KSLATKR 1404
            KKLKQ+HW +++    +IW     ++    +L   GV   ++ +F  +++   K+    +
Sbjct: 1141 KKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAK 1200

Query: 1405 KEDLQKI-TFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTEI 1463
             +D Q++ +FLSRD++QQFGINLH+++S  V +L++KVL CD D  +  +++EF +K E 
Sbjct: 1201 TKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEF 1260

Query: 1464 IEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRMR 1523
              +S ++ARNYAPY  D++            KD ++L+RAD+++L+L  NL +YW  R +
Sbjct: 1261 THISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAYWAERSQ 1314

Query: 1524 ALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFK 1583
             L ++ +YE++Y +L+ KL+++D AV  L  S   +    ++L +GNFMN   K A+G  
Sbjct: 1315 CLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAEGIL 1372

Query: 1584 LSTLQRLTFIKDT-TNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVNDC 1642
            +S+L +L FIK +  N+++FL+++EK IR  +P    F+ +L  V ++  VS++ +  +C
Sbjct: 1373 ISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMEC 1432

Query: 1643 KDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIMEF 1702
            K+F   +     +V  G LS     HP D++L K    + +A+ K + L+D+  LT    
Sbjct: 1433 KEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSI 1492

Query: 1703 ESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKLVXXXXX 1762
              +++ YGED                    +KK   +N+  EE ERLYE+ K ++     
Sbjct: 1493 VKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYML----- 1547

Query: 1763 XXXXXXXXXXRSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKR 1817
                      ++ S   + + E   E+  D +DKLL +L+     +  P   R+R
Sbjct: 1548 -----DNKLQKNNSSGDDSDLEKNTEN-DDAVDKLLLKLRG---VENKPEPLRRR 1593

 Score = 34.7 bits (78), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 702 AIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHE 761
           +I  L D + +DE+A+RA+ E   L   L ++++E +SL E+     H   G+L  EL E
Sbjct: 565 SINDLMDRLHSDEIAKRAMDEMTGLEHNLIKLKSELESLKEE----RHADTGELIKELQE 620

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  254 bits (650), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 134/421 (31%), Positives = 240/421 (57%), Gaps = 26/421 (6%)

Query: 1350 KLKQLHWEKLDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKRKEDL 1408
            +LKQ+HW+K++   +++W  + + ++   +L   G+ + +E  F  ++   +A+K+  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1409 -----------QKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEF 1457
                         ++FLSRD++QQFGINLHM+S +S  + VKKVLNCD + +   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1458 LSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESY 1517
              K E++ +  ++   Y PYS    G           K  +DLQRAD+++L+L INL SY
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLRSY 1049

Query: 1518 WGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSK 1577
            W +R ++L  +++YER+Y +L+ KL+K+D  +  L  S   +++  +I  +GN MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1578 QAQGFKLSTLQRLTFIKDTTN-SMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIE 1636
              +G KL +L +L F++ + + +++FL+++EK+IR  YP+   F+ +L+ + D+ KVS+E
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1637 QLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVK 1696
             +  +C++F   +       + G LS+     P D+++ K    +  A+ K DLL D+ K
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1697 LTIMEFESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKL 1756
            LT+++   LM+ YGED                    +KK   +N+  EE ER+YE+ K L
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1757 V 1757
            +
Sbjct: 1288 L 1288

 Score = 37.7 bits (86), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 77/156 (49%), Gaps = 28/156 (17%)

Query: 629 PLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLV---- 684
           P+ L K L    K +  E  +  +V  L+    K+++  +  S+  K L+L++SL+    
Sbjct: 430 PVCLEKCLLLKAKDSPVETPINEIVNALW----KILDSQRPYSESIKLLRLINSLLFYLI 485

Query: 685 ------TNVSIASAADEESN-------LNMAIQRLYDAMQTDEVARRAILESRALTKKLE 731
                  N S   A D+  N          +I +L D++Q+D++ARRA++E       ++
Sbjct: 486 DSFQVPLNASFDEALDQPQNTQNVDSVFQDSIDKLLDSLQSDDIARRAVIE-------ID 538

Query: 732 EIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILA 767
           ++  +  +L+E++S  E+    QL  +L E + +L+
Sbjct: 539 DLNCKISTLNERISLVENYSKDQLLTKLDESEILLS 574

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  250 bits (638), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 235/415 (56%), Gaps = 27/415 (6%)

Query: 1350 KLKQLHWEKLDSTDNSIW-GSGKAEKFADDLYEKGVLADLEKAFAAREIK------SLAT 1402
            +LKQ+HWEK++  ++++W  S + E+ A +L   G+   +   F  + IK      + A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1403 KRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSKTE 1462
            K+    Q  T L R+++QQFGINLHM+SSL   + V+KVL C+ D +   SV+EF +K E
Sbjct: 912  KK----QNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1463 IIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGSRM 1522
            +  +  +L + + PY+ +              K   +L+RAD+++ +L   L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYAENI-------------KSKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1523 RALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGF 1582
              L ++ +YE++Y +L+ KL+KVD  +  L  S   R+   +I+ +GN+MN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1583 KLSTLQRLTFIKDTT-NSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVND 1641
            ++ +L +L F+K +  N+++FL+++EKIIR+ YP+   F+ EL  + D+ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1642 CKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIME 1701
             ++F   I  +   +E G LS + +  P D++L KT   +  A+ K +L++ ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1702 FESLMQTYGEDSGXXXXXXXXXXXXXXXXNEYKKAQAQNLAGEEEERLYEKHKKL 1756
            +  +M+ +GED+                   +KK   +N+  EE ER+YE+ +K+
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKM 1247

 Score = 42.0 bits (97), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 108/230 (46%), Gaps = 32/230 (13%)

Query: 545 ILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYD 604
           I EY    M  IN +       N++  +  KL++  + ++  ++  LD   + +QI  Y 
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 605 NNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGIC--------KGTENEKLLVSLVQHL 656
            N   D N++L+  NE       +PLS+    +G          K T  E+ + +L    
Sbjct: 383 KN---DENIRLKIINE-------NPLSIPDISYGATLMLLIEKSKSTPLEEPIGAL---- 428

Query: 657 FLSSSKLIEENQNSSKLTKQLKLMDSLVTNV------SIASAADEES---NLNMAIQRLY 707
            L S   I + +  S+  K    + SL+T +      +I+SA +  S    L  +I+RL 
Sbjct: 429 -LDSVLKILDTRTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLI 487

Query: 708 DAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLED 757
           D +++DEVARRA+ E R     ++++  E  +L  + + ++  ++ QLE+
Sbjct: 488 DNLESDEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLEE 537

>KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {ON}
            Anc_6.223 YGL064C
          Length = 540

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 9/112 (8%)

Query: 1345 PRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSLATKR 1404
            PR HK  K+L ++ +DST N   GS K +  A  LY     ++ E     R I  +   +
Sbjct: 324  PRLHKLPKKLDFKIVDSTLNPFKGS-KIKTLAQILYAVA-HSETEPGLEKRTI--VFVNK 379

Query: 1405 KEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVE 1456
            K D++KI    + +  ++G + H++  L+  D V+K L   RDFLQ P  +E
Sbjct: 380  KSDVEKIV---QVLKSEYG-HEHVF-GLTGSDTVEKRLETIRDFLQPPKRLE 426

>KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly
           similar to uniprot|Q08920 Saccharomyces cerevisiae
           YPL178W CBC2 Small subunit of the heterodimeric cap
           binding complex that also contains Sto1p component of
           the spliceosomal commitment complex interacts with Npl3p
           possibly to package mRNA for export from the nucleus
           contains an RNA-binding motif
          Length = 200

 Score = 35.0 bits (79), Expect = 0.97,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 916 NFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRL 970
           N+L +    + N L DLRR++    +   N+S +  EE++ ELF+  KS  +KR+
Sbjct: 23  NYLMKKARRNPNGLEDLRRSMRSATIYVGNLSFYTSEEQIYELFS--KSGVIKRI 75

>CAGL0C04917g Chr3 (457506..460847) [3342 bp, 1113 aa] {ON} highly
            similar to uniprot|P03965 Saccharomyces cerevisiae
            YJR109c CPA2
          Length = 1113

 Score = 35.0 bits (79), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 10/113 (8%)

Query: 1519 GSRMRALTVVTSYEREYNELLAK-LRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSK 1577
            GS M+++  V +  R Y E   K LR+VD ++   QGSD   +  + +LA     N T +
Sbjct: 391  GSAMKSVGEVMAIGRNYEEAFQKALRQVDPSIIGFQGSDEFGDQLDDVLA-----NPTDR 445

Query: 1578 QAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDV 1630
            +      +  Q L F   + + +  L+ ++K       N  +  KEL  ++D+
Sbjct: 446  RI----FAVGQALIFENYSVDKVHDLSKIDKWFLYKCMNIVNIYKELMKLVDI 494

>Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {ON}
           YPL178W (CBC2) - Small subunit of the nuclear cap
           binding complex [contig 31] FULL
          Length = 201

 Score = 33.5 bits (75), Expect = 3.9,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 916 NFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRL 970
           N+L +    + + L DLRR++    +   N+S +  EE++ ELF+  KS  +KR+
Sbjct: 23  NYLMKKARRNPDGLEDLRRSMRSATIYVGNLSFYTSEEQIYELFS--KSGVIKRI 75

>CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar to
           uniprot|Q08920 Saccharomyces cerevisiae YPL178w SAE1
          Length = 236

 Score = 33.1 bits (74), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 917 FLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNE 961
           +L R    + N LNDLR++L    +   N+S +  EE++ ELF++
Sbjct: 24  YLLRKARRNPNGLNDLRQSLKSSTIYVGNLSFYTSEEQIYELFSK 68

>NCAS0H00410 Chr8 complement(73436..76789) [3354 bp, 1117 aa] {ON}
            Anc_7.494
          Length = 1117

 Score = 33.5 bits (75), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 58/139 (41%), Gaps = 21/139 (15%)

Query: 1490 AKPPEKDPNDLQRADQVYLQLMINLESYWGSRMRALTVVTSYEREYNELLAK-LRKVDKA 1548
            AK P+ D +  Q  D+             GS M+++  V +  R Y E   K LR+VD +
Sbjct: 374  AKIPKWDLSKFQYVDRSI-----------GSSMKSVGEVMAIGRNYEEAFQKALRQVDPS 422

Query: 1549 VGALQGSDNLRNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEK 1608
            V   QGSD   +  +  LAV      T ++     L+  Q L     T + +  L  ++K
Sbjct: 423  VLGFQGSDEFGDKLDDALAV-----PTDRRV----LAIGQALIHENYTVDRVHDLTKIDK 473

Query: 1609 IIRLNYPNFNDFLKELEPV 1627
                   N  +  KELE V
Sbjct: 474  WFLFKCMNLVNMYKELEAV 492

>Skud_4.659 Chr4 (1166725..1168611) [1887 bp, 628 aa] {ON} YDR386W
           (REAL)
          Length = 628

 Score = 33.1 bits (74), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 6/60 (10%)

Query: 67  FRNLNGPSRTTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQ--HARSHSVQSKYS 124
           F++L+ P R  +     L K   L+TQN+S Y   ++S   PISS   +A+S +V+ +Y+
Sbjct: 277 FQDLSTPQRRQN----ELRKDERLHTQNISSYAMKEVSGSQPISSTELNAKSKTVRRRYN 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 175,977,246
Number of extensions: 7435284
Number of successful extensions: 25276
Number of sequences better than 10.0: 177
Number of HSP's gapped: 25877
Number of HSP's successfully gapped: 251
Length of query: 1946
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1821
Effective length of database: 39,148,149
Effective search space: 71288779329
Effective search space used: 71288779329
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 74 (33.1 bits)