Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.681.81ON75275232940.0
Suva_14.701.81ON75175625780.0
YNL272C (SEC2)1.81ON75976025020.0
Smik_14.651.81ON79056524230.0
NDAI0F042301.81ON70153314590.0
KAFR0D039601.81ON66451914360.0
NCAS0A005801.81ON68952114360.0
SAKL0C02596g1.81ON73451814350.0
CAGL0J08228g1.81ON75251213521e-176
TDEL0C062001.81ON70051513431e-175
Kpol_2000.671.81ON82452213431e-174
KLTH0F02354g1.81ON73353412721e-164
Kwal_33.133891.81ON69453812401e-160
ZYRO0F16698g1.81ON77954612441e-160
Ecym_10851.81ON70551112321e-159
AFR670W1.81ON71751812311e-158
KLLA0C02299g1.81ON65851212051e-155
TPHA0B045001.81ON73352012041e-154
TBLA0A054301.81ON79553812011e-153
KNAG0F004601.81ON65451811741e-151
KLTH0D04906g2.452ON36272850.12
Kwal_26.76492.452ON36284810.40
Ecym_83744.46ON914121725.3
YML048W (GSF2)1.496ON40394716.9
Skud_16.1168.693ON21143697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.68
         (752 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...  1273   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   997   0.0  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   968   0.0  
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   937   0.0  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   566   0.0  
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   557   0.0  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   557   0.0  
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   557   0.0  
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   525   e-176
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   521   e-175
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   521   e-174
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   494   e-164
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   482   e-160
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   483   e-160
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   479   e-159
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   478   e-158
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   468   e-155
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   468   e-154
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   467   e-153
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   456   e-151
KLTH0D04906g Chr4 complement(446504..447592) [1089 bp, 362 aa] {...    37   0.12 
Kwal_26.7649 s26 complement(458267..459355) [1089 bp, 362 aa] {O...    36   0.40 
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    32   5.3  
YML048W Chr13 (178426..179637) [1212 bp, 403 aa] {ON}  GSF2ER lo...    32   6.9  
Skud_16.116 Chr16 (208753..209388) [636 bp, 211 aa] {ON} YPL166W...    31   7.4  

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score = 1273 bits (3294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/752 (84%), Positives = 636/752 (84%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN
Sbjct: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
           TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR
Sbjct: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           REKYAIEILNKRLTEQLREKDV              VMHSLDNESTVTNNSNRY      
Sbjct: 121 REKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSD 180

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                   LNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK
Sbjct: 181 SATSSSTSLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300

Query: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360
           GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD
Sbjct: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420
           DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT
Sbjct: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420

Query: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480
           QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL
Sbjct: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVXXXXXXXXXXXAISVRLQDKTLWKKNKGA 540
           QLCKLRCILHWTHIGIWAVDDSISSKIGPLV           AISVRLQDKTLWKKNKGA
Sbjct: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSDDNQNDAISVRLQDKTLWKKNKGA 540

Query: 541 PXXXXXXXXXXXXDTFDFESEDTENEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 600
           P            DTFDFESEDTENEK                                H
Sbjct: 541 PSSSSSADESQKSDTFDFESEDTENEKTGESSSDGLSTDGSSTDESSTEESSSTVSTTSH 600

Query: 601 GNSEDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRKKSKRKASQHEIXXXXXXX 660
           GNSEDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRKKSKRKASQHEI       
Sbjct: 601 GNSEDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRKKSKRKASQHEIQKKKLLQ 660

Query: 661 XXXXXXXXFREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNLAISD 720
                   FREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNLAISD
Sbjct: 661 DLDELEEQFREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNLAISD 720

Query: 721 KHQEQIRENXXXXXXXXXXXXXXXXXXAQEQQ 752
           KHQEQIREN                  AQEQQ
Sbjct: 721 KHQEQIRENSPSSALHASSSNDDNFDDAQEQQ 752

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/756 (67%), Positives = 565/756 (74%), Gaps = 9/756 (1%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           M+ASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIA QKAAI+NYN+L+TD++
Sbjct: 1   MEASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYD 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
           TLKKTL ERD+EV KL+ +IAKETQLRTKAEDE+DKLNREVEDLTASLFDEAN MVADAR
Sbjct: 61  TLKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADAR 120

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           +EKYAIEILNKRLTEQLREKD               VMHSLDNESTVTNNS RY      
Sbjct: 121 KEKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSD 180

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                   LNKVPT NSF SQD+YSGIVYSPTISSIRYD +LYNEFLKFVAALP CENIK
Sbjct: 181 SATSSSTSLNKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDG+V+VEPLSGVNATY I
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360
           GYNSSSPVKQ+  NMPKMFKFPL+SPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD
Sbjct: 301 GYNSSSPVKQAAPNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420
           DGTE VTNTYPLCHWCLLK+RQTCEIFAFLRSLKVGAWHLEK+ MQNI KGDL +FSEVT
Sbjct: 361 DGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDLERFSEVT 420

Query: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480
           +RTK + RVS HDK +KRLSFMAGLGINS+ KSKP++EV SSE+  KPG PTTNIQRAW+
Sbjct: 421 KRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRVEVPSSEMTVKPGHPTTNIQRAWI 480

Query: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVXXXXXXXXXXXAISVRLQDKTLWKKNKGA 540
           QLCKLRCILHW+HIGIWAVDDSISSKIGP V            I VRLQDK+LWKKN   
Sbjct: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDEGTDEGQNDTIPVRLQDKSLWKKNADT 540

Query: 541 PXXXXXXXXXXXXDTFDFESEDTENEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 600
           P            DTFDFES+DTE+                                   
Sbjct: 541 PLSSSSTDESQKSDTFDFESDDTED-----GTTDESPTGVSSTDASSSAASSSAATTTSD 595

Query: 601 GNS---EDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDG-VRKKSKRKASQHEIXXX 656
           GNS   E+L +NEGDDTVT  DE S+ S K   E  + T+D  V++K KRKASQ ++   
Sbjct: 596 GNSSAAEELGQNEGDDTVTKDDESSSKSIKNLNEESDTTNDKKVQEKPKRKASQRKLQKK 655

Query: 657 XXXXXXXXXXXXFREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNL 716
                       FREESA+ QDE KSSDDV+          + ++D   +E LS +ES L
Sbjct: 656 KLLKDLDDLEEQFREESADVQDELKSSDDVKTQVVSPDNTISAEKDAGIDEHLSNKESKL 715

Query: 717 AISDKHQEQIRENXXXXXXXXXXXXXXXXXXAQEQQ 752
           ++++KH+EQI EN                  AQEQQ
Sbjct: 716 SVNNKHKEQINENSPASGLHASSSNDDNFDDAQEQQ 751

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/760 (66%), Positives = 553/760 (72%), Gaps = 9/760 (1%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           MDASEEAKR+SIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQL+ D+N
Sbjct: 1   MDASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYN 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
           TLK+ LS+RDDEVK+L EDIAKE +LRTKAE+E DKLN+EVEDLTASLFDEAN MVADAR
Sbjct: 61  TLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           +EKYAIEILNKRLTEQLREKD               VMHSLDNESTVTNNSNRY      
Sbjct: 121 KEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSD 180

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                   LNKVPT  S ASQD+YSGIVYSP+ISSIRYDISLYNEFLKFVAALP+CENIK
Sbjct: 181 SATSSSTSLNKVPTSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
           ATS+ESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLV+VEPLSGVNATY I
Sbjct: 241 ATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360
           GYNSSSP KQ+T+NMPKMFKFPL+SPPVAVHAACSFCGESRDDIIEHARMY+LKTLHK D
Sbjct: 301 GYNSSSPAKQATSNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKTD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420
           DG EQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKL  QNI K DL KFSEVT
Sbjct: 361 DGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDLEKFSEVT 420

Query: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480
           + TK + RVSS DKK+KRLSFMAGLGINS+ K+KPKME+FSSE NAKPGQPTTNIQRAWL
Sbjct: 421 KHTKRDGRVSSQDKKTKRLSFMAGLGINSSTKNKPKMEIFSSETNAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVXXXXXXXXXXXAISVRLQDKTLWKKNKGA 540
           QLCKLRCILHWTHIGIWAVDDSISSKIGPLV           AISVRLQDK LWK++   
Sbjct: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLV-EDDSDEDQNDAISVRLQDKALWKQDAKR 539

Query: 541 PXXXXXXXXXXXXDTFDFESEDTENE--------KXXXXXXXXXXXXXXXXXXXXXXXXX 592
           P            D FDFES D ENE        +                         
Sbjct: 540 PFSSSSAEESQKSDAFDFESGDMENEITGESSSDESSSDGSSTDNSTADSSSEDESSLAD 599

Query: 593 XXXXXXXHGNSEDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRKKSKRKASQHE 652
                    + E +D  EGDDTVT  D+ S  S    +E+ +  D   R   K+KA Q +
Sbjct: 600 STTSSADSSSPESIDNGEGDDTVTKDDKSSIKSANNNEENSDCGDKKGRSIIKKKAPQRK 659

Query: 653 IXXXXXXXXXXXXXXXFREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIE 712
           I               FREESA +Q E ++++   K     K+  +  E+ +K+ +    
Sbjct: 660 IQKKKLLQDLDDLEEQFREESAIDQTEFENAESNVKQNISSKRASSGDENSKKDNNEKTL 719

Query: 713 ESNLAISDKHQEQIRENXXXXXXXXXXXXXXXXXXAQEQQ 752
           ++NL I DK QEQI EN                  AQEQQ
Sbjct: 720 KTNLTIGDKTQEQIGENSPSSGLHASSSNDDNFDDAQEQQ 759

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/565 (79%), Positives = 484/565 (85%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           MDASEEAKRIS+QVTSLSTQLIESVDKQSHLEEQLNKSLKTI+SQK AI NYN+L+TD+ 
Sbjct: 1   MDASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYE 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
            LK+T+ E+DDEV KL ED+ KE +LRTKAEDENDKLN+EVEDLTASLFDEAN MV+DAR
Sbjct: 61  ALKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDAR 120

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           +EKYAIEILNKRLTEQLREKD               VMHSLDNES VTN+SNRY      
Sbjct: 121 KEKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILND 180

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                   LNKVPTLNS ASQDMYSGIVYSP+ISSIRYD+SLYNEFLKFVAALP C+NIK
Sbjct: 181 SATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIK 240

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
           ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLV++EPLSGVNATY I
Sbjct: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQI 300

Query: 301 GYNSSSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360
           GYNSSSPVKQ+T NMP+MFKFPL+SPPVAVHAACSFCGESRDDIIEHARMY+LKTLHKAD
Sbjct: 301 GYNSSSPVKQATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKTLHKAD 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVT 420
           DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKL  Q+I KGDL KFSEVT
Sbjct: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGKFSEVT 420

Query: 421 QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWL 480
           +RTKT+ RVSS DKK+KRLSFMAGLGINS++KSK KMEVFSSE NAKPGQPTTNIQRAWL
Sbjct: 421 KRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQPTTNIQRAWL 480

Query: 481 QLCKLRCILHWTHIGIWAVDDSISSKIGPLVXXXXXXXXXXXAISVRLQDKTLWKKNKGA 540
           QLCKLRCILHW+HIGIWAVDDSISSKIGP V           +ISVRLQDK LWKK+ G 
Sbjct: 481 QLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSDENRDDSISVRLQDKALWKKSTGK 540

Query: 541 PXXXXXXXXXXXXDTFDFESEDTEN 565
                        DTFDFESE+ E+
Sbjct: 541 CSSSSSPGEGPKSDTFDFESEEIES 565

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 78/156 (50%), Gaps = 3/156 (1%)

Query: 600 HGNS---EDLDRNEGDDTVTNYDERSTNSTKKKKESVNKTDDGVRKKSKRKASQHEIXXX 656
           HG+S   E+L  +EGDDT+T  D+ S  S K  +E+ N  D+  +   KRKA++H +   
Sbjct: 635 HGDSTPPENLHEDEGDDTITKDDKSSIKSIKNNEENSNSDDEKRKNIPKRKAARHRLQKE 694

Query: 657 XXXXXXXXXXXXFREESANNQDEPKSSDDVEKHTEFLKKPFATKEDVRKNEDLSIEESNL 716
                       F EESA NQ EP++ DD+ K  E  +K     ++   +   S +E NL
Sbjct: 695 KLLQDLDHLEEQFMEESAINQKEPEAFDDIVKQIESSEKASTADKNFAIDNLQSTKEQNL 754

Query: 717 AISDKHQEQIRENXXXXXXXXXXXXXXXXXXAQEQQ 752
            IS+KH+EQIREN                  AQEQQ
Sbjct: 755 TISNKHKEQIRENSPSSGLHASSSNDDNFDDAQEQQ 790

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/533 (54%), Positives = 372/533 (69%), Gaps = 30/533 (5%)

Query: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61
           + SEE+KRISIQV+SLSTQLIES+ KQS LEE+LN++ +TI SQK ++E  + LE     
Sbjct: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62

Query: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121
           L+++L+ R +EV KL E + +E +LR  AE E +KL++EVEDLTA+LFDEAN MVADAR+
Sbjct: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122

Query: 122 EKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXX 181
           E +A EILN RL  QLREKD               V+ +++ E+      NRY       
Sbjct: 123 EAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETEN------NRYSMILPDS 176

Query: 182 XXXXXXXLNKVPTL--NSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENI 239
                  L+KV T   +SF+ Q M +GI+YSP ISSIRYD+SLY EFLKF+A +P C++I
Sbjct: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236

Query: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYH 299
           K TSS+SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++GLVIVEPLSG+N  Y 
Sbjct: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296

Query: 300 IGYNSSSPVKQSTA-------NMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352
           +G+ ++ P+  +T         +PKMFKFP +SPPVAV   C+FCGE R+DIIEHARMY+
Sbjct: 297 MGH-TTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYL 355

Query: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD 412
           LKT    DDGT  + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEK+ +  I+K  
Sbjct: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415

Query: 413 LVKFSEVTQRTKTEDRVS------SHDKKSKRLSFMAGLGINSTAK-SKPKMEVFSSEIN 465
             KFSEVT       + +      S +KKSKR+SFMAGLG   ++K +  ++E   +  N
Sbjct: 416 SSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNN 475

Query: 466 AKP-------GQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
                     GQPTTNIQRAWLQLCKLR ILHW HIGIW+VDDS+S+K+GP V
Sbjct: 476 NNTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/519 (54%), Positives = 374/519 (72%), Gaps = 22/519 (4%)

Query: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIA-SQKAAIENYNQLETDHN 60
           D +EE  RIS QVTSLSTQL+ES+ ++S LEE+L K LK +A SQ+ +I  Y+ L+ D++
Sbjct: 3   DLAEENNRISAQVTSLSTQLMESIQRESELEEKL-KHLKKVALSQEGSIAKYDILKADYD 61

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
            LK T+SER+ E++ L  ++ +E++LR+ AE E   L++EVEDLTASLF EAN MVADAR
Sbjct: 62  KLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADAR 121

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           REK+  EILN +L EQLREKD               V+ + ++E+ VTN ++        
Sbjct: 122 REKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDEN-VTNKASSIAPDFLG 180

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                        +L++        G VYSP IS+IRYD++LYNEFLKF+A LP C+N+K
Sbjct: 181 SEQKSASA-----SLSNEVGDPSNKG-VYSPYISTIRYDLALYNEFLKFIAVLPYCKNLK 234

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
            TSSESKL+RRL+NDEIQPIL+ID+A+GIGWL KK++L+L+IDGLV++EPLSGVN  Y +
Sbjct: 235 DTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQL 294

Query: 301 GYNSSSPVKQSTANMPKM--------FKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352
           G+ SSS      +N P M        F +P +SPPVAVH  CSFCGE+RDDI+EHARM+V
Sbjct: 295 GHVSSS----DQSNRPSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHV 350

Query: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD 412
           LKT  K++DG+  VTN+YPLC WCL K+RQTCEIFAFLRSLK+G W+LEK+ + +IAKG+
Sbjct: 351 LKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGE 410

Query: 413 LVKFSEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPT 472
             KF+EVT+  K+     S +KK KR SFM GLGIN+++   P++EV +S I    GQPT
Sbjct: 411 SNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTI-GNAGQPT 469

Query: 473 TNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           TNIQRAW+QLCKLR +LHWT++GIW+VD+SIS KIGP V
Sbjct: 470 TNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQV 508

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/521 (55%), Positives = 375/521 (71%), Gaps = 24/521 (4%)

Query: 4   SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLK 63
           SEE+KRIS QVT+LSTQLIES+DKQS LEE+LN + K IASQ+ +++ Y+ L+ +   LK
Sbjct: 5   SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEKLK 64

Query: 64  KTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREK 123
            +  ++  E+      I +E +LR  AE E +KL++EVEDLTA+LFDEAN MVADAR++K
Sbjct: 65  ISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARKDK 124

Query: 124 YAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXX--XXX 181
           Y +E+LN +L EQL EKD               V+ ++++E+     +NRY         
Sbjct: 125 YTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQPDSAT 184

Query: 182 XXXXXXXLNKVPTLNSFASQD---MYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCEN 238
                  L K+ T  S  SQ+   M +GI+YSP ISSIRYD+ LY EFLKF+A +P C  
Sbjct: 185 TSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVIPHCRT 244

Query: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATY 298
           IK TSS+SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++GLV+VEPLSGVN T+
Sbjct: 245 IKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNETF 304

Query: 299 HIGYNSSSP------VKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352
            +G ++  P        +S ++MPK+FKFPL SPP+A+H  CSFCGESRDDIIEHARMYV
Sbjct: 305 QMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYV 364

Query: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD 412
           LKT +K +DGT  VTNT+PLCHWCL K+RQTCEIFAFLRSLK G W+LEK+ M++I+  D
Sbjct: 365 LKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSISSKD 424

Query: 413 LVKFSEVT---QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSS-EINAKP 468
             +FS VT   ++TKTEDR      +SKR+SF+ GL  NS+A +  ++E  +S EI    
Sbjct: 425 SSRFSVVTSAIRQTKTEDR------RSKRMSFIGGLTKNSSAINTAQVESTTSMEIT--- 475

Query: 469 GQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGP 509
           G PTTNIQRAW+QLCKLR ILHW H+GIW++DDSI+SKIGP
Sbjct: 476 GLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGP 516

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 355/518 (68%), Gaps = 10/518 (1%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           M   EE+KR+S+Q++SLSTQLIESVDKQS LEEQL K+ KTIASQ  +  +Y  L     
Sbjct: 1   MSDQEESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLE 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
             ++ L+ R  E  +L   +A ET  R  A+D+ D+LN+EVEDLTASLFDEAN MVADAR
Sbjct: 61  KAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADAR 120

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNE-STVTNNSNRYXXXXX 179
           REK+ +E+ N +L EQL EKD               V++SL++E S++            
Sbjct: 121 REKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSS 180

Query: 180 XXXXXXXXXLNKVPTLN-SFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCEN 238
                    L K  T   S        G+++SP + S+RYD+ LYNEFLKFVA LP C +
Sbjct: 181 DTATSSNVSLEKTATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPICRS 240

Query: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATY 298
           IK T++ESKL+RRL++DEIQP+L++DNASG+GWLV+++L+SL+IDGLV+VEPLSGVN TY
Sbjct: 241 IKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNETY 300

Query: 299 HIGYNSSSPVKQSTANMPK-----MFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVL 353
            +GY+S     Q  A+  +     ++ +P +SPPVA+H AC+FC ESR+DI+EH R+YVL
Sbjct: 301 RMGYSSPQLHAQQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLYVL 360

Query: 354 KTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDL 413
           KTL + +DGT + TN YPLCH+CLLK+RQTCEIFAFLRSLK G WHLEK+ + +IA G  
Sbjct: 361 KTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATGGS 420

Query: 414 VKFSEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTT 473
            KFSEVT+   T    +  D KSKR+SFMAGL   ST K  P +E  +     + GQP T
Sbjct: 421 SKFSEVTKTPHTS--AAKEDAKSKRMSFMAGLSRPSTTKLMPTVE-GAPNFAGQSGQPVT 477

Query: 474 NIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           NIQRAW QLCKLR  LHW HIG+W+++DS++ +IGPL+
Sbjct: 478 NIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLM 515

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  525 bits (1352), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 260/512 (50%), Positives = 346/512 (67%), Gaps = 8/512 (1%)

Query: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61
           D  EE+ RIS+QV++LSTQLIES+D+QS LE++L  +   I  QK  +  +  L+  +  
Sbjct: 3   DPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKNKE 62

Query: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121
           L       +++++ L   + +E   R  AE E DKL +EVEDLTASLFDEAN MV+DARR
Sbjct: 63  LSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDARR 122

Query: 122 EKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXX 181
           EK+ IEI N RL E L+EKD               V+ ++D+ES++  N+N         
Sbjct: 123 EKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSI--NANIRSPISTEN 180

Query: 182 XXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKA 241
                   NK+    S  S       ++SP ++++RYD SLYNEFLKF+A LP   ++KA
Sbjct: 181 STTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSSLKA 240

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIG 301
           TS+ESKL++RLV+DEIQP+LKIDNASGIGWLV+K+LL+ +++G V+VEPLSG+N  Y +G
Sbjct: 241 TSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAYQLG 300

Query: 302 YNSSSPVKQSTAN-MPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKAD 360
           Y +   V Q+    MP MF FPLNSPP+AV   C+FC E RDDIIEHARMYV+KT +K +
Sbjct: 301 YETKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMYVMKTFNKEN 360

Query: 361 DGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD-LVKFSEV 419
           DG+  +TN++PLCHWCL+K+RQTCEIFAFLRSLK+G WHLEK+ +  I+KG+ L KFSEV
Sbjct: 361 DGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKGESLSKFSEV 420

Query: 420 TQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAW 479
           T+ T      S+ +KKS R SF+  L   S  KS P +E        K GQPT+NIQRAW
Sbjct: 421 TKSTN--GSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVETHID--TTKAGQPTSNIQRAW 476

Query: 480 LQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           + LCKLR +LHW H+GIW ++DSIS K+GP+ 
Sbjct: 477 VHLCKLRSMLHWAHVGIWNMEDSISLKMGPIT 508

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  521 bits (1343), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 263/515 (51%), Positives = 362/515 (70%), Gaps = 24/515 (4%)

Query: 5   EEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLKK 64
           EE++R+S+Q++SLSTQLIES+DKQ  LEEQLN++ +TI SQ+ ++++YN L++  + ++ 
Sbjct: 6   EESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKFDGVES 65

Query: 65  TLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREKY 124
           +L  ++  +++L E++ KE  LRT AE   D LN+E+EDLTASLFDEAN MVA AR+E Y
Sbjct: 66  SLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATARKESY 125

Query: 125 AIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXXXXX 184
            IEI N +L EQL EKD+              V+ +L+ EST   +S             
Sbjct: 126 TIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTT--HSGSRSSFVGNDNST 183

Query: 185 XXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKATSS 244
               LNK  T N   S ++  G +YSP I+S+RYD++LY EFLKF+A LP CE +K TSS
Sbjct: 184 SSISLNKTSTSN---SDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCETLKDTSS 240

Query: 245 ESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIGYNS 304
           +SKL+RRLVNDEIQP L++DNASG+GW+V++TL+SL+++GLV+VEPLSG+N  +  GY  
Sbjct: 241 DSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENFQYGY-- 298

Query: 305 SSPVKQSTANMPKM-------FKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLH 357
           +SPV  S++  P M       F +P +SPP+AVH  CSFC E+RDD+IEHARMYVLKT  
Sbjct: 299 TSPVLPSSSFNPSMGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYVLKTQT 358

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFS 417
           + +DG+  VTN++PLC +CLLK+RQTCEIFAFLRSLK+GAW+LEK+ +  IAKG+  +FS
Sbjct: 359 RIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGESSEFS 418

Query: 418 EVTQRTKTEDRVSSHDKKSKRLSFMAGL-GINSTAKSKPKMEVFSSEINAKPGQPTTNIQ 476
           +V+             K+ KRL  M+ + G N ++K  P++++   +I    G PTTNIQ
Sbjct: 419 QVSNGNH-----KGPQKEEKRLQRMSLITGKNQSSKLAPQVDIPVDQI----GAPTTNIQ 469

Query: 477 RAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           RAWLQLCKLR  LHW HIGIW+V+D+++ KIGP V
Sbjct: 470 RAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFV 504

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  521 bits (1343), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/522 (49%), Positives = 355/522 (68%), Gaps = 18/522 (3%)

Query: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61
           D+S+E+KR SIQ+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AIE YN L+  ++ 
Sbjct: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62

Query: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121
           L K  +    ++ KL  +  +E +LR  AE + D+LN+EVE+LTASLFDEAN MVADARR
Sbjct: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122

Query: 122 EKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXX 181
               I+I N++L E L EKD               V+H L N+      SNR        
Sbjct: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLISTTS 182

Query: 182 XXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKA 241
                  L K  T NS  + D+ S  +Y+P + ++RYD+ LYNEFLKF+A LP CE+IK 
Sbjct: 183 ASSSSVSLKKTITSNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242

Query: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIG 301
           T+SESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+GLV++EPLSGVN  Y   
Sbjct: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR-- 300

Query: 302 YNSSSPVKQSTANM-PKM-------FKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVL 353
           ++SS+PV    +N  PK+       FK+P NSPP+AVH  C+FCGE+R+D++EHARMY+L
Sbjct: 301 FSSSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML 360

Query: 354 KTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDL 413
           KT  K +D T  +TN +PLC  CL+K+RQTCEIFAFLRSLK+GAW+LEK+ +  IAKGD 
Sbjct: 361 KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS 420

Query: 414 VKFSEVT------QRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAK 467
            KFS VT       ++K E++  S  K  KR S MAG GI+S + +       S  +  +
Sbjct: 421 KKFSSVTAATSSISKSKIEEKFDS--KLMKRRSIMAGFGISSISNTTTTKSETSVGVVDQ 478

Query: 468 PGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGP 509
            G PTTNIQRAW+ L KLR +LHW HIGIW  D+++++K+ P
Sbjct: 479 SGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP 520

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  494 bits (1272), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 257/534 (48%), Positives = 355/534 (66%), Gaps = 39/534 (7%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENY----NQLE 56
           M   EE+KR+S+QV+SLSTQLIES+DKQSHLEEQL ++ K IASQ+ +++NY     QLE
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLE 60

Query: 57  TDHNTLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMV 116
              + LK   SER   + K+ E++      +  AE E D+LN+EVEDLTASLFDEAN MV
Sbjct: 61  QAESNLK---SERSQNI-KIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMV 116

Query: 117 ADARREKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXX 176
           ADARRE +++++ N +L EQL+EK+               V+++L+ ES     SN+   
Sbjct: 117 ADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASV 176

Query: 177 XXX-XXXXXXXXXLNK-VPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALP 234
                        L K +  LN  AS    S  ++SP + S+RYD+ LYNEFLKF+AALP
Sbjct: 177 AAEDSVASSSESALEKTMNALNGTASPP--SPALFSPLLKSLRYDLVLYNEFLKFIAALP 234

Query: 235 QCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGV 294
           QC +I+ ++S SKL+RRL++DEIQP+L++DNASGIGW +++ L+SL+IDG ++VEP+SG+
Sbjct: 235 QCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGI 294

Query: 295 NATYHIGYNSS---------SPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDII 345
           N TY +G+ SS          P +QS    P ++ +P +SPPVA+ + CSFC ESR+DI+
Sbjct: 295 NETYRVGHMSSQVEAVPQFQGPEQQS---RPHLYNYPADSPPVAIESPCSFCSESRNDIL 351

Query: 346 EHARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVM 405
           EH R+YVLKTL K ++G  + ++ +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE + +
Sbjct: 352 EHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTI 411

Query: 406 QNIAKGDLVKFSEVTQRTKTE---DRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSS 462
                   V+ + V+     E   D++   D+KSKR+SFMAGL     +K+ P    ++ 
Sbjct: 412 SKTNNAFSVQTNSVSNSPTLESPPDKMKP-DRKSKRMSFMAGL-----SKTLPLKTSYTV 465

Query: 463 EINAKP-----GQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           E +A P       PTTNIQRAW QLCKLR  LHW HIGIW ++D + +K+GP+V
Sbjct: 466 E-SASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV 518

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  482 bits (1240), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/538 (46%), Positives = 353/538 (65%), Gaps = 45/538 (8%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           M   EE+KR+S+QV+SLSTQLIES+DKQSHLEEQL ++ K I+SQ+ A+++Y        
Sbjct: 1   MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYE------- 53

Query: 61  TLKKTLSERDDEVKKLHEDIAKE------TQLRTKA-EDENDKLNREVEDLTASLFDEAN 113
           ++ K L E + E++ +    AK+       Q  T+A +DE  +LN+EVE+LTASLFDEAN
Sbjct: 54  SVGKRLEETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEAN 113

Query: 114 TMVADARREKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNR 173
            MVADAR+E ++I++ N +LTEQL+EK                V++ L+ ES     SNR
Sbjct: 114 NMVADARKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNR 173

Query: 174 YXXXXXXXXXXXXXXL---NKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFV 230
                          +   N +  LN  A     + +++SP + S+RYD++LYNEFLKF+
Sbjct: 174 SPVMDTSDNSTVSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFI 231

Query: 231 AALPQCENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEP 290
           AALP   +IK T+SESKL+RRLV+DEIQP+L++DNASG+GW  K++L++L++DGLV+VEP
Sbjct: 232 AALPTSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEP 291

Query: 291 LSGVNATYHIGYNSSSPVKQSTANMPK--------MFKFPLNSPPVAVHAACSFCGESRD 342
           +SG+N TY + +  +S V+ +    P+        ++ +P +SPPVA+   CSFC ESR+
Sbjct: 292 VSGINETYRVSH--ASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRN 349

Query: 343 DIIEHARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEK 402
           DI+EH R+YVL+TL K ++GT +V + +PLCH+CLLK+RQTCEIFAFLRSLK GAWHLE 
Sbjct: 350 DILEHGRLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLES 409

Query: 403 LVMQNIAKGDLVKF---SEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEV 459
           + +   ++    +F   S+++   +  +R    D+KSKRLS MAGL      KS P    
Sbjct: 410 VTVDANSQRSSTEFKSQSKLSTPERGSERKVKSDRKSKRLSIMAGL-----TKSFPSKTS 464

Query: 460 FSSEINAKPGQ------PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511
           ++  I   PG       PTTNIQ AW QLCKLR  LHWTHIGIW++ DS+ +K+GP+ 
Sbjct: 465 YA--IEETPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMT 520

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  483 bits (1244), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 246/546 (45%), Positives = 357/546 (65%), Gaps = 47/546 (8%)

Query: 5   EEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLKK 64
           EE++R+S Q+ SLSTQLIES+++QS LE++LN++ K I     A++ Y +L+ +   L+K
Sbjct: 8   EESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAELEK 67

Query: 65  TLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREKY 124
             S +D ++ KL E++ K+ + RT+A+   DKLN EVE+LTASLFDEAN MVADAR+  +
Sbjct: 68  RESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARKASH 127

Query: 125 AIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXXXXX 184
           A E+ N +L EQL E+D               V+ +LD++S  +                
Sbjct: 128 ATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMASEQVKTLANASDNANLA 187

Query: 185 XXXXLNKVPTLNSFASQDMYS--GIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKAT 242
                N    L+S   + + +  G ++SP I+++RYD+ LY+EFLKF+A LP  ++IK T
Sbjct: 188 ASLSKN----LSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIKDT 243

Query: 243 SSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIGY 302
           +S+SKL+RRLVNDEIQP+LK++NASG+GW++K+TL++L+I+GLV VEP+SG+N  +  GY
Sbjct: 244 ASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQYGY 303

Query: 303 -------------NSSSPVKQSTA-----------------NMPK---MFKFPLNSPPVA 329
                        N+S+ ++ S A                 +M K   +F +P +SPPVA
Sbjct: 304 ASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPPVA 363

Query: 330 VHAACSFCGESRDDIIEHARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAF 389
           +   C+ CGE RDD++EHAR+++LKT  +ADDGT  V NT+PLC +C+LK+RQTCEIFAF
Sbjct: 364 LREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIFAF 423

Query: 390 LRSLKVGAWHLEKLVMQNIAKGDLVKFSEVTQRTKTEDRVS----SHDKKSKRLSFMAGL 445
           LRSLK+GAW LEK+ + +++KGD  +FS+V+     ED+ +      ++K+ R SFMAG+
Sbjct: 424 LRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMAGM 483

Query: 446 GINSTAKSKPKMEVFSSEINAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISS 505
              ++  +    EV  S+     G PTTNIQ AW+QLC+LR +LHWTHIGIW VDD I+S
Sbjct: 484 NALNSKNTTVTPEVPVSQA----GAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCITS 539

Query: 506 KIGPLV 511
           KIGPLV
Sbjct: 540 KIGPLV 545

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  479 bits (1232), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 234/511 (45%), Positives = 342/511 (66%), Gaps = 7/511 (1%)

Query: 5   EEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLKK 64
           EE+KRISIQV+SLSTQLIES+DKQS LEE LN++ K +++QK +I  ++ L+   +  KK
Sbjct: 15  EESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQLSDTKK 74

Query: 65  TLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREKY 124
            L+  ++E+     ++ +  ++R  AE   +KLN+E+EDLT SLFDEAN+MVA+AR+EK+
Sbjct: 75  QLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANARKEKH 134

Query: 125 AIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXXXXX 184
            +E+LN +L EQLREKD+              V++ +++E    N+  +           
Sbjct: 135 DVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTLNSYRQSIIMEGSNGSN 194

Query: 185 XXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKATSS 244
                  +           +  +++SP   S+RYDI LY E+L+F+A LP C+ IK T  
Sbjct: 195 ASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCKGIKDTRH 254

Query: 245 ESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIGYNS 304
           +SK +RRLV DEIQP+L++D ASG+GWLV++ L++L+IDGLV+VEPLSG+N TY IGY S
Sbjct: 255 DSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINETYRIGYAS 314

Query: 305 --SSPVKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLHKADDG 362
             S+  K +  +  KMF +P NSPPVA+   C+FC ESR+DI+EH R+YVLKTL K +DG
Sbjct: 315 PQSNSHKVTEVDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVLKTLQKNEDG 374

Query: 363 TEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEVTQR 422
           +      YPLCH+CLLK+RQTCEIFAFLRSLK GAW+LE + + + A+    +F++V + 
Sbjct: 375 STTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTL-SCARPGSDEFTKVDRN 433

Query: 423 TKTEDRVS--SHDKKSKRLSFMAGLG-INSTAKSKPKMEVFSSEINAKPGQPTTNIQRAW 479
           + T    +  ++   SKRLSFM+GL   +S+ +  P++E   ++ + + G P+TN+QR+W
Sbjct: 434 STTNSASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIETV-TDFSERKGLPSTNVQRSW 492

Query: 480 LQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510
           + LCKLR  LHW HIG+W ++DSI  K+ P+
Sbjct: 493 VHLCKLRASLHWCHIGVWTLEDSIQLKVAPM 523

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  478 bits (1231), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 231/518 (44%), Positives = 347/518 (66%), Gaps = 15/518 (2%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           M   EE +RIS+QV+SLSTQLIES+DKQS LEEQL  + K +A+QK  ++       +  
Sbjct: 10  MSEQEENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQ 69

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
            L+  L++RD E+++  E++ +  + R  AE   ++LN+E+EDLT SLFDEAN MV+ AR
Sbjct: 70  QLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKAR 129

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           +EK+ +E  N RL EQLREKD+              V++ +++E     N+         
Sbjct: 130 KEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDE----QNTRSRRQSVMD 185

Query: 181 XXXXXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIK 240
                   L+     ++F +  + SG++++P + S+RYDI +Y E+L+F+A LP C++I+
Sbjct: 186 SVNPSHTSLDVDGYASAFDNM-LSSGLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSIR 244

Query: 241 ATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHI 300
            T  +SK +RRLV+DEIQP+L++D+A+G+GWLV++ L++L+I+GLV+VEPLSG+N TY +
Sbjct: 245 DTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRM 304

Query: 301 GYNSSSPVKQSTANMP---KMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLH 357
           GY S      S ++ P   KMF +P+NSPPVA+ A C+FC E+R+DI+EH R+YVLKTL 
Sbjct: 305 GYASPQTHSHSKSSEPAAVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQ 364

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFS 417
           K + G     N YPLCH+CLLK+RQTCEIFAFLRSLK G+W+LE + + + AK +   F+
Sbjct: 365 KTETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTL-SCAKQESDAFT 423

Query: 418 EVTQRTKTEDRV----SSHDKKSKRLSFMAGLG-INSTAKSKPKMEVFSSEINAKPGQPT 472
           ++    +    +    +S    SKRLSFM+ L  +++T+K+ P++E   ++ N K G P 
Sbjct: 424 QIPNSVQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAV-TDFNEKKGLPP 482

Query: 473 TNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510
           TN+QR+W+ LCKLR  LHW+HIG+W +DD++ +K+ PL
Sbjct: 483 TNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPL 520

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  468 bits (1205), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 238/512 (46%), Positives = 339/512 (66%), Gaps = 24/512 (4%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           M   EE+KRIS+QVTSLSTQLIES+DKQS LEEQL  + KTI++Q+    +YN+L+ +  
Sbjct: 1   MADQEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQELQ 60

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
           +LK  L    D+ K       K+ ++   AE +   LN+E+EDLTASLFDEAN MVADAR
Sbjct: 61  SLK--LQYETDKTK-----FKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADAR 113

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXX 180
           +E+ A+EILN +L EQL+EKD+              V++  +N+   + N +        
Sbjct: 114 KEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSSKNVSLSDSATSS 173

Query: 181 XXXXXXXXLNKVPTLNSFASQDM-YSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENI 239
                    N    L S     + + G+++SP + S+RYD+ LY E+LKF+A LPQCEN+
Sbjct: 174 TTSIDRSTTN----LTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCENL 229

Query: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYH 299
           + T+SESKL+RRL+N EI P+L++DNASG+GWLVK+ L++L+++GLV +EP+SG+N TY 
Sbjct: 230 QQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETYR 289

Query: 300 IGYNSSS-PVKQSTANM-PKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLH 357
            GY+S S P      N    +F  P+NSPPVA+   C+FCGE+R+DI+EH R+Y+ KT  
Sbjct: 290 TGYSSPSIPDSPEVENKDSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQ 349

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFS 417
           K ++G  ++TN +P+CH+CLLKLRQ CEIFAFLRSL+ GAWHLEK+ + +I +G +  +S
Sbjct: 350 KLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKVNAYS 409

Query: 418 EVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQPTTNIQR 477
           EVT+ ++ +        KSKRLS   GL    +  S P +E    +   K G PTTNIQR
Sbjct: 410 EVTKASRPK-------MKSKRLSIFQGL--KQSQSSTPIIEN-GPQFADKNGLPTTNIQR 459

Query: 478 AWLQLCKLRCILHWTHIGIWAVDDSISSKIGP 509
           +W +L +LR  L W+HIG+W++D+S+++ I P
Sbjct: 460 SWARLSQLRASLQWSHIGVWSLDESVATDIAP 491

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  468 bits (1204), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 241/520 (46%), Positives = 338/520 (65%), Gaps = 17/520 (3%)

Query: 4   SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLK 63
           S+E KR+S+Q+TSLSTQL+ES++KQS LE++L +S K I  QK  I  YN+L   ++ L 
Sbjct: 5   SDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKYDQLD 64

Query: 64  KTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREK 123
           K  S++  ++++L + +  E   + +AE + D+LN+EVE+LTASLFDEAN MVADAR+E 
Sbjct: 65  KNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADARKET 124

Query: 124 YAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNES--TVTNNSNRYXXX---- 177
            +IE  NK+LTEQL EKD               V+  L  ES  ++ NN N         
Sbjct: 125 DSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKGDVPL 184

Query: 178 XXXXXXXXXXXLNKVPTLNSFAS-QDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQC 236
                      L K+ T  SF S Q++ +  +++P I++IRYD  LYNEFLKFVA LP C
Sbjct: 185 SNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAVLPHC 244

Query: 237 ENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNA 296
            +IK TS+ESKL+RRL++DEI P+L++D ++G+GWL K+TL++ I++GLV++EPLSG+N 
Sbjct: 245 NSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLSGINE 304

Query: 297 TYHIG--YNSSSPVKQSTANM---PKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMY 351
           TY     Y  S       ++     KMF FP +SPP+AV   C+FC ESR D I HARMY
Sbjct: 305 TYRQSALYEVSISKSSIKSDQITKAKMFNFPADSPPIAVRDPCAFCDESRSDCIGHARMY 364

Query: 352 VLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKG 411
           +LKT  + DD T  +TN YPLC  CL+K+RQTC+IFAFLRSLK G W LEK+ +  I+KG
Sbjct: 365 MLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLSTISKG 424

Query: 412 DLVKFSEVTQ-RTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQ 470
           D   F +V + + K  ++ ++ +KK KR S ++ LG + ++    K++     +    G 
Sbjct: 425 DTSSFLKVAENQFKQNEKATAQEKKQKRKSIISSLGKSHSSYVNAKLDCTVEPV----GL 480

Query: 471 PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510
           P+TNIQRAWLQLCKLR ILHW+HIGI   +D ++S   P+
Sbjct: 481 PSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPV 520

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  467 bits (1201), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 244/538 (45%), Positives = 335/538 (62%), Gaps = 36/538 (6%)

Query: 4   SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLK 63
           ++E++R++ QVT LSTQL+ES+ KQS LE++LN++ K +A+QK  IE  +Q++   + L+
Sbjct: 7   ADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKATGSALQ 66

Query: 64  KTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREK 123
           K  ++ + ++K  + ++ KE QLR KAE E   LN+EVEDLTASLFDEAN MVADAR+EK
Sbjct: 67  KNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADARKEK 126

Query: 124 YAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLDNESTVTNNSNRYXXXXXXXXX 183
            A+E+ N +L EQL+EKD               V+    +E +   N+ R          
Sbjct: 127 AAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDS---NNKRNSMLSEVTIH 183

Query: 184 XXXXXLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKATS 243
                    PT+ S  + + ++ I+YSP IS IRYD+ LY EFLKFVA LP  +NIK T+
Sbjct: 184 SGSSQRAGSPTIISTTNSESFANIIYSPNISDIRYDLPLYGEFLKFVAVLPFVKNIKQTT 243

Query: 244 SESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIGYN 303
           ++SKL+RRLVNDEIQP+L++DNA G+GW+VK+TLL+ +++GLV+VEPLSGVN  Y    N
Sbjct: 244 NDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNELYTHSRN 303

Query: 304 SSSPVKQSTANMPK-----------------MFKFPLNSPPVAVHAACSFCGESRDDIIE 346
             S    +T    +                 +F FP NSPPVAVH  C+FC E RDD ++
Sbjct: 304 RRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPCAFCNEKRDDSVQ 363

Query: 347 HARMYVLKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQ 406
           HAR+++LKT  +++ G   VTN +PLC  C+LK+RQT EIFAFLRSL +G W LEK+ + 
Sbjct: 364 HARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAIA 423

Query: 407 NIAKGDLVKFSEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAK--SKPKMEVFSSEI 464
           N++K D  K                  KK+KR SF+ GL +  TA   +      F  + 
Sbjct: 424 NLSKSDPTKIK--GSPASPTKDKEKEKKKAKRKSFIKGLNMAQTASVLNPATSNPFFQQT 481

Query: 465 NAKP------------GQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510
              P            GQPTTNIQRAWLQLCKLRC+LHW+H+GIW++DDSI +K  PL
Sbjct: 482 QTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIEAKFAPL 539

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  456 bits (1174), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 231/518 (44%), Positives = 333/518 (64%), Gaps = 14/518 (2%)

Query: 1   MDASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHN 60
           +D ++E+KRIS+Q+TS+STQL+ES+  QS LEE+LN++ K  A+ K    +Y++L+    
Sbjct: 13  VDTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVA 72

Query: 61  TLKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADAR 120
            L+ +L+ RD+E+  L   +A+E   R  ++   ++L  EVEDLTASLF EAN MVADAR
Sbjct: 73  KLEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADAR 132

Query: 121 REKYAIEILNKRLTEQLREKDVXXXXXXXXXXXXXXVMHSLD-NESTVTNNSNRYXXXXX 179
           +EK+  EILN++L E + EKD               ++  +D    + T  S+       
Sbjct: 133 KEKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSATGRSS------M 186

Query: 180 XXXXXXXXXLNKVPTLNSFASQ-DMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCEN 238
                    L  + T +S  SQ D    +VYSP++ S+RYD+SLY+EFLKF+ +LP+C  
Sbjct: 187 TSADTDTNSLKGIVTRSSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQ 246

Query: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATY 298
           I+ T SESKL+RRL+NDEI PIL+ID+A GIGW+ KK+L++++++G+VI+EP SGVN  Y
Sbjct: 247 IRDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENY 306

Query: 299 HIGYNSSSPVKQSTA-NMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLKTLH 357
             G++S S  + S   + P +F +P +SPP+A   +C+ CGESR DI EH R++ +K   
Sbjct: 307 QHGHSSPSISQHSLGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKIQQ 366

Query: 358 KADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFS 417
           K DDGT +V N YPLC WCLL++RQTCEIF+FLRSLK G W LE +  +        K  
Sbjct: 367 KRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAKSKKF 426

Query: 418 EVTQRTKTEDRVSSHDKKSKRLSFMAGLGIN-----STAKSKPKMEVFSSEINAKPGQPT 472
           ++       ++  +   ++KR+S+MAGLG+N     S+A +   +   S+    K G P 
Sbjct: 427 DLNNAPIRRNKTKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFTDKNGLPN 486

Query: 473 TNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPL 510
           TNI+RAWLQLCKLR ILHW HIGIW+V D++  KIGP+
Sbjct: 487 TNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPI 524

>KLTH0D04906g Chr4 complement(446504..447592) [1089 bp, 362 aa] {ON}
           similar to uniprot|Q03175 Saccharomyces cerevisiae
           YMR101C SRT1 Cis-prenyltransferase involved in dolichol
           synthesis
          Length = 362

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 38  SLKTIASQKAAIENYNQLETDHNTLKKTLSERDDEVKKLHEDIAKET-QLRTKAEDENDK 96
            +KT+++   +IEN+N+ + + +TL   L+E+ DEV +  +D   E   LR     E  +
Sbjct: 126 GVKTVSAYAFSIENFNRPQEEVDTLTSLLAEKLDEVARRAQDCNSELFGLRLCVVGERSR 185

Query: 97  LNREVEDLTASL 108
           +++E+ D  +S+
Sbjct: 186 ISKELNDRISSV 197

>Kwal_26.7649 s26 complement(458267..459355) [1089 bp, 362 aa] {ON}
           YMR101C (SRT1) - cis-prenyltransferase homologue [contig
           55] FULL
          Length = 362

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 36  NKSLKTIASQKAAIENYNQLETDHNTLKKTLSERDDEVKKLHEDIAKETQ-LRTKAEDEN 94
           N  +KT+++   +IEN+N+ + + +TL   L+E+ DEV +   D   E   LR +   E 
Sbjct: 124 NLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGER 183

Query: 95  DKLNREVEDLTA---SLFDEANTM 115
            ++++ + D  +    L DE + M
Sbjct: 184 SRISKSLNDRISRVERLTDEGDIM 207

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
           similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 20/121 (16%)

Query: 3   ASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTL 62
           + EE KR+  +V +L     +S    S  EEQL K  K +A+          L  D N L
Sbjct: 405 SDEELKRLKAEVEALHDAKSQSA---SSYEEQLGKLTKEVAT----------LLDDKNRL 451

Query: 63  KKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARRE 122
           +  L + +D++ +  E + K    R +  + NDK+ RE   L  S   E+N+ +A A+RE
Sbjct: 452 ESVLVQSNDQLTRAQEQVQK---FRIQNNEMNDKM-REFNTLKKS---ESNSKLALAQRE 504

Query: 123 K 123
           K
Sbjct: 505 K 505

>YML048W Chr13 (178426..179637) [1212 bp, 403 aa] {ON}  GSF2ER
           localized integral membrane protein that may promote
           secretion of certain hexose transporters, including
           Gal2p; involved in glucose-dependent repression
          Length = 403

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 11/94 (11%)

Query: 18  STQLIESVDKQSHLEEQLNKSLKT-IASQKAAI---ENYNQLETDHNTLKKTLSERDDEV 73
             QL+     QS LE++   S  T I +++  I   E + +LE   N LKK L E D ++
Sbjct: 290 GIQLVAGEGFQSPLEDRFTASTFTAIKTERKFILSEEYFVELE---NNLKKILEEYDGDI 346

Query: 74  KKLHEDIAKETQLRTKAEDEN----DKLNREVED 103
            K++ +I +  +      DE      KL RE+ D
Sbjct: 347 GKMNAEIRRFRRFGIYEPDEKLASLVKLRREIAD 380

>Skud_16.116 Chr16 (208753..209388) [636 bp, 211 aa] {ON} YPL166W
           (REAL)
          Length = 211

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 377 LLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLVKFSEV 419
           L K+ +T E F   R+ K+ A HLE L +Q   K DL KFS V
Sbjct: 55  LSKILETPEFFLRKRTYKLFAKHLELLQIQLDKKRDLEKFSNV 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,738,547
Number of extensions: 2787367
Number of successful extensions: 16203
Number of sequences better than 10.0: 557
Number of HSP's gapped: 16912
Number of HSP's successfully gapped: 736
Length of query: 752
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 635
Effective length of database: 40,065,477
Effective search space: 25441577895
Effective search space used: 25441577895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)