Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.3201.398ON3681859801e-131
YNL007C (SIS1)1.398ON3521859471e-126
Smik_14.3211.398ON3661859481e-126
Suva_14.3411.398ON3591859371e-125
TDEL0B059601.398ON3691858031e-104
SAKL0D08778g1.398ON3481837881e-102
NCAS0G036101.398ON3271827841e-102
ZYRO0E04598g1.398ON3571857771e-101
Kwal_0.2071.398ON3531847731e-100
KLTH0H12100g1.398ON3501757721e-100
KAFR0H031501.398ON3591857701e-99
CAGL0H03707g1.398ON3491857602e-98
NDAI0C026101.398ON3401857567e-98
KNAG0H016801.398ON3631857519e-97
NCAS0C048901.398ON3671827274e-93
TBLA0C014801.398ON3531817221e-92
TPHA0B037601.398ON3551847031e-89
Kpol_457.151.398ON3571746961e-88
Ecym_12921.398ON3471826907e-88
AAL008W1.398ON3491756881e-87
KLLA0D04818g1.398ON3541756831e-86
NDAI0G042501.398ON3631776641e-83
Kpol_1003.122.243ON408722709e-26
TBLA0E038102.243ON410732621e-24
KLLA0F03333g2.243ON409732551e-23
TPHA0C031102.243ON407692532e-23
CAGL0J09966g2.243ON407732498e-23
NCAS0G030002.243ON410682472e-22
SAKL0E08734g2.243ON411682443e-22
KAFR0J009402.243ON411702444e-22
ZYRO0A01496g2.243ON412732419e-22
Smik_14.2632.243ON409732382e-21
ADL257C2.243ON410682347e-21
KNAG0I019002.243ON409732331e-20
Skud_14.2682.243ON410702321e-20
Ecym_32812.243ON409682312e-20
Suva_14.2772.243ON409702302e-20
TDEL0C046002.243ON411692268e-20
YNL064C (YDJ1)2.243ON409702241e-19
Kwal_23.48302.243ON411682242e-19
NDAI0D010302.243ON411692232e-19
KLTH0G09394g2.243ON411682197e-19
Ecym_53842.218ON503732111e-17
KLLA0E07899g2.218ON495712082e-17
TDEL0C043502.218ON462712012e-16
TPHA0L007907.157ON446752003e-16
TBLA0J018707.157ON470751985e-16
AER427W2.218ON470721951e-15
Kpol_1002.1222.218ON503711914e-15
TDEL0H022907.217ON387751895e-15
KAFR0A041608.730ON378761878e-15
Ecym_43727.217ON579761899e-15
KLTH0G08756g2.218ON462711881e-14
KLTH0D12496g8.730ON375691861e-14
Smik_14.2492.218ON533711872e-14
AGR084C8.264ON427681852e-14
YNL077W (APJ1)2.218ON528711862e-14
Kwal_26.90248.730ON375761833e-14
Suva_14.2622.218ON536711843e-14
TBLA0E036602.218ON448711834e-14
NDAI0A028207.157ON482711834e-14
Skud_14.2532.218ON532711825e-14
SAKL0E09306g2.218ON461701826e-14
CAGL0J10296g2.218ON479711817e-14
YIR004W (DJP1)7.157ON432751791e-13
Suva_9.2137.157ON431751791e-13
Kwal_23.30612.218ON458661781e-13
KNAG0L013307.217ON396751782e-13
ZYRO0C15048g2.218ON491711782e-13
Skud_9.1817.157ON421751772e-13
KNAG0M020202.218ON460671782e-13
Smik_9.2037.157ON432711772e-13
CAGL0J02750g7.217ON382751762e-13
SAKL0H16984g8.264ON435731772e-13
ZYRO0D16390g7.217ON398751763e-13
ZYRO0C01606g8.264ON432681753e-13
Ecym_43068.264ON434681754e-13
KAFR0C024507.217ON373751744e-13
NCAS0E029307.217ON387751745e-13
CAGL0L00957g7.217ON373751735e-13
ADR015W7.157ON436751745e-13
NCAS0A132107.157ON414711736e-13
KLTH0A03740g7.217ON395751736e-13
AER346W8.730ON367691726e-13
SAKL0H05258g8.730ON368691726e-13
SAKL0F04444g7.157ON429751736e-13
KNAG0G028808.730ON378691727e-13
Kpol_1064.408.730ON387691719e-13
NDAI0B020008.264ON433681711e-12
TDEL0B037908.730ON373691701e-12
KNAG0I007407.157ON425711711e-12
KLLA0E04423g7.217ON428731711e-12
TBLA0A011007.157ON434751701e-12
TDEL0H032107.157ON411751701e-12
KAFR0L007407.217ON364751692e-12
CAGL0J01936g7.157ON425751692e-12
YER048C (CAJ1)7.217ON391751692e-12
Kwal_47.181337.217ON393751692e-12
TBLA0E024907.217ON366751682e-12
Kpol_499.307.157ON408751682e-12
Suva_5.1507.217ON391751683e-12
Skud_5.1587.217ON391751683e-12
TPHA0C012607.217ON380751673e-12
Smik_5.1737.217ON391751673e-12
Ecym_44697.157ON433751673e-12
Ecym_62368.730ON374691664e-12
TPHA0C029802.218ON554711675e-12
Kpol_1070.227.217ON380751656e-12
TDEL0F039108.264ON429701656e-12
Suva_13.3978.730ON375691656e-12
ZYRO0G03850g7.157ON418751656e-12
KAFR0B047807.157ON423751657e-12
ZYRO0F15400g2.15ON525671667e-12
Smik_12.1498.264ON460691657e-12
KLLA0D13464g7.157ON433751641e-11
KLTH0F13398g7.157ON419751631e-11
NCAS0D009602.350ON224651581e-11
KLLA0C07260g8.730ON368691621e-11
YLR090W (XDJ1)8.264ON459691631e-11
KLLA0F19184g8.264ON512701631e-11
TBLA0D042407.217ON389751622e-11
CAGL0H04499g2.350ON232651572e-11
Suva_10.1748.264ON456681622e-11
NCAS0B005308.730ON375691612e-11
NDAI0E045607.217ON394751612e-11
Smik_13.4228.730ON378691612e-11
ZYRO0A07502g2.350ON238661572e-11
ABL194C2.15ON552671622e-11
NCAS0B050308.264ON433721612e-11
Kwal_56.237828.264ON414671602e-11
CAGL0F03729g8.730ON361671593e-11
Kwal_55.209657.157ON421741603e-11
ZYRO0A06226g8.730ON377691593e-11
KAFR0B048902.350ON220651544e-11
KLTH0G13640g8.264ON414671584e-11
YMR214W (SCJ1)8.730ON377691585e-11
Skud_12.1588.264ON455721585e-11
Skud_13.3838.730ON375691575e-11
SAKL0F08052g7.217ON393751576e-11
SAKL0E06050g2.350ON232651537e-11
KLLA0E01629g2.350ON231661537e-11
TBLA0B093802.350ON227651528e-11
Suva_14.1162.15ON600671578e-11
KLTH0F09944g2.350ON233651529e-11
NDAI0H031802.350ON229651511e-10
Ecym_56262.350ON243671511e-10
Kpol_526.62.350ON228651501e-10
TPHA0G006308.730ON393671542e-10
Kwal_23.3578singletonOFF85641402e-10
NDAI0F024502.218ON530671542e-10
KNAG0I008602.350ON219661473e-10
AFL190C2.350ON235671483e-10
NDAI0F038002.15ON638671533e-10
KLLA0D19602g2.15ON620671524e-10
Smik_14.1062.15ON593641514e-10
Skud_14.1102.15ON596641515e-10
SAKL0E14234g2.15ON678671515e-10
TBLA0G001702.15ON659671515e-10
TDEL0G028002.350ON225651455e-10
YNL227C (JJJ1)2.15ON590671506e-10
Skud_13.3232.350ON224651456e-10
TPHA0C045902.350ON233651457e-10
NCAS0G013602.15ON616671507e-10
KAFR0A079502.15ON551671498e-10
Kpol_529.212.15ON622671499e-10
TDEL0E005002.15ON581671481e-09
KLTH0B08338g2.15ON590671481e-09
Kwal_23.44202.15ON592671481e-09
YMR161W (HLJ1)2.350ON224651421e-09
TPHA0A017908.264ON439701452e-09
CAGL0J07370g2.15ON623671453e-09
Kpol_1072.48.698ON661701444e-09
Smik_13.3612.350ON224651394e-09
TPHA0O019402.15ON598671435e-09
CAGL0G07469g8.698ON668701426e-09
KNAG0F008602.15ON626671401e-08
Suva_13.3402.350ON225661351e-08
Kpol_543.408.264ON414651381e-08
CAGL0L12276g8.264ON452701372e-08
ADL111W7.217ON578761382e-08
NDAI0E008708.730ON376661354e-08
KNAG0G011308.61ON500611354e-08
TBLA0B037308.698ON693701347e-08
KNAG0A056502.350ON175661278e-08
TPHA0D005508.61ON486661311e-07
SAKL0C02904g1.92ON281731291e-07
AFR507W8.61ON474621302e-07
KAFR0H023108.698ON655701312e-07
TDEL0A064308.698ON666701302e-07
NCAS0C012208.698ON669701302e-07
TBLA0A055601.92ON312701282e-07
KLTH0G18546gna 1ON283701263e-07
Smik_10.1681.297ON649661293e-07
KNAG0G020508.264ON432571273e-07
Ecym_10971.92ON270731253e-07
TPHA0A028101.185ON492661274e-07
ZYRO0D10934g8.698ON663701274e-07
NCAS0G028502.218ON494721274e-07
CAGL0H02827g1.297ON656671257e-07
Kwal_33.135331.113ON161691188e-07
KNAG0J018408.698ON650701241e-06
TDEL0C036801.185ON556681231e-06
YJL073W (JEM1)1.297ON645661241e-06
ZYRO0G18436g1.185ON503671231e-06
TPHA0G014808.698ON660701231e-06
KLLA0C09823g8.698ON669701231e-06
NDAI0B002001.185ON594671222e-06
TBLA0B034908.730ON384681212e-06
NCAS0I028301.185ON491661212e-06
Smik_15.4378.698ON663761213e-06
Ecym_23748.698ON661701204e-06
Kwal_33.138601.185ON578671194e-06
Skud_15.4208.698ON665761194e-06
Suva_8.3038.698ON664701185e-06
KAFR0G009101.113ON163681125e-06
KNAG0B018901.92ON370721175e-06
YOR254C (SEC63)8.698ON663761186e-06
KLTH0F04906g1.185ON590671176e-06
Kwal_26.88798.698ON656701187e-06
KLTH0H10032g1.297ON607661178e-06
Skud_10.1691.297ON644661178e-06
Suva_12.1851.113ON168691101e-05
Suva_6.1481.297ON642661161e-05
KAFR0A015301.92ON277481141e-05
KAFR0F018101.185ON555701151e-05
SAKL0D06226g1.297ON615661151e-05
KLTH0D11770g8.698ON652701151e-05
AFR639W1.113ON156591091e-05
Kpol_2000.561.92ON290671131e-05
TBLA0C071605.4ON430781142e-05
ADL327W3.350ON305701122e-05
TPHA0A056505.4ON433781132e-05
KNAG0C024501.185ON544671132e-05
Kwal_14.24521.297ON607661132e-05
AFR659W1.92ON273711112e-05
Kpol_2001.271.185ON520661123e-05
KLLA0F03124g5.4ON433781113e-05
SAKL0H05984g8.698ON658701123e-05
Ecym_14508.61ON4921431113e-05
ADR124C1.297ON611661114e-05
KLLA0D06402g1.297ON631661114e-05
Smik_10.3851.113ON172691055e-05
KNAG0B052401.297ON668661105e-05
CAGL0I06226g1.185ON455611095e-05
Kpol_1027.131.297ON641661106e-05
SAKL0B01276gna 1ON292721086e-05
NDAI0K012308.698ON680701106e-05
Ecym_63181.297ON624731096e-05
Kwal_14.1174na 1ON284631077e-05
Kpol_1060.35.4ON432771071e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.320
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...   382   e-131
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...   369   e-126
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...   369   e-126
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...   365   e-125
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...   313   e-104
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...   308   e-102
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398     306   e-102
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...   303   e-101
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...   302   e-100
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...   301   e-100
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...   301   1e-99
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...   297   2e-98
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}              295   7e-98
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...   293   9e-97
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398    284   4e-93
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...   282   1e-92
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...   275   1e-89
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...   272   1e-88
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...   270   7e-88
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...   269   1e-87
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...   267   1e-86
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...   260   1e-83
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   108   9e-26
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   105   1e-24
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   102   1e-23
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   102   2e-23
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   100   8e-23
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   100   2e-22
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    99   3e-22
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    99   4e-22
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    97   9e-22
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    96   2e-21
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...    95   7e-21
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    94   1e-20
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...    94   1e-20
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...    94   2e-20
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    93   2e-20
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    92   8e-20
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    91   1e-19
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    91   2e-19
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...    91   2e-19
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    89   7e-19
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    86   1e-17
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    85   2e-17
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    82   2e-16
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    82   3e-16
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    81   5e-16
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    80   1e-15
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    78   4e-15
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    77   5e-15
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    77   8e-15
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    77   9e-15
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    77   1e-14
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    76   1e-14
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    77   2e-14
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...    76   2e-14
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    76   2e-14
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    75   3e-14
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    75   3e-14
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    75   4e-14
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    75   4e-14
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    75   5e-14
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    75   6e-14
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    74   7e-14
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    74   1e-13
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    74   1e-13
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    73   1e-13
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    73   2e-13
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    73   2e-13
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    73   2e-13
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    73   2e-13
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    73   2e-13
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    72   2e-13
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...    73   2e-13
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    72   3e-13
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...    72   3e-13
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...    72   4e-13
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    72   4e-13
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     72   5e-13
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    71   5e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    72   5e-13
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    71   6e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    71   6e-13
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    71   6e-13
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    71   6e-13
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    71   6e-13
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    71   7e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    70   9e-13
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264     70   1e-12
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    70   1e-12
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    70   1e-12
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    70   1e-12
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    70   1e-12
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    70   1e-12
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    70   2e-12
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    70   2e-12
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    70   2e-12
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    70   2e-12
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    69   2e-12
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    69   2e-12
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    69   3e-12
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    69   3e-12
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    69   3e-12
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    69   3e-12
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    69   3e-12
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    69   4e-12
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    69   5e-12
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    68   6e-12
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...    68   6e-12
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    68   6e-12
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    68   6e-12
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               68   7e-12
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    69   7e-12
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...    68   7e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    68   1e-11
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    67   1e-11
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    65   1e-11
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    67   1e-11
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...    67   1e-11
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...    67   1e-11
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    67   2e-11
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    65   2e-11
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...    67   2e-11
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       67   2e-11
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             67   2e-11
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    67   2e-11
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    65   2e-11
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    67   2e-11
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264     67   2e-11
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...    66   2e-11
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    66   3e-11
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    66   3e-11
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    66   3e-11
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    64   4e-11
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...    65   4e-11
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    65   5e-11
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...    65   5e-11
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    65   5e-11
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    65   6e-11
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    64   7e-11
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    64   7e-11
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    63   8e-11
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    65   8e-11
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    63   9e-11
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      63   1e-10
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    63   1e-10
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    62   1e-10
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    64   2e-10
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    59   2e-10
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    64   2e-10
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    61   3e-10
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    62   3e-10
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      64   3e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    63   4e-10
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    63   4e-10
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    63   5e-10
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    63   5e-10
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    63   5e-10
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    60   5e-10
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    62   6e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    60   6e-10
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    60   7e-10
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    62   7e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    62   8e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    62   9e-10
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    62   1e-09
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    62   1e-09
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    62   1e-09
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    59   1e-09
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...    60   2e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    60   3e-09
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    60   4e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    58   4e-09
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    60   5e-09
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    59   6e-09
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    59   1e-08
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    57   1e-08
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...    58   1e-08
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...    57   2e-08
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    58   2e-08
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    57   4e-08
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    57   4e-08
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    56   7e-08
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    54   8e-08
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    55   1e-07
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    54   1e-07
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    55   2e-07
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    55   2e-07
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    55   2e-07
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     55   2e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    54   2e-07
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    53   3e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    54   3e-07
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...    54   3e-07
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    53   3e-07
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    54   4e-07
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    54   4e-07
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     54   4e-07
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    53   7e-07
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    50   8e-07
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    52   1e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    52   1e-06
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    52   1e-06
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    52   1e-06
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    52   1e-06
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    52   1e-06
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       52   2e-06
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    51   2e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    51   2e-06
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    51   3e-06
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    51   4e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    50   4e-06
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    50   4e-06
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    50   5e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    48   5e-06
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    50   5e-06
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    50   6e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    50   6e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    50   7e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    50   8e-06
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    50   8e-06
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    47   1e-05
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    49   1e-05
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    49   1e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    49   1e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    49   1e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    49   1e-05
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    47   1e-05
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    48   1e-05
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    49   2e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    48   2e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    48   2e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    48   2e-05
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    48   2e-05
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    47   2e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    48   3e-05
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    47   3e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    48   3e-05
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    47   3e-05
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    47   4e-05
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    47   4e-05
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    45   5e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    47   5e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    47   5e-05
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    47   6e-05
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    46   6e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    47   6e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    47   6e-05
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    46   7e-05
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    46   1e-04
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    46   1e-04
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    46   1e-04
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    45   1e-04
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    45   1e-04
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         45   1e-04
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    45   1e-04
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    45   2e-04
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    45   2e-04
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    45   2e-04
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    45   2e-04
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    45   2e-04
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    45   2e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    44   2e-04
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    44   3e-04
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    45   3e-04
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    44   3e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    44   3e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    44   3e-04
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    43   3e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    44   3e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    44   3e-04
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    44   4e-04
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    44   4e-04
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    43   4e-04
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    44   4e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    44   4e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    44   4e-04
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    44   5e-04
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    44   5e-04
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    44   5e-04
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    43   5e-04
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    44   6e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    43   7e-04
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    43   7e-04
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    43   7e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    43   7e-04
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    43   8e-04
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    43   8e-04
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    43   8e-04
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    43   8e-04
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    41   9e-04
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    41   0.001
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    43   0.001
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    41   0.001
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    43   0.001
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    42   0.001
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    41   0.001
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    42   0.001
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    42   0.002
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    42   0.002
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    42   0.002
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    42   0.002
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    41   0.002
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    42   0.002
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    42   0.002
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    42   0.002
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    42   0.002
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    42   0.003
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    40   0.003
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    42   0.003
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    40   0.004
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    40   0.004
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    41   0.004
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    39   0.004
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    39   0.005
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    40   0.005
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    40   0.005
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    40   0.006
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    39   0.008
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    39   0.009
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.009
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    39   0.012
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    39   0.014
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    39   0.016
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    39   0.017
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    39   0.017
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    39   0.018
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    38   0.023
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    38   0.027
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    38   0.032
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    38   0.037
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    37   0.037
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    38   0.043
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    37   0.060
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    37   0.066
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    37   0.068
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    35   0.11 
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    36   0.12 
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    35   0.15 
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    35   0.15 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    35   0.19 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    35   0.24 
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    35   0.26 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    35   0.26 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    35   0.28 
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    35   0.31 
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    35   0.31 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    35   0.35 
ZYRO0C03454g Chr3 (274135..274572) [438 bp, 145 aa] {ON} similar...    33   0.64 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    33   0.69 
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    33   0.95 
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    32   1.1  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    33   1.1  
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    32   1.4  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    32   1.4  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    32   1.6  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    32   1.7  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    32   2.5  
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    31   2.8  
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    32   3.2  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    31   3.8  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    31   4.6  
KLTH0E05522g Chr5 (488343..488969) [627 bp, 208 aa] {ON} conserv...    30   8.2  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    30   8.4  
KLTH0C00594g Chr3 (61284..62402) [1119 bp, 372 aa] {ON} highly s...    30   9.8  

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {ON}
           YNL007C (REAL)
          Length = 368

 Score =  382 bits (980), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/185 (100%), Positives = 185/185 (100%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA
Sbjct: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI
Sbjct: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA
Sbjct: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363

Query: 364 IDENF 368
           IDENF
Sbjct: 364 IDENF 368

 Score =  167 bits (423), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 87/120 (72%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGAGGFSGGHAFSNEDAFNIFSQ 120

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
           SIS1Type II HSP40 co-chaperone that interacts with the
           HSP70 protein Ssa1p; not functionally redundant with
           Ydj1p due to due to substrate specificity; shares
           similarity with bacterial DnaJ proteins
          Length = 352

 Score =  369 bits (947), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 179/185 (96%), Positives = 182/185 (98%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSASSSPTY EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGA+EKTQIDIQLKPGWKA
Sbjct: 168 RSASSSPTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKA 227

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKNQGD+N QTGRRKTLQFVIQEK HPNFKRDGDDLIYTLPLSFKESLLGFSKTI
Sbjct: 228 GTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 287

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLN+AQKRA
Sbjct: 288 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRA 347

Query: 364 IDENF 368
           IDENF
Sbjct: 348 IDENF 352

 Score =  159 bits (402), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/120 (70%), Positives = 86/120 (71%), Gaps = 3/120 (2%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP+ANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND QK
Sbjct: 1   MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAAR---SGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQ 117

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {ON}
           YNL007C (REAL)
          Length = 366

 Score =  369 bits (948), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 179/185 (96%), Positives = 182/185 (98%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSASSSPTY EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGA+EKTQIDIQLKPGWKA
Sbjct: 182 RSASSSPTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKA 241

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKNQGD+N QTGRRKTLQFVIQEK HPNFKRDGDDLIYTLPLSFKESLLGFSKTI
Sbjct: 242 GTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 301

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLN+AQKRA
Sbjct: 302 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRA 361

Query: 364 IDENF 368
           IDENF
Sbjct: 362 IDENF 366

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 87/120 (72%), Gaps = 3/120 (2%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND+QK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAAR---SGGPSFGAGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQ 117

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {ON}
           YNL007C (REAL)
          Length = 359

 Score =  365 bits (937), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/185 (95%), Positives = 180/185 (97%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSASSSP+Y EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG +EKTQIDIQLKPGWKA
Sbjct: 175 RSASSSPSYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGTSEKTQIDIQLKPGWKA 234

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKNQGDFN QT RRKTLQFVIQEK HPNFKRDGDDLIYTLPLSFKESLLGFSKTI
Sbjct: 235 GTKITYKNQGDFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 294

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLN+AQKRA
Sbjct: 295 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRA 354

Query: 364 IDENF 368
           IDENF
Sbjct: 355 IDENF 359

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 83/117 (70%), Gaps = 3/117 (2%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYD+LGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND QK
Sbjct: 1   MVKETKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNI 117
           REIYDQYG+EAAR                                 HAFSNEDAFNI
Sbjct: 61  REIYDQYGIEAAR---SGGPSFGAGGAGGPGGAGGFPGGAGGFSGGHAFSNEDAFNI 114

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
           {ON} Anc_1.398 YNL007C
          Length = 369

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/185 (80%), Positives = 166/185 (89%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RS S+SP+  EEE V VNLPVSLEDL  GKKKSFKIGRKGP+G +EKTQIDIQLK GWKA
Sbjct: 185 RSGSASPSQVEEEVVSVNLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKA 244

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKN+GD+N +TG RKTLQFV+QEK HP FKRDGD+LIYTLPLSFKESLLGFSKTI
Sbjct: 245 GTKITYKNEGDYNPRTGGRKTLQFVLQEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTI 304

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLP+SRVQP+QPS++S YPGQGMP  K P QRG+LIVKYK+DYPISLN+AQK A
Sbjct: 305 QTIDGRTLPISRVQPIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYPISLNDAQKHA 364

Query: 364 IDENF 368
           ID+NF
Sbjct: 365 IDQNF 369

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 86/119 (72%), Gaps = 4/119 (3%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND+QK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFS 119
           REIYDQYGLEAAR                                 HAFSNEDAFNIFS
Sbjct: 61  REIYDQYGLEAAR----NGGPAFGGASPGAGGFPGGAGGFSGGHGGHAFSNEDAFNIFS 115

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
           to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score =  308 bits (788), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 164/183 (89%)

Query: 186 ASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGT 245
           AS +    EEETVQVNLPVSLEDLF G+KKSFKI RKGP    EK QIDIQ+KPGWKAGT
Sbjct: 166 ASRAAPQREEETVQVNLPVSLEDLFAGRKKSFKITRKGPGSVPEKKQIDIQMKPGWKAGT 225

Query: 246 KITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQT 305
           KIT+KN+GD+N QTG R+T+QFVIQEK HP+FKRDG++LIYTLPLSFKESLLGFSKTIQT
Sbjct: 226 KITFKNEGDYNQQTGGRQTMQFVIQEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTIQT 285

Query: 306 IDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAID 365
           IDGRTLP+SRVQP+QPS+TSTYPGQGMP PK P+QRG+LI+KYKVDYPI LNEAQKRAI 
Sbjct: 286 IDGRTLPISRVQPIQPSETSTYPGQGMPLPKTPAQRGDLIIKYKVDYPIGLNEAQKRAIA 345

Query: 366 ENF 368
           ENF
Sbjct: 346 ENF 348

 Score =  149 bits (375), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 83/120 (69%), Gaps = 4/120 (3%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVK+TKLYDLLGVSP+A+E ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND QK
Sbjct: 1   MVKDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYD YGLEAAR                                 HAFS EDAFNIFSQ
Sbjct: 61  REIYDSYGLEAAR----NGGPSFGGAGAGAGGFPGGAGGFPGGAGQHAFSQEDAFNIFSQ 116

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (89%)

Query: 187 SSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTK 246
           S++P Y EEE V VNLPVSLEDLF+GKKKSFKIGRKGP G+ EKTQIDIQL+PGWKAGTK
Sbjct: 146 SAAPQYEEEEVVPVNLPVSLEDLFIGKKKSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTK 205

Query: 247 ITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 306
           +TYKNQGD+N ++G RKTLQFVIQEK HP+FKRDGDDLIY L LSFKESLLGFSKTI TI
Sbjct: 206 VTYKNQGDYNPRSGGRKTLQFVIQEKAHPDFKRDGDDLIYILRLSFKESLLGFSKTINTI 265

Query: 307 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           DGR LPLSR QP+QP++ STYPGQGMP  KNPSQRGNLI+KYK+DYPISLN+ Q+ AI++
Sbjct: 266 DGRKLPLSRSQPIQPTEISTYPGQGMPVSKNPSQRGNLIIKYKIDYPISLNDNQRIAIEQ 325

Query: 367 NF 368
           NF
Sbjct: 326 NF 327

 Score =  151 bits (381), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 83/120 (69%), Gaps = 10/120 (8%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND   
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNT 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YDQYGLEAAR                                 H FSN+DAFN+FSQ
Sbjct: 61  REVYDQYGLEAAR----------SGGPSFGGAGAGGFPGGAGGFSGHQFSNDDAFNMFSQ 110

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {ON}
           some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 357

 Score =  303 bits (777), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/185 (77%), Positives = 163/185 (88%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RS S+SP  AEEE V VNLPVSLEDLF G+KKSFKIGRK   G+ EKTQIDIQLKPGWKA
Sbjct: 173 RSGSASPPSAEEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFEKTQIDIQLKPGWKA 232

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKN+GD+N QTG RKTLQFV+QEK HP +KRDGD+LIY+LPLSFKESLLGFSKTI
Sbjct: 233 GTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYSLPLSFKESLLGFSKTI 292

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLP+S++QPVQP++ S+YPGQGMP  K P QRG+L+VKYK+DYP+SL E QKRA
Sbjct: 293 QTIDGRTLPISKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKIDYPLSLTEDQKRA 352

Query: 364 IDENF 368
           I ENF
Sbjct: 353 IAENF 357

 Score =  152 bits (383), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 85/120 (70%), Gaps = 7/120 (5%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYD+LGVSP+ANEQELKKGY+KAALKYHPDKP GDTEKFKEISEA+EIL+D+ K
Sbjct: 1   MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEKFKEISEAYEILSDSSK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAAR-------NGGPAFGGASPGAGGFPAGGAGGFSSHAFSNEDAFNIFSQ 113

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
           YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
           82] FULL
          Length = 353

 Score =  302 bits (773), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 166/184 (90%), Gaps = 1/184 (0%)

Query: 185 SASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAG 244
           S +SSP   EE+ VQVNLPVSLEDLF GKKKSFKI RKGP GA+EK Q+DIQLKPGWKAG
Sbjct: 171 SGASSPP-PEEKVVQVNLPVSLEDLFSGKKKSFKITRKGPGGASEKQQVDIQLKPGWKAG 229

Query: 245 TKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQ 304
           TKITYKN+GD+N +TGRR+TLQF++QEK H N+ RDG+DLIY+LPL+FKESLLGFSKTIQ
Sbjct: 230 TKITYKNEGDYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYSLPLTFKESLLGFSKTIQ 289

Query: 305 TIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAI 364
           TIDGRTLP+SRVQPVQPS +STYPGQGMP  K PSQRGNLIVKYK+DYP++LN++Q+RAI
Sbjct: 290 TIDGRTLPISRVQPVQPSDSSTYPGQGMPIAKTPSQRGNLIVKYKIDYPVTLNDSQRRAI 349

Query: 365 DENF 368
            ENF
Sbjct: 350 LENF 353

 Score =  140 bits (354), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 79/117 (67%), Gaps = 7/117 (5%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVK+TKLYDLLGVSP+A E ELKKGYRKAALKYHPDKP+GD EKFKEISEAFEILND QK
Sbjct: 1   MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNI 117
           RE+YD YGLEAAR                                 H+FSNEDAFNI
Sbjct: 61  REVYDTYGLEAAR-------NGGPAFGGAGGPGGAGGHPGAGFAGAHSFSNEDAFNI 110

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 350

 Score =  301 bits (772), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/175 (80%), Positives = 160/175 (91%)

Query: 194 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQG 253
           EE+TVQVNLPVSLEDLF GKKKSFKI RKGP GA EK Q+DIQL+PGWKAGTKITYKN+G
Sbjct: 176 EEKTVQVNLPVSLEDLFSGKKKSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEG 235

Query: 254 DFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 313
           D+N +TGRR+T+QF+IQEK H N+ RDG+DLIYTLPL+FKESLLGF+KTIQTIDGRTLP+
Sbjct: 236 DYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPI 295

Query: 314 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368
           SRVQPVQPS  STYPGQGMP  KNPSQRGNLIVKYK+DYP +LN++Q+RAI ENF
Sbjct: 296 SRVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYPATLNDSQRRAISENF 350

 Score =  143 bits (360), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 79/117 (67%), Gaps = 9/117 (7%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVK+TKLYDLLGVSP+A E ELKKGYRKAALKYHPDKPTGD EKFKEISEAFEILND QK
Sbjct: 1   MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNI 117
           REIYD YGLEAAR                                 H+FSNEDAFNI
Sbjct: 61  REIYDNYGLEAAR---------NGGPAFGGAGGAGGAGGHPGFASSHSFSNEDAFNI 108

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.398
           YNL007C
          Length = 359

 Score =  301 bits (770), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 146/185 (78%), Positives = 165/185 (89%), Gaps = 1/185 (0%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RS S+SP+ A+EETVQV+LPVSLEDLF GKKKSFKIGRKG  G  EKTQIDIQLKPGWKA
Sbjct: 176 RSTSNSPS-AQEETVQVSLPVSLEDLFHGKKKSFKIGRKGQGGIPEKTQIDIQLKPGWKA 234

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYK+QGD+N QTG RKTLQF++QEK HP FKR+GDDL  TLPL+FKESLLGF+K I
Sbjct: 235 GTKITYKSQGDYNPQTGGRKTLQFMLQEKNHPVFKREGDDLTCTLPLTFKESLLGFNKQI 294

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLP+SR QP+QPS+TS YPGQGMP PK PSQRGNLIV+YK+DYPI+LN+AQK A
Sbjct: 295 QTIDGRTLPISRTQPIQPSETSVYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNA 354

Query: 364 IDENF 368
           I +NF
Sbjct: 355 ILQNF 359

 Score =  150 bits (380), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 85/120 (70%), Gaps = 8/120 (6%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP+AN+QE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDKNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YDQYGL+AAR                                 HAF+NEDAFNIFSQ
Sbjct: 61  REVYDQYGLQAAR--------SGGPQFGGAGGPGGAGGFPGGGFGGHAFTNEDAFNIFSQ 112

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P25294 Saccharomyces
           cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score =  297 bits (760), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 161/185 (87%), Gaps = 2/185 (1%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSASS     EEE V VNL VSLEDL+ GKKK+F IGRKGP+GA EKTQ+DIQLKPGWKA
Sbjct: 167 RSASSP--QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKA 224

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKN GD+N  TGRRKTLQF+IQEK HP F RDG+DLIYTLPL+FKESLLGF+KTI
Sbjct: 225 GTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTI 284

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLP+SR+QP+QPS+ STYPGQGMP PK P QRG++IV YKVDYPISL + Q++A
Sbjct: 285 QTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQA 344

Query: 364 IDENF 368
           IDENF
Sbjct: 345 IDENF 349

 Score =  153 bits (387), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 86/120 (71%), Gaps = 10/120 (8%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D QK
Sbjct: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YDQYGLEAAR                                 HAFSN+DAFNIFSQ
Sbjct: 61  REVYDQYGLEAAR----------NGGPAFGGAGGFRGGGFSSAGGAHAFSNDDAFNIFSQ 110

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score =  295 bits (756), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 138/185 (74%), Positives = 164/185 (88%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RSA+ +    EEE V VNLPVSLEDLF GKKKSFKIGRKGP G+ EK QIDIQLK GWKA
Sbjct: 156 RSATGASQRPEEEVVTVNLPVSLEDLFTGKKKSFKIGRKGPGGSQEKKQIDIQLKRGWKA 215

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTKITYKN+GDFN +TG RKTLQFV+QEK HP FKRDG++L+YT+PLSF+ESLLGFSKT+
Sbjct: 216 GTKITYKNEGDFNPRTGGRKTLQFVLQEKAHPLFKRDGENLLYTVPLSFQESLLGFSKTV 275

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGR+L LSR QP+QP++T+TYPGQGMP PKNP+QRG+LI+ YK+DYPISL++AQ++A
Sbjct: 276 QTIDGRSLSLSRTQPIQPTETTTYPGQGMPNPKNPNQRGDLIITYKIDYPISLSDAQRQA 335

Query: 364 IDENF 368
           I +NF
Sbjct: 336 IQQNF 340

 Score =  145 bits (367), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 74/120 (61%), Positives = 86/120 (71%), Gaps = 14/120 (11%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP+AN+QE+KKGYRKAAL+YHPDKPTG+TEKFK+ISEA+EIL+D+ K
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEKFKQISEAYEILSDSNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YDQYGLEAAR                                 H+FSN+DAFNIFSQ
Sbjct: 61  REVYDQYGLEAAR--------------SGGPSFGGAGGAGGFPGGAHSFSNDDAFNIFSQ 106

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {ON}
           Anc_1.398 YNL007C
          Length = 363

 Score =  293 bits (751), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 142/185 (76%), Positives = 162/185 (87%), Gaps = 1/185 (0%)

Query: 184 RSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKA 243
           RS S+SP   +EE VQV+LPVSLEDLF GKKKSFK+GRKGP GA EK QIDIQLK GWKA
Sbjct: 180 RSTSASPP-PQEEVVQVHLPVSLEDLFEGKKKSFKVGRKGPGGAQEKVQIDIQLKAGWKA 238

Query: 244 GTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI 303
           GTK+TYKN GD+N +TG RKTLQFVIQEK HP +KR+GDDL YTLPL+FKESLLGFSKTI
Sbjct: 239 GTKVTYKNHGDYNPRTGGRKTLQFVIQEKTHPLYKRNGDDLEYTLPLTFKESLLGFSKTI 298

Query: 304 QTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRA 363
           QTIDGRTLPLSR  PVQP++TS YPGQGMP PK PSQRG+L+V++K+DYPISLN+AQ++A
Sbjct: 299 QTIDGRTLPLSRSSPVQPTETSRYPGQGMPMPKMPSQRGDLVVRFKIDYPISLNDAQRQA 358

Query: 364 IDENF 368
           I  NF
Sbjct: 359 IAANF 363

 Score =  152 bits (384), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 83/117 (70%), Gaps = 9/117 (7%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSPTANEQELKKGYRK+ALKYHPDKPTGDTEKFKEISEAFEILND QK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTEKFKEISEAFEILNDKQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNI 117
           REIYDQYGLEAAR                                 H+FSNEDAFNI
Sbjct: 61  REIYDQYGLEAAR---------QGGPSFGAGGPGAGGAPGGGAGFAHSFSNEDAFNI 108

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398
          Length = 367

 Score =  284 bits (727), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 158/182 (86%)

Query: 187 SSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTK 246
           S SP   EE+T +V+LPVSLEDLFVGKKKSFK+GRKGP G  EKTQIDIQLKPGWKAGTK
Sbjct: 186 SPSPEQQEEKTDEVHLPVSLEDLFVGKKKSFKVGRKGPDGKHEKTQIDIQLKPGWKAGTK 245

Query: 247 ITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 306
           ITYK++GD+N +TG RKTLQF+I EK HP+FKR+ D+LIYTLPL+FKESLLGFSKTIQTI
Sbjct: 246 ITYKSKGDYNPKTGGRKTLQFIISEKPHPHFKREDDNLIYTLPLTFKESLLGFSKTIQTI 305

Query: 307 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           DG+ LPLSR QPVQPS+T+TYPGQGMP  K P QRG+L++KYKVDYPI+L  AQ+ AI  
Sbjct: 306 DGKNLPLSRGQPVQPSETTTYPGQGMPITKKPGQRGDLLIKYKVDYPINLTPAQREAISN 365

Query: 367 NF 368
           NF
Sbjct: 366 NF 367

 Score =  148 bits (373), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 84/120 (70%), Gaps = 8/120 (6%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLL V PTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND QK
Sbjct: 1   MVKETKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAAR--------NGGAIPTSDGGASFQGGFPGGAGGAHAFSNEDAFNIFSQ 112

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score =  282 bits (722), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/181 (72%), Positives = 155/181 (85%)

Query: 188 SSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKI 247
           SS +  EEE V V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTK+
Sbjct: 173 SSASPHEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKL 232

Query: 248 TYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTID 307
           TYKN GD+N  TG RKTLQF+I+EK HP +KRDGD++IYTLPL+FKESLLGFSKT+QT+D
Sbjct: 233 TYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLD 292

Query: 308 GRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDEN 367
           GRTLPLSR QPVQP++ +TYPGQGMP  KNP QRGNLI+KYK++YPISL ++Q+RAI +N
Sbjct: 293 GRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADN 352

Query: 368 F 368
           F
Sbjct: 353 F 353

 Score =  140 bits (352), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 83/120 (69%), Gaps = 14/120 (11%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D+ K
Sbjct: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           R +YDQYGL+AAR                                 H+FSN+DAFNIFSQ
Sbjct: 61  RSVYDQYGLDAAR--------------NGGPSFQGQSGFPGGGGSTHSFSNDDAFNIFSQ 106

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.398
           YNL007C
          Length = 355

 Score =  275 bits (703), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (83%), Gaps = 2/184 (1%)

Query: 185 SASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAG 244
           S  +SP  AEEE V V+LPVSLEDLF GKKK+FKIGRKG +G  EK Q+DIQLK GWKAG
Sbjct: 174 SRGASP--AEEEVVTVDLPVSLEDLFQGKKKTFKIGRKGQNGVQEKVQVDIQLKAGWKAG 231

Query: 245 TKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQ 304
           TKIT+KN GD+N  TG RKTLQFVI+EK HPNFKR+ D L+Y LPL+FKESLLGF KTIQ
Sbjct: 232 TKITFKNYGDYNPSTGGRKTLQFVIKEKVHPNFKREDDTLVYYLPLTFKESLLGFQKTIQ 291

Query: 305 TIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAI 364
           TIDGRTLP+SRVQPVQP+ +STYPGQGMP  K P QRG++IVKYK++YP +L + Q+RAI
Sbjct: 292 TIDGRTLPISRVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVKYKIEYPTTLTDDQRRAI 351

Query: 365 DENF 368
           DE F
Sbjct: 352 DELF 355

 Score =  143 bits (360), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 82/117 (70%), Gaps = 12/117 (10%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP+AN+QE+KKGYRKAALKYHPDKPTG+TEKFKEISEAFEIL+D+ K
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEKFKEISEAFEILSDSNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNI 117
           RE+YDQYGLEAAR                                 H FSN+DAFNI
Sbjct: 61  REVYDQYGLEAAR------------GNGPQFGPGGMPGGPGGSGGAHTFSNDDAFNI 105

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
           (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score =  272 bits (696), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 130/174 (74%), Positives = 151/174 (86%)

Query: 195 EETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGD 254
           EE VQV+LPVSLEDLF GKKK+FKIGRKGP+G AEK QI+I LK GWKAGTKITYKNQGD
Sbjct: 184 EEVVQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTKITYKNQGD 243

Query: 255 FNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLS 314
           +N  TG RKTLQF+++EK + NFKRD D+LIYTLPL+FKESLLGF KTI+TIDG+TLP+S
Sbjct: 244 YNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTLPLTFKESLLGFQKTIKTIDGKTLPIS 303

Query: 315 RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368
           RVQPVQPS+ +TYPGQGMP  K+  QRG++IVK+KV YP SL E QKR I+ENF
Sbjct: 304 RVQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPTSLTEDQKRVINENF 357

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 84/120 (70%), Gaps = 14/120 (11%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKET LYDLL VSPTANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DA+K
Sbjct: 1   MVKETGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAEK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YDQYGL+AAR                                 H F+N+DAFNIFSQ
Sbjct: 61  REVYDQYGLKAAR--------------GEAPQFANGGAGGFPGGGAHTFTNDDAFNIFSQ 106

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
           similar to Ashbya gossypii AAL008W
          Length = 347

 Score =  270 bits (690), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 150/182 (82%)

Query: 187 SSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTK 246
           S S    EE+ VQVNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQL+PGWKAGTK
Sbjct: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225

Query: 247 ITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 306
           ITYKN+GD+N  TG R+TLQF+IQEK H   KRDG+DL YTLPLSFKESLLGFSKT+ TI
Sbjct: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285

Query: 307 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           DGR + +S+ QPVQPS+ S YPGQGMP  KNPS+RG+LIVKYK+DYPI+L+E QK AI  
Sbjct: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345

Query: 367 NF 368
           NF
Sbjct: 346 NF 347

 Score =  139 bits (350), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/120 (62%), Positives = 78/120 (65%), Gaps = 9/120 (7%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND  K
Sbjct: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YD+YGLEAAR                                    S EDAFNIFSQ
Sbjct: 61  REVYDKYGLEAARGNGPAGFGGQAGAGGGFSGFGGGGHAF---------SQEDAFNIFSQ 111

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score =  269 bits (688), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (84%)

Query: 194 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQG 253
           EE+ VQVNLPVSLEDLFVGK+KSFKI RKG  G  EK QIDIQL+PGWKAGTKITYKN+G
Sbjct: 175 EEKLVQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEG 234

Query: 254 DFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 313
           D+N  TG R+T+QF+IQEK H  FKRDG+DLIYTLPL+FKESLLGF KT++TIDGR + +
Sbjct: 235 DYNPSTGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFDKTVRTIDGRQISI 294

Query: 314 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368
            + QPVQPS+   YPGQGMP  KNPS+RG+LIVKYK DYPI+L E Q+RAI ENF
Sbjct: 295 HKTQPVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYPITLTEKQRRAILENF 349

 Score =  144 bits (363), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 82/120 (68%), Gaps = 6/120 (5%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGVSP+A++ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YD YGLEAAR                                 HAFS EDAFNIFSQ
Sbjct: 61  REVYDTYGLEAAR------GNAPSGFGGAGPGGAGFGGFSTGGGGRHAFSQEDAFNIFSQ 114

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {ON}
           similar to gnl|GLV|CAGL0H03707g Candida glabrata
           CAGL0H03707g and some similarites with YNL007C
           uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score =  267 bits (683), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 127/175 (72%), Positives = 149/175 (85%)

Query: 194 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQG 253
           EEE VQVNLPVSLEDLF GKKKSFKI RKG  G +EK QIDIQLKPGWKAGTKIT+K +G
Sbjct: 180 EEEVVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEG 239

Query: 254 DFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 313
           D+N +TG R+TLQFV+QEK H  F R  +DLIYTLPLSFKESLLGFSK +QTIDG+T+P+
Sbjct: 240 DYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTLPLSFKESLLGFSKQVQTIDGKTIPI 299

Query: 314 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368
           +R QP+QP+QTSTYPGQGM   KNPSQRG+LI+K+K+DYP SL   Q++AI +NF
Sbjct: 300 TRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLIIKFKIDYPTSLTPQQRQAIMDNF 354

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 83/120 (69%), Gaps = 4/120 (3%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVK+TKLYDLLG+SP+A E E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DAQK
Sbjct: 1   MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           RE+YD YGLEAAR                                 HAFS +DAFNIFSQ
Sbjct: 61  REVYDTYGLEAAR----GNAPQFGGAGGPGGPGGPGGFSSGGFAGGHAFSQDDAFNIFSQ 116

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
           Anc_1.398
          Length = 363

 Score =  260 bits (664), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 149/177 (84%), Gaps = 1/177 (0%)

Query: 193 AEEETV-QVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKN 251
           A+EE V +V++ VSLEDLF GKKKSFKIGRKGP G  EKTQIDIQLKPGWKAGTK+TYKN
Sbjct: 185 AQEEGVDEVHISVSLEDLFAGKKKSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKLTYKN 244

Query: 252 QGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTL 311
           +GD+N +T  RKTLQF+I EK HP F+R+ D+L+ T+PL+FKESLLGFSKT+QTIDGR L
Sbjct: 245 KGDYNPRTHGRKTLQFIIDEKPHPTFQREDDNLVCTVPLTFKESLLGFSKTVQTIDGRNL 304

Query: 312 PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368
           P+SR QP+QP++ + YPGQGMP  K P QRG+LIVKYK+ YPI+L +AQ+ AI  NF
Sbjct: 305 PISRSQPIQPTEITRYPGQGMPISKKPGQRGDLIVKYKIAYPITLTQAQRDAIKTNF 361

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 86/120 (71%), Gaps = 6/120 (5%)

Query: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60
           MVKETKLYDLLGV+P+ANEQE+KKGYRKAALKYHPDKPTGDTEKFK+ISEA+EIL+D+ K
Sbjct: 1   MVKETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKQISEAYEILSDSNK 60

Query: 61  REIYDQYGLEAARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAFSNEDAFNIFSQ 120
           REIYDQYGLEAAR                                 HAFSNEDAFNIFSQ
Sbjct: 61  REIYDQYGLEAAR------NGGAMPMPGQDGTTFTSTGGFPGGGGAHAFSNEDAFNIFSQ 114

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa]
          {ON} complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  108 bits (270), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVKETK YDLLGVSP A+E E+KKGYRKAALKYHPDK PT +  EKFKE S A+E+L+D+
Sbjct: 1  MVKETKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEKFKECSGAYEVLSDS 60

Query: 59 QKREIYDQYGLE 70
          QKREIYDQYG E
Sbjct: 61 QKREIYDQYGEE 72

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 79/149 (53%), Gaps = 6/149 (4%)

Query: 222 KGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDG 281
           KG   A E+  +++ ++PG + G K+T+K + D          + FV+ EK H +FKR G
Sbjct: 204 KGNKVANERKVLEVHVEPGMREGQKVTFKGEADQAPDIIPGDVI-FVVTEKPHKHFKRSG 262

Query: 282 DDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPS 339
           DDL+Y   +    ++ G    I+ + G  L ++ V  + + P       G+GMP  K   
Sbjct: 263 DDLLYEAEVDLLTAIAGGDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKY-G 321

Query: 340 QRGNLIVKYKVDYPIS--LNEAQKRAIDE 366
             GNLI+ +K+ +P +   +EA+ +A+++
Sbjct: 322 GYGNLIITFKIKFPENHFADEAKLKALED 350

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa]
          {ON} Anc_2.243 YNL064C
          Length = 410

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 62/73 (84%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVK+TK YD+LGVSPTA+E E+KKGYRKAALKYHPDK PT +  EKFKE S A+E+L+D 
Sbjct: 1  MVKDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAEKFKECSAAYEVLSDP 60

Query: 59 QKREIYDQYGLEA 71
          +KR++YDQYG E 
Sbjct: 61 EKRDVYDQYGEEG 73

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 71/137 (51%), Gaps = 7/137 (5%)

Query: 222 KGPHG---AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFK 278
           K  HG   A E+  ++++++PG K G +I +K + D  +       + FV+ EK H +F+
Sbjct: 203 KSCHGKKIANERKILEVKIEPGMKDGQRIVFKGESD-QAPDIIPGDVVFVVNEKPHKHFQ 261

Query: 279 RDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPK 336
           R G+DL+Y   +    ++ G    ++ + G  L ++ V  + + P       G+GMP  K
Sbjct: 262 RSGNDLVYLAEIDLLTAIAGGEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILK 321

Query: 337 NPSQRGNLIVKYKVDYP 353
                GNLI+++ + +P
Sbjct: 322 Y-GGYGNLIIQFNIKFP 337

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 409

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 62/73 (84%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TKLYDLLGVSP A++ ++KK YRK+ALK+HPDK   +   EKFKEI+ A+EIL+D+
Sbjct: 1  MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDS 60

Query: 59 QKREIYDQYGLEA 71
          QKRE+YDQ+GLE 
Sbjct: 61 QKREVYDQFGLEG 73

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G +I ++ + D  S       + FV+ E+ HP FKRDG+DL Y  
Sbjct: 209 ERKVLEVNIEPGMKDGQRIVFQGEAD-QSPGIIPGDVVFVVSEQPHPVFKRDGNDLHYDA 267

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +  V  + + P       G+GMP PK     GNL++
Sbjct: 268 EIDLLSAIAGGQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKY-GGYGNLLI 326

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 327 KFNIKFP 333

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa]
          {ON} Anc_2.243 YNL064C
          Length = 407

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (82%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YDLLGVSP A+E E+KKGYRK ALKYHPDK   +   EKFKE S A+E+L+D+
Sbjct: 1  MVKETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAEKFKECSAAYEVLSDS 60

Query: 59 QKREIYDQY 67
          QKRE+YDQY
Sbjct: 61 QKREVYDQY 69

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 4/134 (2%)

Query: 222 KGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDG 281
           KG   A E+  +++ ++PG + G KI +K + D          + FV+ EK H +FKR G
Sbjct: 204 KGKKIANERKVLEVHVEPGMREGQKIVFKGEADQAPDVIPGDVI-FVVVEKPHKHFKRAG 262

Query: 282 DDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPS 339
           DDL+Y   +    ++ G    IQ + G  L +S V  + +         G+GMP PK   
Sbjct: 263 DDLLYEAEIDLLTAIAGGEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKY-G 321

Query: 340 QRGNLIVKYKVDYP 353
             GNLIV +K+ +P
Sbjct: 322 GYGNLIVTFKIKFP 335

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064c YDJ1
          Length = 407

 Score =  100 bits (249), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 60/73 (82%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TKLYD LGVSP A++ E+KK YRK+ALKYHPDK   +   EKFKE+S A+EIL+D+
Sbjct: 1  MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDS 60

Query: 59 QKREIYDQYGLEA 71
          QKRE+YDQ+G E 
Sbjct: 61 QKREVYDQFGEEG 73

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  ++++++PG K G KI +K + D          + FVI EK H +F+R GDDLIY  
Sbjct: 210 ERKILEVRIEPGMKDGQKIVFKGEADQAPDVIPGDVV-FVISEKPHKHFQRAGDDLIYEA 268

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    +L G    ++ + G  L +  V  + + P       G+GMP  K     GNL++
Sbjct: 269 EIDLLTALAGGQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGY-GNLLI 327

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 328 KFNIKFP 334

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa]
          {ON} Anc_2.243
          Length = 410

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVK+TKLYD+LGVSPTA + E+KK YRK+ALKYHPDK PT +  EKFKE+S A+EIL+D+
Sbjct: 1  MVKDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDS 60

Query: 59 QKREIYDQ 66
          +KREIYDQ
Sbjct: 61 EKREIYDQ 68

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G  I +K + D          + FV+ +K H +F+R GDDL+Y  
Sbjct: 215 ERKILEVHIEPGMKDGQNIVFKGEADQAPDVIPGDVI-FVVAQKPHKHFQRSGDDLVYEA 273

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +S +  + + P       G+GMP PK     GNLIV
Sbjct: 274 EIDLLTAIAGGEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGH-GNLIV 332

Query: 347 KYKVDYPISLNEAQKRAIDEN 367
            + V +P      QK   DE+
Sbjct: 333 HFTVKFP------QKHFADED 347

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
          to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 411

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVK+TKLYDL+GVSP A++ ++KK YRKAALKYHPDK PT +  EKFKEIS A+EIL+D+
Sbjct: 1  MVKDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEKFKEISSAYEILSDS 60

Query: 59 QKREIYDQ 66
          QKRE+YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 227 AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIY 286
           A E+  +++ ++PG K G KI ++ + D  +       + FV+ E+ H  F R GDDL Y
Sbjct: 211 ANERKILEVHIEPGMKDGQKIVFQGEAD-QAPDVVPGDVVFVVSERPHERFNRKGDDLYY 269

Query: 287 TLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNL 344
              +    ++ G    +Q + G  L +  V  + + P  T    G+GMP  K     GNL
Sbjct: 270 EAEVDLLTAIAGGEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKY-GGFGNL 328

Query: 345 IVKYKVDYP 353
           IVK+K+ +P
Sbjct: 329 IVKFKIKFP 337

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 98.6 bits (244), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 59/70 (84%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MV+ETKLYD+LGVSPTA++ E+KK YRK ALKYHPDK   +   EKFKE S A+E+L+D+
Sbjct: 1  MVRETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 QKREIYDQYG 68
          +KR+IYDQ+G
Sbjct: 61 EKRDIYDQFG 70

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 68/137 (49%), Gaps = 7/137 (5%)

Query: 222 KGPHG---AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFK 278
           K  HG   A E+  + + + PG K G K+ +K + D          + FVI EK H +F+
Sbjct: 201 KDCHGKKIANERKILQVNVDPGMKNGQKVVFKGEADQAPDIIPGDVI-FVISEKPHKHFQ 259

Query: 279 RDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPK 336
           R GDDLIY   +    ++ G    ++ + G  L +S V  + + P+      G+GMP  K
Sbjct: 260 RVGDDLIYEAEIDLLTAVAGGEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQK 319

Query: 337 NPSQRGNLIVKYKVDYP 353
                GNLI+K+ + +P
Sbjct: 320 Y-GGYGNLIIKFSIKFP 335

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa]
          {ON} highly similar to gnl|GLV|CAGL0J09966g Candida
          glabrata CAGL0J09966g and similar to YNL064C
          uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 412

 Score = 97.4 bits (241), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YDLLGVS TA+E E+KK YRK ALKYHPDK   +   EKFKE S A+E+L DA
Sbjct: 1  MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEKFKEASSAYEVLMDA 60

Query: 59 QKREIYDQYGLEA 71
          +KRE YDQ+G E 
Sbjct: 61 EKREAYDQFGEEG 73

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 4/129 (3%)

Query: 227 AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIY 286
           A E+  +++ + PG K G KI +K + D          + FV+ E+ H +F+RD DDL+Y
Sbjct: 212 ANERKILEVHVDPGMKDGQKIVFKGEADQAPDIIPGDVI-FVVSERPHKHFRRDSDDLVY 270

Query: 287 TLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNL 344
              +    ++ G    I+ + G  L +  V  + + P       G+GMP  K     GNL
Sbjct: 271 EADIDLLTAIAGGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKY-GGFGNL 329

Query: 345 IVKYKVDYP 353
           +VK+ + +P
Sbjct: 330 LVKFNIVFP 338

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YD+LGVS TA + E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+D+
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 QKREIYDQYGLEA 71
          +KRE+YDQ+G E 
Sbjct: 61 EKREVYDQFGEEG 73

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G +I +K + D  +       + F++ E+ H NFKRDGDDL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEAD-QAPDVIPGDVVFIVSERPHKNFKRDGDDLVYEA 270

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +  V  + + P       G+GMP PK     GNL++
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKY-GGYGNLVI 329

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 330 KFTIKFP 336

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL064C
          (YDJ1)
          Length = 410

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 58/68 (85%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TKLYDLLGVSP AN+ ++KK YRK+ALKYHPDK   +   +KFK+I+ A+EIL+D+
Sbjct: 1  MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDS 60

Query: 59 QKREIYDQ 66
          QKRE+YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 6/132 (4%)

Query: 227 AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRR-KTLQFVIQEKGHPNFKRDGDDLI 285
           A+E+  +++ ++PG K G KI +  QG+ + Q G+    + FV+ E+ HP F R+GD+L 
Sbjct: 211 ASERKILEVNIQPGMKHGQKIVF--QGEADQQPGQIPGDVVFVVNEQEHPRFVRNGDNLH 268

Query: 286 YTLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGN 343
           Y   +    ++ G    ++ + G  L +  V  + + P       G+GMP  K  S  G+
Sbjct: 269 YEAEIDLLTAIAGGQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSY-GD 327

Query: 344 LIVKYKVDYPIS 355
           L++K+ V +P S
Sbjct: 328 LLIKFNVKFPKS 339

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON}
          Anc_2.243 YNL064C
          Length = 409

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TKLYD+LGVS TA + E+KK YRK ALK+HPDK   +   EKFKE S A+E+L+DA
Sbjct: 1  MVKDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEKFKEASSAYEVLSDA 60

Query: 59 QKREIYDQYGLEA 71
           KR+ YDQ+GLE 
Sbjct: 61 DKRDTYDQFGLEG 73

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 4/129 (3%)

Query: 227 AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIY 286
           A+E+  +++ + PG K G K+ +K + D  +       + FVI EK H +F+R GD+L+Y
Sbjct: 209 ASERKILEVHVDPGMKNGQKVVFKGEAD-QAPDVIPGDVVFVINEKPHKHFQRSGDNLVY 267

Query: 287 TLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNL 344
              +    ++ G    I+ + G  L ++ V  + + P       G+GMP  K     GNL
Sbjct: 268 EAEVDLLTAIAGGEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKY-GGYGNL 326

Query: 345 IVKYKVDYP 353
           I+K+ V +P
Sbjct: 327 IIKFTVKFP 335

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa]
          {ON} YNL064C (REAL)
          Length = 410

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YD+LGVS TA + E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+D+
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 QKREIYDQYG 68
          +KR++YDQ+G
Sbjct: 61 EKRDVYDQFG 70

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G +I +K + D  +       + F++ E+ H +FKRDGDDL+Y  
Sbjct: 213 ERKILEVHVEPGMKDGQRIVFKGEAD-QAPDVIPGDVVFLVSERPHKSFKRDGDDLVYEA 271

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +  V  + + P       G+GMP PK     GNLI+
Sbjct: 272 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY-GGYGNLII 330

Query: 347 KYKVDYP 353
           K+ V +P
Sbjct: 331 KFTVKFP 337

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
          similar to Ashbya gossypii ADL257C
          Length = 409

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 59/68 (86%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVK+TKLYDLLGVS  AN+ ++KK YRKAALKYHPDK P+ +  +KFK+++ A+EIL+D+
Sbjct: 1  MVKDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAADKFKQMTAAYEILSDS 60

Query: 59 QKREIYDQ 66
          QKRE+YDQ
Sbjct: 61 QKREVYDQ 68

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 6/130 (4%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRR-KTLQFVIQEKGHPNFKRDGDDLIYT 287
           E+  +++ ++PG K G K+ +  QG+ + Q G+    + FV+ E+ HP F R+GD+L Y 
Sbjct: 212 ERKILEVNIEPGMKNGQKVVF--QGEADQQPGQIPGDVVFVVNEQEHPKFVRNGDNLHYE 269

Query: 288 LPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLI 345
             +    ++ G    ++ + G  L +  V  + + P       G+GMP  K  S  GNL+
Sbjct: 270 AQIDLLTAVAGGQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLL 328

Query: 346 VKYKVDYPIS 355
           +K+ V +P S
Sbjct: 329 IKFNVKFPKS 338

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/70 (62%), Positives = 56/70 (80%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YD+LGVS TA + E+KK YRK ALK+HPDK   +   EKFKE S A+E+L+D+
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 QKREIYDQYG 68
          +KRE+YDQ+G
Sbjct: 61 EKREVYDQFG 70

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G KI +K + D  +       + F++ E+ H +FKRDGDDL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQKIVFKGEAD-QAPDVIPGDVVFLVSERPHKHFKRDGDDLVYEA 270

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +  V  + + P       G+GMP PK     GNLIV
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY-GGYGNLIV 329

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 330 KFTIKFP 336

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 91.7 bits (226), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 59/69 (85%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVK++K YDLLGVS +A E E+KK YRK+ALKYHPDK P+ +  EKFKE+S A+E+L+D+
Sbjct: 1  MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAEKFKEVSSAYEVLSDS 60

Query: 59 QKREIYDQY 67
          +KR++YDQ+
Sbjct: 61 EKRQVYDQF 69

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 4/129 (3%)

Query: 227 AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIY 286
           A E+  +++ + PG K G KI +K + D          + FV+ EK H NF+R GDDL+Y
Sbjct: 211 ANERKILEVHVDPGMKDGQKIVFKGEADQAPDVIPGDVI-FVVSEKPHKNFQRVGDDLVY 269

Query: 287 TLPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNL 344
              +    ++ G   +++ + G  L ++ V  + + P       G+GMP  K     GNL
Sbjct: 270 EAEIDLLTAVAGGEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKF-GGYGNL 328

Query: 345 IVKYKVDYP 353
           +V +K+++P
Sbjct: 329 LVTFKINFP 337

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
          YDJ1Type I HSP40 co-chaperone involved in regulation of
          the HSP90 and HSP70 functions; involved in protein
          translocation across membranes; member of the DnaJ
          family
          Length = 409

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVKETK YD+LGV  TA + E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+D 
Sbjct: 1  MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDP 60

Query: 59 QKREIYDQYG 68
          +KR+IYDQ+G
Sbjct: 61 EKRDIYDQFG 70

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G +I +K + D  +       + F++ E+ H +FKRDGDDL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEAD-QAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEA 270

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    ++ + G  L +  V  + + P       G+GMP PK     GNLI+
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKY-GGYGNLII 329

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 330 KFTIKFP 336

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa]
          {ON} YNL064C (YDJ1) - yeast dnaJ homolog (nuclear
          envelope protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TK YDLLGVSP AN+ ++KK YRK ALK+HPDK   +   +KFKE++ A+EIL+D+
Sbjct: 1  MVKDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDS 60

Query: 59 QKREIYDQ 66
          QKR+IYDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 69/128 (53%), Gaps = 6/128 (4%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRR-KTLQFVIQEKGHPNFKRDGDDLIYT 287
           E+  +++ ++PG K G KI +  QG+ +   G     + FVI ++ H +F+R GDDL+Y 
Sbjct: 213 ERKILEVHIEPGMKDGQKIVF--QGEADQAPGIIPGDVVFVISQRPHKHFERKGDDLLYQ 270

Query: 288 LPLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLI 345
             +    ++ G    I+ + G  L +S V  + + P  T    G+GMP  K     GNLI
Sbjct: 271 AEVDLLSAIAGGEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKY-GGYGNLI 329

Query: 346 VKYKVDYP 353
           V +K+++P
Sbjct: 330 VTFKINFP 337

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa]
          {ON} Anc_2.243
          Length = 411

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (79%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          MVK+TK YD+LGVSP+A+  E+KK YRK ALKYHPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEKFKEASAAYEVLSDD 60

Query: 59 QKREIYDQY 67
          +KRE+YDQ+
Sbjct: 61 EKREMYDQF 69

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G K+ +K + D          + FV+ +K H +F+R GDDL+Y  
Sbjct: 214 ERKILEVHIEPGMKDGQKVVFKGEADQAPDIIPGDVI-FVVSQKPHEHFQRAGDDLVYEA 272

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    I+ + G  L ++ V  + + P        +GMP PK     GNLIV
Sbjct: 273 EIDLLTAIAGGEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKY-GGYGNLIV 331

Query: 347 KYKVDYP 353
           K+ + +P
Sbjct: 332 KFNIKFP 338

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 411

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 57/68 (83%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDA 58
          MVKETK YDLLGV   AN+ ++KKGYRK ALK+HPDK P+ +  +KFKE++ A+E+L+D+
Sbjct: 1  MVKETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAADKFKELTVAYEVLSDS 60

Query: 59 QKREIYDQ 66
          QKR+IYDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTL 288
           E+  +++ ++PG K G KI ++ + D          + FVI ++ H +F+R GD+L Y  
Sbjct: 212 ERKILEVHIEPGMKDGQKIVFQGEADQAPGVIPGDVI-FVISQRPHKHFERKGDNLYYQA 270

Query: 289 PLSFKESLLGFSKTIQTIDGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKNPSQRGNLIV 346
            +    ++ G    I+ + G  L +  V  + + P  T    G+GMP  K     G+LIV
Sbjct: 271 EVDLLSAIAGGEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKY-GGFGDLIV 329

Query: 347 KYKVDYP 353
            +KV++P
Sbjct: 330 TFKVNFP 336

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
          Ashbya gossypii AER427W
          Length = 503

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 57/73 (78%), Gaps = 5/73 (6%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILN 56
          MVK+T+ YDLL VSPT + QELKK Y+ AAL+YHPDK  G +E     F++I+EA+ IL+
Sbjct: 1  MVKDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK-NGHSESAKQAFQQITEAYGILS 59

Query: 57 DAQKREIYDQYGL 69
          D +KR+IYD+YG+
Sbjct: 60 DERKRKIYDRYGV 72

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 65/140 (46%), Gaps = 12/140 (8%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQ----FVIQEK---GHPNFKR 279
           E+   ++++KPG    ++I    + D   ++  G+++ +      ++QE+   G     R
Sbjct: 249 ERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFR 308

Query: 280 DGDDLIYTLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYPGQGMPTPK 336
           + D ++    +  + SL G S  I     GR + L  +  + + P         GMP   
Sbjct: 309 ESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRD 368

Query: 337 NPSQRGNLIVKYKVDYPISL 356
           NPSQ G+L +K+ V++P  L
Sbjct: 369 NPSQYGDLYIKFCVNFPERL 388

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and weakly similar to YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 495

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          M K TKLYD+L V+ TA EQE+KK YRK ALK+HPDK     E    F++IS A+E L++
Sbjct: 1  MAKNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSN 60

Query: 58 AQKREIYDQYG 68
          + KRE+YDQYG
Sbjct: 61 SNKRELYDQYG 71

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON}
          Anc_2.218 YNL077W
          Length = 462

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+LYD+L VSP A+  E++K YR  ALK+HPDK     E   KF E++EA+EIL D
Sbjct: 1  MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEESKSKFLEVNEAYEILID 60

Query: 58 AQKREIYDQYG 68
           +KR +YDQYG
Sbjct: 61 EKKRSLYDQYG 71

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 16/151 (10%)

Query: 222 KGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGD------FNSQTGRRKTLQFVIQEKGHP 275
           +G     E+   D+++KPG   G +I    + D      F ++T     +   I +   P
Sbjct: 225 EGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDP 284

Query: 276 NFKR---DGDDL-IYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQP---VQPSQTSTYP 328
            F+R   +G DL +    +    SL G   +I       L    + P   ++P+   +  
Sbjct: 285 KFQRVNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIE 344

Query: 329 GQGMP---TPKNPSQRGNLIVKYKVDYPISL 356
             GMP     + P   GNL ++++V++P +L
Sbjct: 345 NLGMPRYEEKRAPEGYGNLYIQFQVEFPETL 375

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/75 (54%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV ET+ YDLLG+S TA + E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVLETEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           Q R  YD+YG E A
Sbjct: 61 KQLRSNYDKYGKEKA 75

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YD+LG++PTA + E+KK YRK ++K HPDK   D   TE+F++ISEA+++L+D
Sbjct: 1  MVVDTTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATERFQQISEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YDQ+G E A
Sbjct: 61 EHLRNNYDQFGKEQA 75

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 5/72 (6%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILN 56
          MVK+T+LYD+LGV P  +  ELKK Y+ AAL+YHPDK  G +E    +F++I++A+ +L 
Sbjct: 1  MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK-NGHSEASKQRFQQIADAYRVLG 59

Query: 57 DAQKREIYDQYG 68
          D + R+IYD+YG
Sbjct: 60 DERLRKIYDRYG 71

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 75/148 (50%), Gaps = 12/148 (8%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTL---QFVIQEKGHP----NFKR 279
           E+   +++++PG +AG+++ +  + D   N+  G+ + L     +  E+  P      + 
Sbjct: 227 ERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRG 286

Query: 280 DGDDLIYTLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYPGQGMPTPK 336
           D + L+  L +  + SL G +  I+    G+ + L  +  + ++P         GMP P 
Sbjct: 287 DANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPD 346

Query: 337 NPSQRGNLIVKYKVDYPISLNEAQKRAI 364
           +PSQ G+L +K+ VD+P +L ++   AI
Sbjct: 347 DPSQYGHLFIKFHVDFPKTLADSTITAI 374

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
          (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          MV  ++LYD+L +S  A+ +++KK YR  ALKYHPDK     E    F++ISEA+E+L D
Sbjct: 1  MVMSSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLID 60

Query: 58 AQKREIYDQYG 68
           +KR++YDQYG
Sbjct: 61 VEKRKLYDQYG 71

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 20/154 (12%)

Query: 225 HGAAEKTQI-DIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQ----FVIQEKGHPNF 277
           +G  E+ +I D++++PG   G  I    + D   N+  G++K +       I +    NF
Sbjct: 256 NGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNNF 315

Query: 278 K--RDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQP---VQPSQTSTYPGQGM 332
           +   D D L+    ++  ++L G +  I       L    + P   + P    T    GM
Sbjct: 316 EVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGM 375

Query: 333 PTP--KNPS------QRGNLIVKYKVDYPISLNE 358
           P    ++P        +GNL VK+ + +P  L E
Sbjct: 376 PKEEKRDPDVSIINISKGNLYVKFDIKFPTRLEE 409

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGVSPTA   E+KK YRK A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAETKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YDQ+G + A
Sbjct: 61 TELRSRYDQFGKDDA 75

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          ++     Y +LGV+  AN++E+K  YR+ + KYHPDK  GD E   KF E+ EA+++L+D
Sbjct: 17 LINAQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHNKFIEVGEAYDVLSD 76

Query: 58 AQKREIYDQYGLEAAR 73
          ++KR IYDQYG +A +
Sbjct: 77 SEKRNIYDQYGADAIK 92

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+TK YD+LGV P A  +++KK YRK A++ HPDK   D E   KF+E+S+A+++L+D
Sbjct: 1  MVKDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQAKFQEVSKAYKVLSD 60

Query: 58 AQKREIYDQYGLEAAR 73
           + R  YD+ GL   R
Sbjct: 61 GELRSRYDEVGLSDER 76

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 462

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 5/71 (7%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILND 57
          V  ++LYD+LGVS +A+ Q++KK YR  ALK+HPDK  G +E    KF++I +A+EIL D
Sbjct: 4  VSNSELYDILGVSASASRQDIKKAYRVNALKHHPDK-NGHSEESKLKFQQICKAYEILKD 62

Query: 58 AQKREIYDQYG 68
           +KRE+YD++G
Sbjct: 63 ERKREMYDRFG 73

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 13/139 (9%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQ----FVIQEKGHPNF--KRD 280
           E+   DI++  G + G ++    + D    S+ G    +      ++++  H  F   RD
Sbjct: 235 ERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRHRD 294

Query: 281 GDDLIYTLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYPGQGMPTPKN 337
              ++    +  K SL G    + +   G+ L +  +  + ++P       G GMP  K+
Sbjct: 295 ASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP--KS 352

Query: 338 PSQRGNLIVKYKVDYPISL 356
             + GNL +++ V +P SL
Sbjct: 353 GGRFGNLYIRFDVAFPESL 371

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDAQKREIY 64
          Y +LGVS  A+E+E+K  YR+ + KYHPDK  GD     KF E+ EA+E+L+D QKR+IY
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDETAHHKFIEVGEAYEVLSDDQKRQIY 85

Query: 65 DQYGLEAAR 73
          +QYG EA +
Sbjct: 86 NQYGAEALK 94

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 6/93 (6%)

Query: 265 LQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTIDG-RTLPLSRVQ--PVQ 320
           ++F    + +  ++R G  L  T  L+ KE+L G + + I+ +D  + + L R    PV+
Sbjct: 273 IKFSESSRDNMGYRRRGVHLHRTEVLTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVR 332

Query: 321 PSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
             +T   PG GM  PK+    G+L V Y V  P
Sbjct: 333 HGETERVPGFGM--PKDGRHFGDLFVDYVVLTP 363

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
          (REAL)
          Length = 533

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+ TA+  E+KK YR AALKYHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 AQKREIYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR090W
          (XDJ1)
          Length = 427

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQK 60
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 61 REIYDQYG 68
          R  YDQ+G
Sbjct: 65 RAEYDQFG 72

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 70/132 (53%), Gaps = 11/132 (8%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDF--NSQTGRRKTLQFVIQEKG--HPNFKRDGDDL 284
           E++ I + +  G + G ++ Y  Q D     +TG    L FVI E+     + +R G DL
Sbjct: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLERKGTDL 278

Query: 285 IYTLPLSFKESLLGFSKTI-QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQR 341
             T+ +S  E+L GF++ + +T D R L ++  R + ++P     +  +G P  ++ ++ 
Sbjct: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGARF 337

Query: 342 GNLIVKYKVDYP 353
           G++ V+  +++P
Sbjct: 338 GDMYVQVLIEFP 349

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}
          APJ1Putative chaperone of the HSP40 (DNAJ) family;
          overexpression interferes with propagation of the
          [Psi+] prion; the authentic, non-tagged protein is
          detected in highly purified mitochondria in
          high-throughput studies
          Length = 528

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M + T LYD L V+  A+  E+KK YR AALKYHPDK     E   KF+EI +A+EIL D
Sbjct: 1  MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKD 60

Query: 58 AQKREIYDQYG 68
           + R +YDQYG
Sbjct: 61 NRLRALYDQYG 71

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON}
          YMR214W (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          +V     Y +LGVS  A+++E+K  YR+ + K+HPDK  GD +   KF E+ EA+E+L+D
Sbjct: 20 LVAAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSD 79

Query: 58 AQKREIYDQYGLEAAR 73
           QKR+IYDQ+G EA +
Sbjct: 80 DQKRQIYDQHGAEALK 95

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 265 LQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLL-GFSKTIQTID-GRTLPLSRVQ--PVQ 320
           ++F    + +  ++R G  L  T  LS KE+LL G+ + I+  D  + L L R Q  PV+
Sbjct: 272 IKFSESSRDNMGYRRRGPHLYRTEVLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVR 331

Query: 321 PSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
             +    PG GMPT  +  + G+L V Y V  P
Sbjct: 332 NGEIERVPGFGMPTGGH-GKHGDLFVDYVVVIP 363

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
          (REAL)
          Length = 536

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+ TA+  E+KK YR AAL+YHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 AQKREIYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON}
          Anc_2.218 YNL077W
          Length = 448

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ +LY+ L + PTA++ ++KK YR  AL+YHPDK     E   KF++ISEA+ IL D
Sbjct: 1  MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEESKKKFQDISEAYSILRD 60

Query: 58 AQKREIYDQYG 68
            +R++YD+YG
Sbjct: 61 ENQRKMYDKYG 71

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 7/154 (4%)

Query: 220 GRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQFVIQEKGHPNF 277
           G  G     E    D+++ PG K GT+I + N+GD   N +      +   I E     F
Sbjct: 245 GCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPGNVIIHINEIEDNKF 304

Query: 278 KR--DGDDLIY-TLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPG-QGMP 333
           KR  DG DL Y    +    SL G    I+      L    + P +  ++ +  G + + 
Sbjct: 305 KRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLG 364

Query: 334 TPKNP-SQRGNLIVKYKVDYPISLNEAQKRAIDE 366
            PKN  ++ G L ++++V YP  LN    +AI++
Sbjct: 365 MPKNKGNEYGILYIQFQVKYPEKLNMESIKAIEK 398

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLG+ P+A + E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYG 68
             R  YD+YG
Sbjct: 61 ESLRLKYDKYG 71

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
          (REAL)
          Length = 532

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+ TA+  E+KK YR AALKYHPDK     E   KF+EI +A+E L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYETLKD 60

Query: 58 AQKREIYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 461

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDA 58
          VK T+LYD L +S  A  QE+KK YR AALK HPDK     +   KF+EI +A+EIL DA
Sbjct: 4  VKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDKNNHSEDSKRKFQEICKAYEILGDA 63

Query: 59 QKREIYDQYG 68
          +K+ +YD+YG
Sbjct: 64 KKKLLYDRYG 73

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 12/146 (8%)

Query: 222 KGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKT----LQFVIQEKGHP 275
           KG     E+   +I+++PG   G +I    + D    +  G+ +     +  ++Q+  HP
Sbjct: 227 KGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHP 286

Query: 276 NFK--RDGDDLIYTLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYPGQ 330
            F+   D D ++    +  K SL G    I+    G  L +  +  + ++P         
Sbjct: 287 LFQIHNDTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESM 346

Query: 331 GMPTPKNPSQRGNLIVKYKVDYPISL 356
           GMP P++    GNL ++++VD+P  L
Sbjct: 347 GMPHPQSQG-FGNLYIRFQVDFPDKL 371

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077w
          Length = 479

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+LYDLL V   A++  +KK +  AAL+ HPDK     E   +F+EIS+A+E+L+D
Sbjct: 1  MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSD 60

Query: 58 AQKREIYDQYG 68
           + RE+YD+YG
Sbjct: 61 PKSREMYDRYG 71

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS TA+  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD+YG + A
Sbjct: 61 DDLRAKYDKYGRKEA 75

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS TA+  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD+YG + A
Sbjct: 61 NELRVKYDKYGRKEA 75

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa]
          {ON} YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%), Gaps = 5/66 (7%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILNDAQKRE 62
          LYD LGV+  A+ QE+KK YR  ALK+HPDK  G +E    KF++I +A+EIL D +KRE
Sbjct: 9  LYDTLGVAANASRQEIKKAYRLKALKHHPDK-NGHSEQSKLKFQQICKAYEILGDDKKRE 67

Query: 63 IYDQYG 68
          +YD++G
Sbjct: 68 MYDRFG 73

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 66/148 (44%), Gaps = 16/148 (10%)

Query: 223 GPHGAA---EKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQ----FVIQEKG 273
           G HG     E+   +I+++ G + G  +    + D    S+ G  + +      ++++  
Sbjct: 227 GCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLP 286

Query: 274 HPNFKRDGDD--LIYTLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYP 328
           H + KR  D   L+    +  K SL G +  + +   G+ L +  +  + ++P       
Sbjct: 287 HRSLKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQ 346

Query: 329 GQGMPTPKNPSQRGNLIVKYKVDYPISL 356
             GMP  K+    G+L +K+KV +P +L
Sbjct: 347 SMGMP--KSKGGYGDLFIKFKVIFPDNL 372

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MVKET+ YD+LG+ PTA   E+KK YR+ A++ HPDK   D   +E+F+++ EA+++L+D
Sbjct: 1  MVKETEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASERFQQVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R+ YD++G + A
Sbjct: 61 PDLRKQYDEFGKDNA 75

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and some similarites with YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 491

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M ++T+LYD L VSP A   E+K+ Y+  ALKYHPDK     +   KF+E+ +A+EIL D
Sbjct: 1  MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKNKFQEVCKAYEILAD 60

Query: 58 AQKREIYDQYG 68
            KR +YD+YG
Sbjct: 61 EDKRVMYDRYG 71

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 15/142 (10%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRK--------TLQFVIQEKGHPNFK 278
           E+   D+++  G   G  I    + D    +  G  K        T+  V   K H    
Sbjct: 259 ERKIFDVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFH-RVN 317

Query: 279 RDGDDLIY-TLPLSFKESLLGFSKTIQTI-DGRTLPLSRV--QPVQPSQTSTYPGQGMPT 334
           R G DL+  +  +    SL G    I     G+ L +S V  + + P+   +  G GMP 
Sbjct: 318 RYGCDLVMGSCSIDLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPK 377

Query: 335 PKNPSQRGNLIVKYKVDYPISL 356
             +   +GNL ++++++YP+ L
Sbjct: 378 YGHDGGKGNLYIQFQLEYPVGL 399

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS TA+  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATERFQAISEAYQVLGD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G + A
Sbjct: 61 DELRAKYDKFGRKEA 75

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa]
          {ON} Anc_2.218 YNL077W
          Length = 460

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDAQKREI 63
          LYD+LGV+  A++ E+KK YRK AL+YHPDK  GD    E F++IS A+ +L D  +R+ 
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEAFQKISHAYGVLGDVAQRQR 63

Query: 64 YDQYGLE 70
          YDQ G E
Sbjct: 64 YDQSGDE 70

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +++ YDLLGVS TA   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDSEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 AQKREIYDQYG 68
           + R  YD+YG
Sbjct: 61 DELRAKYDKYG 71

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LG+SP A   E+KK YRK A+  HPDK   D E   KF+ + EA+++LND
Sbjct: 1  MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLND 60

Query: 58 AQKREIYDQYGLEAA 72
             R+ YD++G + A
Sbjct: 61 PALRKQYDEFGKDNA 75

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 435

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 51/73 (69%), Gaps = 6/73 (8%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDA 58
          TKLY++LGV+P A++ E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61

Query: 59 QKREIYDQYGLEA 71
            R+ YD YG +A
Sbjct: 62 DSRKKYDVYGDDA 74

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 5/94 (5%)

Query: 265 LQFVIQE--KGHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQ--PV 319
           L FVI+E  +   N +R GDDL   L +S  E++ GF K +  T+D R L L   Q   +
Sbjct: 263 LLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVI 322

Query: 320 QPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
           +P        +G P   + ++ G++ V+  +++P
Sbjct: 323 RPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD LG+SPTA   E+KK YR+ A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD+YG + A
Sbjct: 61 ESLRARYDEYGKDDA 75

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 432

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDAQK 60
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 61 REIYDQYG 68
          R  YD YG
Sbjct: 63 RSKYDTYG 70

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
          similar to Ashbya gossypii AGR084C
          Length = 434

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQK 60
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 61 REIYDQYG 68
          R  YD YG
Sbjct: 65 RSEYDHYG 72

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 18/144 (12%)

Query: 222 KGPHGAA---EKTQIDIQLKPGWKAGTKITYKNQGDFNS--QTGRRKTLQFVIQEKGHPN 276
           K  HG     E + + + +  G +    I    Q D  +  +TG    L F I E   P+
Sbjct: 216 KKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGKETG---DLVFEIDEITDPD 272

Query: 277 --FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGR----TLPLSRVQPVQPSQTSTYPG 329
              +R G DL  ++ +S  E+L GF++ + +T D R    T+P  +V  ++P     +  
Sbjct: 273 AELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV--LRPGNYLKFTN 330

Query: 330 QGMPTPKNPSQRGNLIVKYKVDYP 353
           +G P   N S+ G+L VK  +++P
Sbjct: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKP---TGDTEKFKEISEAFEILND 57
          MVKET  Y+LLGV P A   E+KK YRK AL   P+K     G  EKF+ I+EA+++L+ 
Sbjct: 1  MVKETAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANEKFQAIAEAYQVLHS 60

Query: 58 AQKREIYDQYGLEAA 72
           + RE YD+ G EAA
Sbjct: 61 KELREKYDKLGKEAA 75

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T  YD+LGV PTA   E+KK YR+ A++ HPDK   D E   KF+E+ EA+++L+D
Sbjct: 1  MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G + A
Sbjct: 61 PGLRSRYDEFGKDEA 75

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MVK+T+ YD+LGV P A   E+KK YR+ A++ HPDK   D     KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R+ YDQ G E+A
Sbjct: 61 DELRKRYDQLGKESA 75

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP A   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+ 
Sbjct: 1  MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSS 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G E A
Sbjct: 61 DELRAKYDKFGKEEA 75

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  Y+LLG+SP+A   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYG 68
             R  YD+YG
Sbjct: 61 DTLRLKYDKYG 71

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YDLLG+ P A+  E+KK YRK A+  HPDK   D E   KF+ I +A+++L+D
Sbjct: 1  MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGQAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G E A
Sbjct: 61 PELRSRYDEFGKEDA 75

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDAQKREIY 64
          Y +LGV   A E+++K  YR+ + KYHPDK  GDT     F E+ EA+E L+D +KR IY
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEKRRIY 82

Query: 65 DQYGLEAAR 73
          DQYG EA +
Sbjct: 83 DQYGAEALK 91

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 277 FKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRV--QPVQPSQTSTYPGQGM 332
           ++R G +L  T  LS KE+L G + + ++ +D  + +P SR   Q VQ  +    PG GM
Sbjct: 277 YRRQGANLFRTEVLSLKEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGM 336

Query: 333 PTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           P P + +  G+L V Y V  P + +    R +DE
Sbjct: 337 PLP-DSAGFGDLYVDYVVILPGTFD---SRIMDE 366

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGDT--EKFKEISEAFEILNDAQKREIY 64
          Y +LGVS  A ++++K  YR+ + KYHPDK P  D+   KF E+ EA+E+L+D +KR+IY
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHNKFIEVGEAYEVLSDPEKRKIY 81

Query: 65 DQYGLEAAR 73
          DQYG EA +
Sbjct: 82 DQYGAEALK 90

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP A   E+KK YRK +++ HPDK   D   TE+F+ IS+A+++L++
Sbjct: 1  MVVDTTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSN 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G E A
Sbjct: 61 EELRTKYDKFGKEEA 75

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LGV+  A+E+++K  YR+ + K+HPDK  GD E   KF EI EA+E+L+D++KR  Y
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEAHHKFIEIGEAYEVLSDSEKRATY 80

Query: 65 DQYGLEAAR 73
          D++G +A +
Sbjct: 81 DRFGADALK 89

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 265 LQFVIQEKGHPN--FKRDGDDLIYTLPLSFKESLL-GFSKTIQTIDG-RTLPLSRVQPV- 319
           L FV +E  H N  ++R GD L  T  L +KE+LL G+ + I   D  + + + R + V 
Sbjct: 263 LVFVFEENSHENLGYRRRGDHLYRTEVLHWKEALLGGWERRIAFFDDQKQVVVKRDKNVV 322

Query: 320 -QPSQTSTYPGQGMP----TPKNPSQRGNLIVKYKVDYP 353
             P +    P  GMP      K+ +  G+L ++Y +  P
Sbjct: 323 TAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVIVSP 361

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
          (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LG+S   NE+E+K  YR+ + K+HPDK   D +   KF EI EA+E+L+D +KR +Y
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHNKFIEIGEAYEVLSDPEKRRMY 84

Query: 65 DQYGLEAAR 73
          DQ+G +A +
Sbjct: 85 DQFGADAVK 93

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 277 FKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSR--VQPVQPSQTSTYPGQGM 332
           ++R G DL  T  L+ +E++ G +S+ IQ +D  + L L R  +  V   +    PG GM
Sbjct: 295 YRRRGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGM 354

Query: 333 PTPKNPSQRGNLIVKYKVDYP 353
           P   +  + G+L + Y V  P
Sbjct: 355 PILGSKGKFGDLYIDYVVIKP 375

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDAQK 60
          LY +LGV+ +A + E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D +K
Sbjct: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 61 REIYDQYG 68
          R  YD YG
Sbjct: 64 RAHYDLYG 71

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 15/145 (10%)

Query: 222 KGPHG---AAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQEK---- 272
           K  HG    +E  Q+ + +  G +    I  +N+ D   + G+ KT  +  VI+E     
Sbjct: 208 KNCHGKGLLSENKQLLVSVPRGLQNKDTIRIENEAD--QEIGKSKTGDIILVIEEDTTMP 265

Query: 273 GHPNFKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLS--RVQPVQPSQTSTYP 328
              +F R G D +  L LS  E+L GF      +++DGR L LS    + ++P       
Sbjct: 266 SDVHFIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIK 325

Query: 329 GQGMPTPKNPSQRGNLIVKYKVDYP 353
            +G P     S+ G+L V  K+++P
Sbjct: 326 QEGWPVNPQASKFGDLYVIIKIEFP 350

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LG++  A+++E+K  YR+ + K+HPDK  GD E   KF EI EA+E+L+D +KR+I+
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEAHHKFIEIGEAYEVLSDPEKRKIF 82

Query: 65 DQYGLEAAR 73
          DQYG +A +
Sbjct: 83 DQYGADALK 91

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 277 FKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQ--PVQPSQTSTYPGQGM 332
           ++R G  L  T  LS +E+L G + + ++ +D  + + ++R +   V   +    PG GM
Sbjct: 281 YRRRGPHLYRTEVLSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGM 340

Query: 333 PTPKNPSQRGNLIVKYKVDYPISLNEAQKR 362
           P P      G+L ++Y V  P  ++++  R
Sbjct: 341 PQPNGKHAFGDLFIEYVVVMPHEISKSGIR 370

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  Y++LGV+PTA   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYG 68
             R  YD++G
Sbjct: 61 EDLRGKYDRFG 71

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T  YD+L VS  A+ QE+KK YRK A+K HPDK   D +   KF+E+++A+++L D
Sbjct: 1  MVKDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLID 60

Query: 58 AQKREIYDQYGLE 70
             R+ YDQ+GL+
Sbjct: 61 DDLRKKYDQFGLD 73

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV  T+ YDLLGV P + + E+KK YRK ++K HPDK   +   T+KF+ ISEA+++L+D
Sbjct: 1  MVVNTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATKKFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G + A
Sbjct: 61 KNLRSNYDKFGKDKA 75

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ Y+LLG+  TA   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
          +  R  YD++G E A
Sbjct: 61 SDLRANYDKFGKEKA 75

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LG+ P+A   E+KK YRK A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQSKFQSVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R+ YD++G + A
Sbjct: 61 DDLRKRYDEFGKDNA 75

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV ++  YDLLG+ PTA   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+ 
Sbjct: 1  MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSS 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G + A
Sbjct: 61 EELRAKYDKFGKQEA 75

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YDQ+G E A
Sbjct: 61 PGLRSKYDQFGKEDA 75

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YDLLG+ P A+  ++KK YRK A+  HPDK   D E   KF+ I EA+++L+D
Sbjct: 1  MVKDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 PDLRSRYDEFGKENA 75

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ + YD+LGVSP A+  E+KK YRK A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQAKFQRVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           + R+ YD++G + A
Sbjct: 61 EELRKRYDEFGKDYA 75

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLL +  TA   E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTEYYDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 KNLRANYDKFGKEKA 75

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 QGLRSKYDEFGKEDA 75

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 PGLRSKYDEFGKEDA 75

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV+P A   ++KK YRK A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YDQ+G + A
Sbjct: 61 PGLRSKYDQFGKDDA 75

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 PGLRSKYDEFGKEDA 75

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP A + ++KK YRK +++ HPDK   D   TE+F+ ISEA+++L  
Sbjct: 1  MVFDTTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLGS 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G + A
Sbjct: 61 DELRAKYDKFGKDEA 75

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LGV   A+++++K  YR+ + KYHPDK  GD +   +F E+ EA+E L+D +KR+IY
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHNRFIEVGEAYEALSDPEKRKIY 82

Query: 65 DQYGLEAAR 73
          DQ+G EA +
Sbjct: 83 DQFGAEALK 91

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON}
          Anc_2.218 YNL077W
          Length = 554

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          MV  T+LYD+L V   ++E  +KK YR  ALKYHPDK     E    F++ISEA+ +L++
Sbjct: 1  MVASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQMFQKISEAYVVLSN 60

Query: 58 AQKREIYDQYG 68
            KR++YD+YG
Sbjct: 61 KDKRQMYDKYG 71

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV P A   E+KK YR+ A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G + A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON}
          Anc_8.264 YLR090W
          Length = 429

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDA 58
          + LY++LGV   A + E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61

Query: 59 QKREIYDQYG 68
          +KR  YD+YG
Sbjct: 62 EKRARYDKYG 71

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 11/133 (8%)

Query: 229 EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHP----NFKRDGDDL 284
           E   + + L  G +   +I  K + D      +   L F I+E        + +R G DL
Sbjct: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286

Query: 285 IYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMPTPKNPSQ 340
           I  L LS  E++ GFSKT+ +T+DGR L L ++ P   ++P      P +G P     S 
Sbjct: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTTTS- 344

Query: 341 RGNLIVKYKVDYP 353
            G+L V   +++P
Sbjct: 345 -GDLYVVVHIEFP 356

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +L +   A+E+E+K  YR+ + KYHPDK  G  E   KF EI EA+E+L+D +K++IY
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHHKFIEIGEAYEVLSDPEKKKIY 84

Query: 65 DQYGLEAAR 73
          DQ+G +A +
Sbjct: 85 DQFGADAVK 93

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 277 FKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQPVQPSQTSTYPGQGMPT 334
           ++R G +L  T  LS  E+L G + +TI+ +D  + + LSR      S       +G   
Sbjct: 283 YRRRGHNLYRTEVLSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGM 342

Query: 335 PKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           PK     G+L + Y V  P +L+       DE
Sbjct: 343 PKGSRDHGDLYIDYVVVMPKALSHEHTMLKDE 374

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGV  TA + E+KK YRK ++  HPDK   D   TE+F+ ISEA+++L++
Sbjct: 1  MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATERFQSISEAYQVLSN 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD+ G E A
Sbjct: 61 KDLRANYDKSGKEKA 75

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLG++P A   E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L++
Sbjct: 1  MVVDTAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATERFQAISEAYQVLSN 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD+ G + A
Sbjct: 61 DELRAKYDRLGKQEA 75

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGVS TA++ ELKK +R+ AL+YHPDK   +    TE F +I  A+E+LND Q+
Sbjct: 3  TCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATETFAQIRAAYEVLNDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
          (REAL)
          Length = 460

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQ 59
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREIYDQYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGV+  A + ++KK YRK ++K HPDK   D   TE+F+ ISEA+++L+ 
Sbjct: 1  MVVDTTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATERFQAISEAYQVLSS 60

Query: 58 AQKREIYDQYGLEAA 72
           + R  YD++G E A
Sbjct: 61 EELRMKYDKFGKEEA 75

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP A   ++KK YRK +++ HPDK   D   TE+F+ IS+A+++L+ 
Sbjct: 1  MVVDTTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSK 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G E A
Sbjct: 61 DDLRAKYDKFGKEEA 75

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L V  TAN+ E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D +KR++
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKA-SEAFKIINRAFEVLSDVEKRQL 81

Query: 64 YDQYG 68
          YD+ G
Sbjct: 82 YDRIG 86

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LGV   A+E+E+K  YR+ + KYHPDK  G+ E    F E+ EA+++L+D +KR+IY
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

Query: 65 DQYGLEAAR 73
          D++G +A +
Sbjct: 82 DRHGADALK 90

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 4/100 (4%)

Query: 271 EKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTIDG-RTLPLSR--VQPVQPSQTST 326
           EK    ++R G+ L  T  LSFKE+L G + + I+  D  ++L LSR     VQ  +T  
Sbjct: 268 EKDSMGYRRRGNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEV 327

Query: 327 YPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
               GMP P    + G+LI+ Y +  P   + + K   DE
Sbjct: 328 IKSFGMPIPSATDKFGDLIIDYVILLPGEWSTSSKGYDDE 367

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}
          XDJ1Putative chaperone, homolog of E. coli DnaJ,
          closely related to Ydj1p; the authentic, non-tagged
          protein is detected in highly purified mitochondria in
          high-throughput studies
          Length = 459

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQ 59
          +LYD+LGV+  A  QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREIYDQYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 228 AEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQFVIQEKGH---------PNFK 278
           ++K  I + + PG      IT K   D          L+F + EK            NF 
Sbjct: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297

Query: 279 RD-GDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLSRVQP---VQPSQTSTYPGQGMP 333
              G+DL  ++ +S  E+L GF K + +T D R L LS V+P   V+P  T     +G P
Sbjct: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVRPGDTIKIANEGWP 356

Query: 334 TPKNPSQR-GNLIVKYKVDYP 353
              NP  R G+L V   +++P
Sbjct: 357 ILDNPHGRCGDLYVFVHIEFP 377

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDAQKR 61
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+D + +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 62  EIYDQYGLEA 71
             YD YG  A
Sbjct: 134 SRYDMYGDSA 143

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 276 NFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PLSRVQPVQPSQTSTYPGQ 330
           + +R  +DL  TL +S  ++L GFS  + +T D R L    P  +V  ++P     + G+
Sbjct: 346 HLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKV--IRPGNYFKFKGE 403

Query: 331 GMPTPKNPSQRGNLIVKYKVDYP 353
           G P   N    G++ V+  +++P
Sbjct: 404 GWPL-SNGDSFGDMYVQINIEFP 425

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ + YD+LG+ P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQSKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
           Q +  YDQ+G + A
Sbjct: 61 PQLKSRYDQFGKDDA 75

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           YD+L V  ++++ ++KK YRK A+K HPDK   P    E FK I+ AFE+L+D+QKR+I
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKA-HEAFKLINRAFEVLSDSQKRQI 80

Query: 64 YDQYG 68
          YDQ G
Sbjct: 81 YDQIG 85

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
          (REAL)
          Length = 456

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDAQ 59
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+D +
Sbjct: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68

Query: 60 KREIYDQY 67
          K+  YD Y
Sbjct: 69 KKSHYDLY 76

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LG++  A ++E+K  YR+ + K+HPDK  G+ +   KF E+ EA+E+L+D QKR+ +
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

Query: 65 DQYGLEAAR 73
          DQ+G +A +
Sbjct: 83 DQFGADAVK 91

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV P A   E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G + A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
          (REAL)
          Length = 378

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +L V   A+E+E+K  YR+ + KYHPDK +G  E   KF E+ EA+++L+D +K++IY
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEAHHKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLEAAR 73
          DQ+G +A +
Sbjct: 85 DQFGADAVK 93

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 2/95 (2%)

Query: 264 TLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQPVQP 321
            ++F  ++  +  ++R GD+L  T  LS +E+L G + +TI+  D  + + LSR   V  
Sbjct: 273 VIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVV 332

Query: 322 SQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISL 356
           S       +G   PK+    G+L + Y V  P  L
Sbjct: 333 SNGEIEVLKGFGMPKSGKGHGDLYIDYVVIMPNKL 367

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKRE 62
          + Y++L V  TAN+ E+KK YRK A++ HPDK   P   +E FK I+ AFE+L D++KR 
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRA-SEAFKLINRAFEVLGDSEKRS 80

Query: 63 IYDQYG 68
          +YD+ G
Sbjct: 81 LYDRLG 86

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV   A++ +LKK YR+ AL+YHPDK  G+    TE F  I  A+E+L+DAQ+
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILN 56
          T LY +LGV+  A + ++KK YRK AL++HPDK              KFKEIS A+EIL+
Sbjct: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61

Query: 57 DAQKREIYDQYG 68
          D  KR  YD YG
Sbjct: 62 DEDKRAHYDLYG 73

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa]
          {ON} YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig
          173] FULL
          Length = 414

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EIYDQYG 68
            YD YG
Sbjct: 64 RNYDTYG 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 73/172 (42%), Gaps = 15/172 (8%)

Query: 190 PTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---AAEKTQIDIQLKPGWKAGTK 246
           P +   ETVQ      L     GK    +   K  HG     E   +++ +  G +   +
Sbjct: 178 PGFVTRETVQCTKCRGL-----GKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDR 232

Query: 247 ITYKNQGDFNSQTGR-RKTLQFVIQEKGH-PNFKRDGDDLIYTLPLSFKESLLGFSKTI- 303
           I    +G+ + + G+    L F I E     N +R G DL   + +S  ++L GF K + 
Sbjct: 233 IVL--EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVC 290

Query: 304 QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
            T+DGR L L     Q ++P        +G P      + GN+ V+  +++P
Sbjct: 291 TTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LG+S  A+++E+K  YR+ + KYHPDK  GD E   KF E+ EA++IL D +KR+ Y
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

Query: 65 DQYGLEA 71
          D +G +A
Sbjct: 82 DVHGADA 88

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 49/74 (66%), Gaps = 3/74 (4%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILNDA 58
          V +T  YDLLGV P+A   ++KK YRK +++ HPDK   D   TE+F+ IS+A+++L+  
Sbjct: 3  VIDTTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKE 62

Query: 59 QKREIYDQYGLEAA 72
            R  YD+YG E A
Sbjct: 63 DLRAKYDKYGKEEA 76

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDAQKREIY 64
          Y +LG++  A+++++K  YR+ + KYHPDK  GD    ++F E+ EA+E+L+D +KR I+
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIF 80

Query: 65 DQYGLEAAR 73
          DQYG +  +
Sbjct: 81 DQYGADGLK 89

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 265 LQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQP--VQ 320
           ++F   +K +  ++R GD L  T  LS +E+L G +S+ I+ +D  + + L R +   V 
Sbjct: 271 VEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVH 330

Query: 321 PSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
             +    PG GMP   +    G+L V+Y V  P    +  +   DE
Sbjct: 331 HGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMPAQFKQTNQWIRDE 376

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L V+ TAN+ E+KK YRK A+K HPDK   P    E FK I+ AFE+L +++KREI
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKA-AEAFKLINRAFEVLGNSEKREI 81

Query: 64 YDQYG 68
          +++ G
Sbjct: 82 FNRIG 86

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 414

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61
          Y+ LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EIYDQYG 68
          + YD YG
Sbjct: 64 QNYDTYG 70

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 190 PTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---AAEKTQIDIQLKPGWKAGTK 246
           P +   E VQ +    L     GK    +   K  HG     E   +++ +  G + G +
Sbjct: 178 PGFVTREIVQCDKCKGL-----GKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDR 232

Query: 247 ITYKNQGDFNSQTGR-RKTLQFVIQEK-GHPNFKRDGDDLIYTLPLSFKESLLGFSKTI- 303
           +  K + D   + G+    L F I E     + +R G DL   + +S  ++L GF K + 
Sbjct: 233 VVLKGEAD--EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290

Query: 304 QTIDGRTL----PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
            T+DGR L    PL +V  V+P        +G P     S+ G++ V+  +++P
Sbjct: 291 TTLDGRLLKLKVPLGQV--VRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +L +   A E+E+K  YR+ + KYHPDK  G  E   KF E+ EA+++L+D +K++IY
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLEAAR 73
          DQ+G +A +
Sbjct: 85 DQFGADAVK 93

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 264 TLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQPVQP 321
            ++F  ++  +  ++R GD+L  T  LS  E+L G + +TI+ +D  + + LSR   V  
Sbjct: 272 VIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVV 331

Query: 322 SQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           S       +G   PK     G+L + Y V  P +    Q    DE
Sbjct: 332 SNGEVEVVKGFGMPKGSKGYGDLYIDYVVVMPKTFKSGQNMLKDE 376

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
          (REAL)
          Length = 455

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 6/72 (8%)

Query: 3  KETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65

Query: 57 DAQKREIYDQYG 68
          D +K+  YD YG
Sbjct: 66 DPEKKSHYDLYG 77

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +L +   A+E+E+K  YR+ + K+HPDK  G  E   KF E+ EA+++L+D +K++IY
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLEAAR 73
          DQ+G EA +
Sbjct: 85 DQFGAEAVK 93

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 264 TLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTID-GRTLPLSRVQPVQP 321
            ++F  ++  +  ++R GD+L  T  LS +E+L G + +TI+ +D  + + LSR   V  
Sbjct: 270 VIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWERTIEFLDENKPVKLSRPAYVGV 329

Query: 322 SQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
           S       +G   PK     G+L + Y V  P +L   Q    DE
Sbjct: 330 SNGEIEVMKGFGMPKGGKGYGDLYIDYVVIMPKTLKREQTLLKDE 374

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD LG+SP A   E+KK YRK A+  HPDK   D +   KF+ + +A+++L+D
Sbjct: 1  MVKDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSD 60

Query: 58 AQKREIYDQYGLEAA 72
             R  YD++G + A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDAQKREI 63
          + Y+LL V   A++ E+KK YRK A++ HPDK T    +E FK I+ AFE+L+D  KR +
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEAFKRINRAFEVLSDVGKRRM 83

Query: 64 YDQYG 68
          +DQ G
Sbjct: 84 FDQLG 88

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKRE 62
          + Y++L V  +A+E ++KK YRK A+K HPDK   P   +E FK+I+ AFE+L+D  KR 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRA-SEAFKKINRAFEVLSDDSKRR 80

Query: 63 IYDQYG 68
          I+DQ G
Sbjct: 81 IFDQLG 86

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           YD+L V  TA + E+KK YRK A+K HPDK   P   +E FK I+ AFE+L D +KR +
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKA-SEAFKRINRAFEVLGDEKKRVL 83

Query: 64 YDQYG 68
          +D+ G
Sbjct: 84 FDRIG 88

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV   A++ ELKK YRK AL+YHPDK   +    TEKF  I  A+E+L+D+Q+
Sbjct: 3  TCYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATEKFAIIRAAYEVLSDSQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L +   A++ E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D QKR I
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRA-SEAFKRINRAFEVLSDEQKRRI 81

Query: 64 YDQYG 68
          +DQ G
Sbjct: 82 FDQVG 86

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L V  T+ E E+KK YRK A++ HPDK   P   +E FK I+ AFE+L+D +KR I
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKA-SEAFKIINRAFEVLSDNEKRRI 80

Query: 64 YDQYG 68
          +DQ G
Sbjct: 81 FDQLG 85

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y+LL +   A++ ++KK YRK A+K HPDK   P    E FK+I+ AFE+L+D  KR++
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRA-AEAFKKINRAFEVLSDENKRKV 83

Query: 64 YDQYGLE 70
          YDQ G +
Sbjct: 84 YDQIGCD 90

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L V  +++E E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D +KREI
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKA-SEAFKVINRAFEVLSDNEKREI 81

Query: 64 YDQYG 68
          +D+ G
Sbjct: 82 FDRIG 86

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa]
          {ON} Anc_8.730 YMR214W
          Length = 393

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +LG+   A+E+ +K  YR+ + KYHPDK   D E    F EI EA+E+L+D +KR  Y
Sbjct: 31 YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNHFIEIGEAYEVLSDPEKRRTY 90

Query: 65 DQYGLEA 71
          DQ+G +A
Sbjct: 91 DQFGSDA 97

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 11/151 (7%)

Query: 212 GKKKSFKIGRKGPHG---AAEKTQIDIQLKPGWKAGTKITYKNQGD--FNSQTGRRKTLQ 266
           G   + K   K  HG     +  +I++++  G         +N GD   N++ G    +Q
Sbjct: 231 GAGSTIKNHCKKCHGQKLVTKSKEINVKVPAGAPRDFLKIVENGGDKELNAEAGDL-LVQ 289

Query: 267 FVIQEKGHPNFKRDGDDLIYTLPLSFKESLL-GFSKTIQTID-GRTLPLSRVQ--PVQPS 322
           F    + +  ++R G+DL  T  L FK+++  G+++TI   D  R + +SR    PV   
Sbjct: 290 FQEIAQNNLGYRRRGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNK 349

Query: 323 QTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
           +     G GMP  +   + G+L + Y +  P
Sbjct: 350 EIEKLVGFGMPI-QGSDRFGDLYIDYVIIVP 379

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L V   A++ E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D QKR I
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRA-SEAFKRINRAFEVLSDEQKRRI 81

Query: 64 YDQY 67
            ++
Sbjct: 82 LTRW 85

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa]
          {ON} Anc_2.218
          Length = 530

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKR 61
          T+LY +L V   A   E+K  Y+K ALKYHPDK     E   KF+EI +A+E+L+D  K+
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 62 EIYDQYG 68
           +YD YG
Sbjct: 72 LLYDTYG 78

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDAQKRE 62
          ++ Y++L V  TA++ E+KK YR+ A+K HPDK       E FK I+ AFE+L D  KR 
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEAFKVINRAFEVLGDEDKRR 81

Query: 63 IYDQYG 68
          ++DQ G
Sbjct: 82 LFDQLG 87

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y+LL V   A++ ++KK YRK A+K HPDK   P    E FK+++ AFE+L+D +KR +
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRA-AEAFKKVNRAFEVLSDEKKRRV 83

Query: 64 YDQYGLE 70
          YDQ G +
Sbjct: 84 YDQLGYD 90

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV  TA++ ELKK YRK AL++HPDK   +    TE F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATENFATIRAAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  YDLL V   A + +LK+ YRK AL YHPDK   +    TE F +I  A+E+L+DAQ+
Sbjct: 3  TCYYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQKREI 63
          Y+LLGV   A++ ELKK YRK AL+YHPDK   +    TEKF  I  A+E+L+D Q+R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATEKFAIIRAAYEVLSDPQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQKREI 63
          Y+LLGV   A++ ELKK YRK AL+YHPDK   +    T+KF  I  A+E+L+D+Q+R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAIIRAAYEVLSDSQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDAQK 60
          T  Y+LLGV   A++ ELKK YRK ALKYHPDK   + E+    F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILNDAQK 60
          T  Y+LL VS  A++ ELKK YRK AL+YHPDK    P   T  F EI  A+E+L+D Q+
Sbjct: 3  TCYYELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEATAIFSEIRAAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           Y++L +  +A++ E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D +KR +
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRA-SEAFKVINRAFEVLSDEEKRRL 83

Query: 64 YDQYG 68
          YD+ G
Sbjct: 84 YDRLG 88

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV   A++ ELKK YRK AL+YHPDK   +    T+KF  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDAQKREI 63
          + Y++L V   A + E+KK YRK A+K HPDK +    +E FK I+ AFE+L++ +KR I
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKREI 63
           YD+L V  +A+  E+KK YRK A+K HPDK   P    E FK I+ AFE+L+D +KR +
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKA-GEAFKVINRAFEVLSDDEKRSV 83

Query: 64 YDQYG 68
          +D+ G
Sbjct: 84 FDRIG 88

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV  TA + ELKK YRK AL++HPDK   +    TE F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDK-PTG---DTEKFKEISEAFEILNDAQK 60
          T  Y+LLGV   A++ ELKK YRK AL+YHPDK PT     TE F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEIFATIRTAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LLGV  TA + ELKK YRK AL++HPDK   +    TE F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATEIFATIRSAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LL V P A++ ELKK YR+ AL+YHPDK   +    TE F  I  A+E+L+D Q+
Sbjct: 3  TCYYELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATEIFASIRAAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDAQK 60
          T  Y+LLGV  TA++ +LKK YR+ AL+YHPDK   + E+    F  I  A+E+L D Q+
Sbjct: 3  TCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATTVFATIRSAYEVLADPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDAQK 60
          T  Y+LLGV  TA++ +LKK YRK AL YHPDK   + E+    F  I  A+E+L D Q+
Sbjct: 3  TCYYELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDAQKREI 63
          + Y++L V   A + E+KK YRK A+K HPDK +     E FK I+ AFE+L++ +KR I
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa]
          {ON} Anc_8.264 YLR090W
          Length = 439

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 56 NDAQKREIYD 65
          +D +KR+ YD
Sbjct: 72 SDEEKRKQYD 81

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 11/148 (7%)

Query: 215 KSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQE- 271
           K+F +   G         I + +  G      I   N+ D   + G+ KT  L FV++E 
Sbjct: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263

Query: 272 -KGHPNFKRDGD-DLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTS 325
                  KR GD DLI  L +S  +++ GF +   ++T+DGR L LS    + ++     
Sbjct: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323

Query: 326 TYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
              G+G P  KN ++ G+L +K+ +++P
Sbjct: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDAQK 60
          T  YDLL V   A++ +LKK YR+ AL+YHPDK   + E+    F EI  A+E+L+D Q+
Sbjct: 3  TCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           YDLLGVS TA+++E+K  YRK +LK+HPDK   D          E + +IS+A+E L D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 59  QKREIYDQYG 68
             ++ Y  YG
Sbjct: 182 LVKQNYLMYG 191

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDAQKREI 63
          + Y++L V   A + ++KK YRK A+K HPDK +     E FK I+ AFE+L++ +KR I
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDAQK 60
          T  Y+LL V  TA++ +LKK YR+ AL+YHPDK   +    T+ F  I  A+EIL+D Q+
Sbjct: 3  TCYYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATDIFANIRTAYEILSDPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RVWYDSH 69

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILNDA 58
           YDLLG+SP+A+++++K  YR+ +LK+HPDK          T   E + +IS+A E L D 
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 59  QKREIYDQYG 68
             RE Y +YG
Sbjct: 187 IVRENYLKYG 196

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDAQK 60
          T  Y+LLGV   A + ELKK YR+ AL++HPDK   + E+    F  +  A+E+L D Q+
Sbjct: 3  TCYYELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETTAIFASVRAAYEVLADPQE 62

Query: 61 REIYDQY 67
          R  YD +
Sbjct: 63 RAWYDDH 69

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDAQKRE 62
          + Y +L V   A + E+KK YRK A+K HPDK   P   +E FK I+ AFE+L++ +KR 
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKA-SEAFKIINRAFEVLSNEEKRG 79

Query: 63 IYDQYG 68
          +YD+ G
Sbjct: 80 LYDRIG 85

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
          (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61
          Y++LGV+  A  +E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D  KR
Sbjct: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 62 EIYDQ 66
            YD 
Sbjct: 74 NEYDN 78

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 233 IDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQE--KGHPNFKRDGDDLIYTL 288
           I + +  G   G  I  K + D   + G++    L F I E    + + +R G+ LI   
Sbjct: 222 IVVSIPRGSSNGDNIILKGEAD--EELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHT 279

Query: 289 PLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNL 344
            +S  E++ GF     ++T D R L LS  + + ++P        +G P  K  +  GNL
Sbjct: 280 HISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNL 339

Query: 345 IVKYKVDYP 353
            V  ++++P
Sbjct: 340 YVILEIEFP 348

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
          similar to uniprot|Q12014 Saccharomyces cerevisiae
          YLR090w
          Length = 452

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 57 DAQKREIYDQ 66
          DA  R  YDQ
Sbjct: 64 DASLRAEYDQ 73

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPD-KPTG--DTEKFKEISEAFEILND 57
          MV +T  YD+LGV+P+A  ++  K YR  A++ HPD  PT      KF+E+S+A+++L+D
Sbjct: 1  MVLDTTYYDILGVTPSAFAEQNNKAYRMKAIQTHPDMNPTHPYAHAKFQEVSKAYKVLSD 60

Query: 58 AQKREIYDQYGLEAAR 73
             +  Y ++GL   R
Sbjct: 61 PDLKNRYTEFGLSDER 76

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa]
          {ON} Anc_8.730
          Length = 376

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREIY 64
          Y +L +   A +++++  YR+ + KYHPDK   D +   KF E+ +A+EIL+D +KR+ Y
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHHKFIEVGQAYEILSDPEKRQRY 83

Query: 65 DQYGLE 70
          DQ+G E
Sbjct: 84 DQFGPE 89

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 265 LQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLG-FSKTIQTIDGRTLPLSRVQP---VQ 320
           ++F   +K +  ++R G  L  T  L+  E+L G + + +  +D   +   + +P   +Q
Sbjct: 270 IEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQ 329

Query: 321 PSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366
             +T    G GMP        G+L + Y V  P SL+  + R  DE
Sbjct: 330 NGETERIAGFGMPLGNGRKGFGDLFIDYVVVMPESLSGEELRMRDE 375

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%), Gaps = 2/61 (3%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQKREIYD 65
          Y +LGV  +A++ E+KK Y K A +YHPD  K  G  +KF ++  A+EIL+D  KR+ +D
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGAEKKFHDLQNAYEILSDESKRKQFD 96

Query: 66 Q 66
          Q
Sbjct: 97 Q 97

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 275 PNFK-RDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMP 333
           P F  RD  D+ YT+ +    + LG +  + T+DG  + L      Q     T P  G+P
Sbjct: 337 PTFTIRDKSDIWYTMEIPITTAALGGTVQVPTVDGSHIRLKVAPGTQSGDVITVPNMGVP 396

Query: 334 TPKNPSQRGNLIVKYKV 350
                  RG + V+Y++
Sbjct: 397 RSNLTRSRGAMKVQYRI 413

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y+LLG+S +A+E+++K  YRK ++K+HPDK + D          E + +I++A+E L D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 59  QKREIYDQYG 68
             RE + +YG
Sbjct: 191 AMRENFLKYG 200

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILNDAQKREIYD 65
          YD++GV    ++++LK  Y++   K HPDK +  G  E F  + +A++ L++ QKR +YD
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEAFALVHKAYKTLSNKQKRAMYD 84

Query: 66 QYGLEA 71
          +YG +A
Sbjct: 85 KYGNDA 90

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQKREIYD 65
           Y  LGVS  A+  ++K+ Y K A KYHPD  K  G  + F  +  A+EIL+D +K+  YD
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKTFHNLQNAYEILSDEKKKLQYD 109

Query: 66  QYGLEA 71
           QYG  A
Sbjct: 110 QYGSSA 115

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 262 RKTLQFVIQEKGHPNFKRDGDDLIYTLP-LSFKESLLGFSKTIQTIDGRTLPLSRVQPVQ 320
           R  L   I+ K  P F       I+T+  +    + LG +  I+T+DG+ + L  +   Q
Sbjct: 324 RGDLLVRIRVKSDPKFFVKNKYDIWTIKEIPITTAALGGTVEIETVDGKNIRLKVISGTQ 383

Query: 321 PSQTSTYPGQGMPTPKNPSQRGNLIVKYKV 350
             Q ++ P  G+P  +N + RGN+ V+YK+
Sbjct: 384 HDQVTSIPNMGIPY-RNGTGRGNMNVQYKI 412

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 10/73 (13%)

Query: 5  TKLYDLLGVSP-------TANEQELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEI 54
            LY +LG SP         +  +++K YRK AL+YHPDK   DT    KF ++S A +I
Sbjct: 13 VNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKNPHDTSLIHKFHQVSVATKI 72

Query: 55 LNDAQKREIYDQY 67
          L+D++ R +YD +
Sbjct: 73 LSDSRLRSLYDSW 85

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQKREIYD 65
           Y+ LGV+  A+  ++KK Y K A ++HPD  K  G  +KF ++  A+EIL+D  KR  YD
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQYD 102

Query: 66  QY 67
           Q+
Sbjct: 103 QF 104

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 261 RRKTLQFVIQEKGHPNFK-RDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPV 319
           RR  L   +Q +  P F+ ++  D+ Y   +    + LG + +I T+DG  + L  +   
Sbjct: 312 RRGDLLVQVQVERDPRFQIKNNYDIWYVQEIPITTAALGGTVSIPTVDGDQIRLKVIPGT 371

Query: 320 QPSQTSTYPGQGMPTPKNPSQRGNLIVKYKV 350
           QP Q  + P +G+P   + + RG++ V+Y++
Sbjct: 372 QPDQVVSIPNKGVPRGLSGA-RGDMKVQYRI 401

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILNDA 58
           YD+LG+S +A+E+E+K  YRK ++K+HPDK          T   E + +I++A+E L D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 59  QKREIYDQYG 68
             R+ + +YG
Sbjct: 181 LTRQNFLKYG 190

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y LLGVSP+A ++++K  YRK ++K+HPDK + D          E + +IS+A+E L D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 59  QKREIYDQYG 68
             +  Y  YG
Sbjct: 185 ITKANYLTYG 194

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y+LLG+S +A+++++K  YRK ++K+HPDK + D          EK+ +I++A+E L D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 59  QKREIYDQYG 68
             +E + +YG
Sbjct: 183 VIKENFLKYG 192

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 4  ETKLYDLLGV---SPTANEQELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          +  LYD+LG    + T    E+KK YR  ALKYHPDK   D    EKF +I+ A  IL +
Sbjct: 12 KVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVEKFHKITIALNILTN 71

Query: 58 AQKREIYDQY 67
           Q +  YD++
Sbjct: 72 NQLKTEYDKW 81

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 7/70 (10%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT----EKFKEISEAFEILNDAQKREI 63
          Y++LGV+ +  E+ELKK YRK  L+ HPDK    T    EKF +I  AFE+L+  + +E 
Sbjct: 16 YEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTPEAKEKFHKIQFAFEVLD--KFKET 73

Query: 64 YDQYG-LEAA 72
          YD+ G +EA 
Sbjct: 74 YDKTGSVEAC 83

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDAQ 59
           Y +LGVSP AN +E++K Y     KYHPDK   +         E   +I+EA+E L+D  
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 604 KRKEYD 609

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON}
          Anc_8.264 YLR090W
          Length = 432

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 6/57 (10%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDA 58
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++ 
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNG 63

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 210 FVGKKKSFKIGRKGPHGAA---EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQ 266
           +  K  S K   K  HG     EK Q+ + +  G +    I +K +GD + +T R   + 
Sbjct: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260

Query: 267 FVIQEKGHPN-------FKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLSRVQ 317
           F ++    PN         ++G DL   + +   E++ G       +T D R L L+  Q
Sbjct: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320

Query: 318 P--VQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353
              ++P  T    G+G P   N ++ G++ V   V++P
Sbjct: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 9/73 (12%)

Query: 4  ETKLYDLLGVSPTANE-------QELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEI 54
          +  LYD L ++  + E        +L+K YR+ ALKYHPDK T     EKF +I  AF++
Sbjct: 11 DINLYDELQIAILSKEDLNNVSISQLRKQYRQMALKYHPDKSTAPNAQEKFLKIKLAFDV 70

Query: 55 LNDAQKREIYDQY 67
          L+D+  R+ Y+Q+
Sbjct: 71 LSDSDSRKRYNQW 83

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDAQ 59
          + +T  Y +LG++PTA+  ++KK Y+K A + HPDK   +  +E FK + +A+ IL+D +
Sbjct: 3  IDKTTHYSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSELFKIVVDAYSILSDVK 62

Query: 60 KREIYD 65
          +RE Y+
Sbjct: 63 EREEYN 68

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y++LGVS +A ++E+K  YRK ++K+HPDK   D          E + +I++A+E L D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 59  QKREIYDQYG 68
             +E Y +YG
Sbjct: 184 NVKENYLRYG 193

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON}
          Anc_2.218
          Length = 494

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MV++TKLY+ L V  TA   ++KK Y+K ALKYHPDK     +   KF+ + +A+EILND
Sbjct: 1  MVRDTKLYETLNVPITATTLDIKKAYKKLALKYHPDKNNHSEDSKTKFQAVCQAYEILND 60

Query: 58 AQKREIYDQYGL 69
           Q R IYD  G+
Sbjct: 61 KQSRAIYDALGI 72

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%), Gaps = 9/67 (13%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILNDA 58
           Y +LG+ P A+++E++K Y     KYHPDK            + EK  EI+EA+E+LND 
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 59  QKREIYD 65
           +KR+ YD
Sbjct: 603 EKRKEYD 609

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPD---KPTGDTEKFKEISEAFEILND 57
          MV     Y++LGV    NE ++KK Y+   L  HPD   K  G+    +EI EA+ +L +
Sbjct: 1  MVNNRSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDVGNKVLIEEIKEAYRVLIE 60

Query: 58 AQKREIYDQ 66
          +  RE YD+
Sbjct: 61 SPSREKYDK 69

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK-PTGDTE--------KFKEISEAFEILNDA 58
           Y+LLG+S +A+++++K  YRK +LK+HPDK P G +E        ++ +I++A+E L D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 59  QKREIYDQYG 68
             R  Y  YG
Sbjct: 183 LIRFNYLTYG 192

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDA 58
          ++ ET  Y  LG+S  ANE E+ K Y   A + HPDK   +   E+FK IS A  +L D 
Sbjct: 8  ILDETTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQFKLISHAHSVLMDE 67

Query: 59 QKREIYDQ 66
           KR  YD+
Sbjct: 68 AKRLKYDE 75

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDAQ 59
           Y +LGVSP+A+ +E++K Y     KYHPDK   +         E   +I+EA+E L+D  
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDAQ 59
          + ET  Y  LG+S  A+++E+ K Y K A + HPDK   D   E FK IS A  +L D +
Sbjct: 9  LDETTYYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAELFKLISHAHSVLMDKE 68

Query: 60 KREIYDQ 66
          K++ YD+
Sbjct: 69 KKDAYDK 75

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y++LGV+ ++ E+E+KK YR  +LK+HPDK   +          E F +IS+A+E L + 
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 59  QKREIYDQYG 68
             +E Y  YG
Sbjct: 183 ATKENYLLYG 192

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y+LLGV+ ++ ++E+K  YRK ++K+HPDK + D          E+F  I++A++ L D 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 59  QKREIYDQYG 68
             +E Y +YG
Sbjct: 173 ITKENYRKYG 182

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDAQ 59
          + ET  Y +LG+ P A + E++K Y K A K HPDK   DT  E FK +  A  IL D +
Sbjct: 14 LDETTYYSILGLHPQATDNEIRKSYMKFARKLHPDKSKSDTCAELFKLVVHAHSILTDKE 73

Query: 60 KREIYDQ 66
           +  YD+
Sbjct: 74 LKLEYDR 80

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa]
          {ON} Anc_8.730 YMR214W
          Length = 384

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 8  YDLLGVSPTAN-EQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKREI 63
          Y +LG++     E+E+K  YRK + KYHPDK   D +    F ++ EA+++L D  K+  
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIKVGEAYDVLGDPDKKRQ 85

Query: 64 YDQYGLEA 71
          YDQ G +A
Sbjct: 86 YDQMGHDA 93

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 277 FKRDGDDLIYTLPLSFKESLLG-FSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQ----- 330
           ++R G++L  T  +S  E+L G + +T+  +D    P  R+   +    + Y G+     
Sbjct: 294 YRRRGNNLFRTEYISLNEALYGNWERTLDFLD----PKKRINLKRSPNVTIYDGEIEILK 349

Query: 331 --GMPTPKNPSQRGNLIVKYKVDYP 353
             GMP P   ++ G+L + YKV  P
Sbjct: 350 GFGMPIPNKKNKFGDLYIDYKVIIP 374

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDAQ 59
          + ET  Y +LG++P A + E++K Y K A + HPDK   D+  E FK +  A  IL D +
Sbjct: 3  LDETTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEE 62

Query: 60 KREIYD 65
           +  YD
Sbjct: 63 TKRKYD 68

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPTANEQELKKGYRKAALKYHPDKP----TGD-----TEKFKEISEAF 52
           TKL+D   +LG+S +A+++++K  YRK ++K+HPDK     T D      E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAY 180

Query: 53  EILNDAQKREIYDQYG 68
           E L D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y+LLG+  +A E+E++  YRK ++K+HPDK + D          E++  I++A++ L + 
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 59  QKREIYDQYG 68
             RE Y +YG
Sbjct: 177 VTRENYLKYG 186

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQ 59
          + +T  Y +LG++  A E ++KK YRK A+  HPD  K     E FK +S A  +L D +
Sbjct: 8  IDQTTHYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKE 67

Query: 60 KREIYDQ 66
          +R+ Y++
Sbjct: 68 QRQSYNR 74

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPTANEQELKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LGVS +A+++++K  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAY 180

Query: 53  EILNDAQKREIYDQYG 68
           E L D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK----PTGD-----TEKFKEISEAFEILNDA 58
           Y++LG+S +A+++++K  YRK ++K+HPDK     T D      E + +I++A+E L D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 59  QKREIYDQYG 68
             R+ Y +YG
Sbjct: 187 LVRQNYLKYG 196

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFK--EISEAFEILNDAQKREIYD 65
          Y++L V       ELKK YR   L  HPDK    T K+   +I EA+ IL+D   R+ YD
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTTSKYSIDQIKEAYRILSDPVSRKTYD 66

Query: 66 QYGLEAAR 73
           + LE  +
Sbjct: 67 AHLLEEGK 74

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 11/72 (15%)

Query: 7   LYDLLGV-SPTANE---QELKKGYRKAALKYHPDKPTGDTE-------KFKEISEAFEIL 55
           LYD+LG+ S   +E   +E+K+ Y+K  L+YHPDK     E       +F  +  AF+IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 56  NDAQKREIYDQY 67
            D+  R  YDQ+
Sbjct: 143 CDSSLRTQYDQW 154

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPTANEQELKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LG+S +A+++++K  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAY 180

Query: 53  EILNDAQKREIYDQYG 68
           E L D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQ 59
          V ET  Y +LG+   A+E ++KK YR+ A+  HPD  K     E FK +S A  +L D +
Sbjct: 8  VDETTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAEMFKLVSHAQSVLIDKE 67

Query: 60 KREIYDQ 66
           R  Y++
Sbjct: 68 LRRTYNR 74

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y LL VS ++ ++E++  YRK ++K+HPDK + D          E++  I++A++ L D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 59  QKREIYDQYG 68
             RE Y +YG
Sbjct: 179 VTRENYLKYG 188

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDAQ 59
           Y +L V+P A  ++++K Y     KYHPDK           + E+  EI+EA+EIL+D  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 565 KRKEYD 570

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDAQ 59
           Y  LGV+P+A  +E++K Y     KYHPDK   +         E   +I+EA+E L+D  
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDAQKR 61
          Y++L +   A ++E+KK YR   L  HPDK T +T          +I +A++IL++ QKR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 62 EIYDQYGLE 70
            YD+  LE
Sbjct: 70 GEYDKTILE 78

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDAQ 59
           Y +LGV+P A  +E++K Y     KYHPDK   +         E   +I+EA+E L+D  
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 597 KRKEYD 602

>KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92
          YGL128C
          Length = 277

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 21 ELKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILNDAQKREIYDQY 67
          +LK+ YRK +LKYHPDK T  + E+F  +S A +IL +   R +YD++
Sbjct: 34 DLKRQYRKLSLKYHPDKTTDQNAERFHAVSMAMQILGEDHLRSVYDKW 81

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 5  TKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDAQKRE 62
          T  Y +LG++P A + E++K Y   A K HPDK   +   E FK +  A  IL D +K+ 
Sbjct: 12 TTHYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGELFKLVVHAHSILTDVEKKR 71

Query: 63 IYDQYGLEAA 72
           YD   L++ 
Sbjct: 72 AYDAELLKSG 81

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDAQ 59
           Y +L V   AN ++++K Y +   KYHPDK           + EK   I+EA+EIL+D  
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 569 KRKEYD 574

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y LL +S ++ ++E++  YRK ++K+HPDK + D          E++  I++A++ L D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 59  QKREIYDQYG 68
             RE Y +YG
Sbjct: 177 ITRENYLRYG 186

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILNDAQKREIYD 65
          YD+LG++  A   E+++ YR+  L+ HPDK  G D      I +A+ +L+D  +R  YD
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAYD 64

>Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON}
          (110867..111739) [873 nt, 291 aa]
          Length = 290

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 9  DLLGVSPTANE---QELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDAQKRE 62
          DL+G     NE    E++K YR+ ALKYHPDK   + +    F +IS A +IL D+  RE
Sbjct: 23 DLVGNRRQPNEITLTEIRKEYRRLALKYHPDKNISNVDIDSIFHDISLANQILCDSSLRE 82

Query: 63 IYDQYGL 69
           YD++ +
Sbjct: 83 QYDKWYI 89

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSPT---ANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     AN+ ++ K +RK  LKYHPDK + +         FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGIFKIIQKAFE 153

Query: 54  ILNDAQKREIYDQYGLEA 71
            L D+ KR  YD    +A
Sbjct: 154 TLTDSTKRAQYDSCDFQA 171

>ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR061C
          Length = 305

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 10/70 (14%)

Query: 8   YDLLGVSPTA-NEQELKKGYRKAALKYHPD------KPTGDTEK---FKEISEAFEILND 57
           Y++LG+  T  + ++LKK Y + A  YHPD      +  G+ E+   FK ++EA+ +L+D
Sbjct: 93  YEVLGLVKTGVDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSD 152

Query: 58  AQKREIYDQY 67
           A +R +YD Y
Sbjct: 153 ASRRRMYDMY 162

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSPT---ANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A E ++ K +RK  LKYHPDK +           FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGASLDQDGFFKIIQKAFE 153

Query: 54  ILNDAQKREIYDQYGLEA 71
            L D  KR  YD    EA
Sbjct: 154 TLTDPTKRSQYDSCDFEA 171

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDAQ 59
          + +T  Y LLGV   A  +E+ K YRK A+K HPDK   D   E FK +  A  +L + +
Sbjct: 5  LDKTTHYSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEELFKLVVHAHSVLTNGE 64

Query: 60 KREIYDQ 66
          +R  Y++
Sbjct: 65 ERAKYNK 71

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDAQ 59
           Y +LGV   A  ++++K Y     KYHPDK           + EK  EI+EA+EIL+D  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 567 KRKEYD 572

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 10/71 (14%)

Query: 7  LYDLLGVSPTANEQ-------ELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILN 56
          LY LL VS ++ E+       +L+  +R+ AL+YHPDK   DT   +KF  + +A++IL+
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 57 DAQKREIYDQY 67
          ++  R  Y+++
Sbjct: 76 NSSLRATYNRW 86

>Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON}
          (79675..81237) [1563 nt, 521 aa]
          Length = 520

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDAQ 59
          + ET  Y +LG+  TAN++++ K Y + A K HPDK   +   E FK + +A  IL D  
Sbjct: 3  IDETTYYSVLGLPTTANKKDIHKSYLRLARKLHPDKSKSNDFEELFKVVVQAHSILTDIS 62

Query: 60 KREIYD 65
           ++ YD
Sbjct: 63 SKQEYD 68

>KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 433

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSPT---ANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A  Q++ K +RK  LKYHPDK +           FK I +A+E
Sbjct: 94  KTADLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGASLDQDGFFKIIQKAYE 153

Query: 54  ILNDAQKREIYDQYGLEA 71
            L D+ KR  YD    EA
Sbjct: 154 TLTDSNKRPQYDSCDFEA 171

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           Y LLGV+ +A ++E++  YRK ++K+HPDK   D          E++  I++A++ L D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 59  QKREIYDQYG 68
             +E Y ++G
Sbjct: 178 ITKENYLKFG 187

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (44%), Gaps = 16/143 (11%)

Query: 232 QIDIQLKPGWKAGTKITYKNQGDF----------NSQTGRRKTLQFVIQEKGHPNFK-RD 280
           +ID+ L  G + G  +   +QG F          ++   RR  L   I+ +  P F+ R+
Sbjct: 289 EIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDPRFQIRN 348

Query: 281 GDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQ 340
             D+ YT  +    + LG    I T+DG  L L      Q  Q  + P +G+P     S 
Sbjct: 349 NYDIWYTQDIPITTAALGGVVNIPTVDGEQLRLKIAPGTQHEQVVSVPNKGVPKGLTAS- 407

Query: 341 RGNLIVKYKVDYPISLNEAQKRA 363
           RG++    KV Y ISL + Q +A
Sbjct: 408 RGDM----KVQYKISLRKPQSKA 426

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDAQKREIYD 65
           Y+ LGVS  A+  ++KK Y K A KYHPD  K  G  +KF ++  A+EIL+D  KR  YD
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEGAEKKFHDLQNAYEILSDESKRSQYD 112

Query: 66  QYGLEA 71
           Q+G  A
Sbjct: 113 QFGAAA 118

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--------EKFKEISEAFEILNDAQ 59
           Y +LG+   AN +++++ Y     KYHPDK    +        EK   I+EA+E+L+D  
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 60  KREIYD 65
           KR+ YD
Sbjct: 571 KRKEYD 576

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTG--------DTEKFKEISEAFEILNDAQ 59
           Y +LGV  +A  +++++ Y +   K+HPDK           + EK  EI+EA+EIL+D  
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 60  KREIYD 65
           KR  YD
Sbjct: 590 KRTKYD 595

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61
          Y++L +   A ++E+K+ YR   L  HPDK T +T          +I +A+ IL+D + R
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 62 EIYDQYGLE 70
            YD+  LE
Sbjct: 70 CEYDRLILE 78

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDAQ 59
           Y +LGV+  ++ + ++K Y     KYHPDK           + EK  EI+EA+EIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 60  KREIYD 65
           K++ YD
Sbjct: 616 KKKEYD 621

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDAQKREIYD 65
          Y +LGV   A+  E++K Y K A K HPDK   +   E FK + +A  ILN+ Q R  YD
Sbjct: 14 YSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAELFKLVVDAHSILNNDQLRAEYD 73

Query: 66 Q 66
          +
Sbjct: 74 K 74

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKE--------ISEAFEILNDAQ 59
           Y +LG+S  A+ +E++K Y     KYHPDK    +EK +E        ++EA+EIL+D  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 60  KREIYD 65
           K+  YD
Sbjct: 584 KKRDYD 589

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDAQKR 61
          Y  L +S  A + ++KK YR+  L+YHPDK + D       ++F ++  ++E+L   + R
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVL--TKFR 71

Query: 62 EIYDQYG-LEAA 72
          EIYD+ G +EA 
Sbjct: 72 EIYDKSGSIEAC 83

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDA 58
           YD+LG+S +++++++K  YRK ++K+HPDK + D          EK+ +I++A+E L D 
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 59  QKREIYDQYG 68
             RE Y +YG
Sbjct: 184 TVRENYLKYG 193

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT--------EKFKEISEAFEILNDAQ 59
           Y  LGVS  AN +++++ Y +   KYHPDK    +        EK   I+EA+E L D  
Sbjct: 506 YKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLRDDS 565

Query: 60  KREIYDQYGLEAA 72
           KR+ YD    E A
Sbjct: 566 KRKEYDMVRSEGA 578

>Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig
          244] FULL
          Length = 284

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 6/63 (9%)

Query: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT----EKFKEISEAFEILNDAQKREI 63
          Y+ L V  + +E +L+K YRK  L YHPDK    T    EKF +I  AFEIL   + R+I
Sbjct: 14 YEELQVETSVSEAQLRKSYRKRMLLYHPDKTKDWTPEAKEKFHKIQFAFEIL--TKFRDI 71

Query: 64 YDQ 66
          +D+
Sbjct: 72 FDR 74

>Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..5743)
           [1299 nt, 433 aa]
          Length = 432

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 3   KETKLYDLLGVSPT---ANEQELKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S     A++ ++ K +RK  LK+HPDK   +G   +   FK I +AFE 
Sbjct: 94  KSADLYAAMGLSKLRFKASDAQIIKAHRKQVLKHHPDKISASGGLNQDGFFKIIQKAFET 153

Query: 55  LNDAQKREIYDQYGLEA 71
           L D+ KR  YD    EA
Sbjct: 154 LTDSTKRSQYDSCDFEA 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,442,456
Number of extensions: 1198168
Number of successful extensions: 3513
Number of sequences better than 10.0: 369
Number of HSP's gapped: 3251
Number of HSP's successfully gapped: 484
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)