Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.3072.286ON49049025020.0
Suva_14.3252.286ON49049022660.0
YNL022C2.286ON49048921980.0
Smik_14.3092.286ON49049021960.0
NDAI0G006602.286ON49649718210.0
Kpol_1003.382.286ON49649618060.0
KAFR0H033102.286ON48849117670.0
NCAS0G037902.286ON49249617120.0
TPHA0C034002.286ON49449317080.0
KNAG0H020002.286ON49849617040.0
TBLA0B069602.286ON50850616670.0
CAGL0M06941g2.286ON49249516640.0
TDEL0G021702.286ON48448916620.0
SAKL0E07678g2.286ON47749016170.0
KLLA0E08361g2.286ON49149615880.0
Kwal_27.115322.286ON47949215490.0
Ecym_33252.286ON49649315490.0
ZYRO0A01892g2.286ON46549115380.0
KLTH0G10362g2.286ON52948915280.0
ADL215W2.286ON48449314700.0
CAGL0J10032g2.247ON6192771643e-11
Kpol_1003.152.247ON6333481633e-11
ZYRO0A01562g2.247ON6172771616e-11
SAKL0E08624g2.247ON6112391591e-10
TPHA0C031502.247ON6082431582e-10
KAFR0J009702.247ON6102431562e-10
ADL254W2.247ON6031991562e-10
KNAG0I018702.247ON6292391553e-10
TBLA0E038502.247ON6322391544e-10
Smik_14.2662.247ON6183131544e-10
Suva_14.2802.247ON6203131544e-10
KLLA0F03399g2.247ON6193171536e-10
YNL061W (NOP2)2.247ON6183131536e-10
Kwal_23.48412.247ON6272811527e-10
NCAS0G030302.247ON4902031518e-10
NDAI0D010502.247ON6252391511e-09
Skud_14.2712.247ON6193131511e-09
KLTH0G09460g2.247ON6372031511e-09
Ecym_32842.247ON6062431492e-09
TDEL0C041502.247ON6142391455e-09
AFR179C8.171ON7002951402e-08
KNAG0G015108.171ON6662961367e-08
TBLA0A087408.171ON6863031295e-07
ZYRO0G08998g8.171ON6832981286e-07
TPHA0C028708.171ON6742981286e-07
KLTH0H08096g8.171ON6882951279e-07
NDAI0B018308.171ON6863021251e-06
KAFR0B022208.171ON6862991232e-06
Ecym_23538.171ON6902951233e-06
TPHA0H001508.171ON6493031224e-06
TDEL0B043908.171ON6733001214e-06
KNAG0D020508.171ON6823001214e-06
SAKL0H19448g8.171ON6912971198e-06
NCAS0B056408.171ON6593021124e-05
Kpol_1002.1098.171ON6703001116e-05
NCAS0B043908.171ON6713001116e-05
Smik_2.928.171ON6743021108e-05
CAGL0K01991g8.171ON6722941091e-04
Suva_2.978.171ON6703031063e-04
YBL024W (NCL1)8.171ON6842991053e-04
Skud_2.818.171ON6813001028e-04
NDAI0B029808.171ON6793051010.001
KLLA0F12562g8.171ON704301990.002
KLTH0H03102g6.261ON47039723.1
Kwal_56.242706.261ON47039723.2
Ecym_30036.1ON31983713.2
ZYRO0F13486g1.251ON161058714.1
KNAG0L024406.1ON31788704.7
NCAS0B078001.251ON168926697.3
TDEL0D012701.251ON155127697.4
Kwal_23.4862na 1ON173153697.6
TBLA0H029901.251ON174826698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.307
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   968   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   877   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   851   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   850   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   706   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   700   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   685   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   664   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   662   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   660   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   646   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   645   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   644   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   627   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   616   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   601   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   601   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   597   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   593   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   570   0.0  
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    68   3e-11
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    67   3e-11
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    67   6e-11
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    66   1e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    65   2e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    65   2e-10
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    65   2e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    64   3e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    64   4e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    64   4e-10
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    64   4e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    64   6e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    64   6e-10
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    63   7e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    63   8e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    63   1e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    63   1e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    63   1e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    62   2e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    60   5e-09
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    59   2e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    57   7e-08
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    54   5e-07
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    54   6e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    54   6e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    54   9e-07
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    53   1e-06
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    52   2e-06
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    52   3e-06
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    52   4e-06
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    51   4e-06
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    51   4e-06
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    50   8e-06
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    48   4e-05
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    47   6e-05
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    47   6e-05
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    47   8e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    47   1e-04
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    45   3e-04
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    45   3e-04
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    44   8e-04
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    44   0.001
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    43   0.002
KLTH0H03102g Chr8 (275767..277179) [1413 bp, 470 aa] {ON} highly...    32   3.1  
Kwal_56.24270 s56 complement(930311..931723) [1413 bp, 470 aa] {...    32   3.2  
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    32   3.2  
ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa...    32   4.1  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    32   4.7  
NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa]...    31   7.3  
TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {...    31   7.4  
Kwal_23.4862 s23 complement(898390..903585) [5196 bp, 1731 aa] {...    31   7.6  
TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {...    31   8.3  

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/490 (96%), Positives = 471/490 (96%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSEMV       VRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
           NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCFERK
Sbjct: 481 GFFAVCFERK 490

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/490 (87%), Positives = 456/490 (93%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAK RISGSMQTLVL+SCK+YKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILE+IPKKKGKPLF+R            SKQKRIQMGKHPIK+YVLKFKSP
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSEMV       VRDLSE+VLSEDI NDLPPVRWIRINPLKCHP+G+TEPVLAEL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T KV+ WS+LVPGSIY+DEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G++DIVIDACSAPGNKTTHTASYI S PPKD  I+IYAFEKDPERAKILQKM+KVAGCS+
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
           NIDV VGDFTKLATP+KCKG TGFIVDPSCSGSGIFGRKFFDSLN+RK+DEKDD++D +P
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           DKAVQEWGWKVA RTEV+PSWPRRGKVEEF EVFRDG+AH+P+QLAEGCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCF RK
Sbjct: 481 GFFAVCFVRK 490

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/489 (85%), Positives = 447/489 (91%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVL+SCK+YKLKSNPKHIYAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKA ILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSEMV       VR+LSE+VLSEDI+NDLPPVRWIRINPLKCHPNG+TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           TLKV+KWS+LVPGSIYYDE+IPNLFGIHP+DKITAHELYKHGKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G  DIVID+CSAPGNKTTHTASYI   PPKDN  RIYAFEKDPERAK+LQKM+K+AGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
           NI V VGDFTKLATP+K K  T FIVDPSCSGSGIFGRKFFDS N+RK+D+KDDD  ++P
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEF+AKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           DK+V+EWGWKVAP+ EVIPSWPRRGKVEEF EVFRDG  ++P+QLAEGCIRALPK DGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/490 (87%), Positives = 456/490 (93%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLEDIEKEAAKERISGSMQTLVL+SCK+YKLKSNPKH+YAVLDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKKARILEDIPKKKGKPLFSR            SKQKRIQMGKHPIKDYVLKFKSP
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSEMV       VR+LSE+VLSEDI NDLPPVRWIRINPLKC+PNG TEPVLAELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           TLKV KWS+LVP SIYYDEYIPNLFGIHP+DKITAHELYK+GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G +DIVIDACSAPGNKTTHTASYICS PPKD+  RIYAFEKDPERAKILQKM+K+AGCSS
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
           NIDV VGDFTKLATP+K K ATGFIVDPSCSGSGIFGRKFFDSLN++KMD+KDDDND++P
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           DKAVQEWGW+VAPR+EVIP WPRRGKVEEF EVFR+G AH+P++LAEGCIRALPK+DGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 481 GFFAVCFERK 490
           GFFAVCFERK
Sbjct: 481 GFFAVCFERK 490

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/497 (69%), Positives = 405/497 (81%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC KYKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL+DIPKKKGKP++SR            SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSE+V       V++LSE+V + D T D+ PVRWIRINPL+C+   D   VL EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V  W+D+VPGSIYYDEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICS-GPPKDNIIRIYAFEKDPERAKILQKMVKVAGCS 299
             DDI+IDAC+APGNKTTH ASY+      +D  ++IYAFEKDPERAKIL+KM+KVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 SNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDD----- 354
            NI V VGDFTK ATPDK K  TGFIVDPSCSGSGIFGRK+ DSLN+++ ++  D     
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 355 --DNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENE 412
             ++D +PDEQE++  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 413 RVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRA 472
           RVV+DLLLD  V++WGWKVA +  VIP+WPRRGK+EEF EVFRD  A   + LA+GCIRA
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA-KCQALADGCIRA 479

Query: 473 LPKEDGGIGFFAVCFER 489
           LP++DGGIGFFAVCFER
Sbjct: 480 LPRDDGGIGFFAVCFER 496

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/496 (67%), Positives = 401/496 (80%), Gaps = 8/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVL+SCKKYK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMK++ IL+DIP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSE+V       VRDLSE++  E+  +D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +VN WSD+VPG+IY+D+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHIL+P
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G +DIVIDAC+APGNKTTHTASYI  GP KD   +IYAFEKDPERAKILQ M+KVAGCS+
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDE-----KDDD 355
            I V VGDFTK+ATP+K +  TGFIVDPSCSGSGIFGRK+ DS+NK+K +        DD
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 356 NDVIPDEQEEF--MAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413
            D +PDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 414 VVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRAL 473
           VVIDLLLDK VQEWGWKVAPR+EVIP+WPRRG   EF +VFRD      ++LA+GCIR L
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRD-EDEKCQELADGCIRVL 479

Query: 474 PKEDGGIGFFAVCFER 489
           PKEDGGIGFFAVCFER
Sbjct: 480 PKEDGGIGFFAVCFER 495

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/491 (68%), Positives = 392/491 (79%), Gaps = 7/491 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVL+SC+KYKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVM K+ IL+DIPKKKGKP+++R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSE+V       VRDLSE+V + D +ND+ PVRW RINPL+C    D   V+ EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V  W  +VPGSIY+DE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHIL+P
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
             +D +IDACSAPGNKTTH ASY+      D+ +RI+AFEKDPERAK+LQKM+KVAGCS 
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
            I V VGDFTKLATP K    TGFIVDPSCSGSGIFGRK+ DSLN++K  +   DN V P
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV-P 355

Query: 361 DEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415

Query: 419 LLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDG 478
           LLD+ V++WGWK+A R  VIP WPRRG V EF E+FRD TA   +++A+GCIRALP+EDG
Sbjct: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475

Query: 479 GIGFFAVCFER 489
           GIGFFA+CFER
Sbjct: 476 GIGFFAICFER 486

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/496 (68%), Positives = 396/496 (79%), Gaps = 11/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           M FYRDATWVLE +E+E AK RISGS+QTLV +SCK+YKLK NPKH+YAVLDSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK+ IL++IPK+KGKP++SR            SK KRIQMGK PIK YVLK KS 
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LHSE+V       V++LSE+V + D  ND+ PVRWIRINPL+C    D E    E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V  WSD+VPGSIYYDEYIPNLFGIHP DKIT+H LYK GKIIIQDRASCFPAHILHP
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
             +D+VID C+APGNKTTHTASY+   P KD  I+IYAFEK+PERAKIL KM+KVAGCS 
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKD------D 354
           NI + VGDFTK+A P+K K  TGFIVDPSCSGSGIFGRKF DSLN++KM++ +      D
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 355 DNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
           + + +PDEQEE+  +E+L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 357 EEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGK-VEEFGEVFRDGTAHNPRQLAEGCIRAL 473
           VIDL+LD  V++WGWKVAPR++VIP+WPRRGK  E       DG +    +LA GCIRAL
Sbjct: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476

Query: 474 PKEDGGIGFFAVCFER 489
           P+ DGGIGFFAVCFER
Sbjct: 477 PRSDGGIGFFAVCFER 492

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/493 (65%), Positives = 396/493 (80%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VL+SCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LE +MKK+ IL +IPKK GKP F R            SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L SEMV       ++   +++ S+D  ND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V+ WS +  G+IY+DE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+L+P
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G DDIVID+C+APGNKTTHTA+YI  GP KD  I+I+AFEKDPERAK+LQKMV+ AGC+ 
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRK---MDEKDDDND 357
            I+V VGDFTK+ATP+K K  TGFIVDPSCSGSGIFGRKF D+LNK+K     ++DD+++
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 358 VIPDEQ-EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
            IP EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476
           DLLLD+ +++ GW+VA R +VIP+WPRRG V+EF EVFRD      +++A GCIRALPKE
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPKE 479

Query: 477 DGGIGFFAVCFER 489
           DGGIGFFAVCFER
Sbjct: 480 DGGIGFFAVCFER 492

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/496 (63%), Positives = 397/496 (80%), Gaps = 7/496 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCK++K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEKVMKK++IL+++P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L++E+        V+DLS++  S+D+TND+ PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
           T KV+ W D+VPGSIYYDEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDN--IIRIYAFEKDPERAKILQKMVKVAGC 298
            +DDIVIDAC+APGNKTTH A+++      D    ++IYAFEKDPERA++L KM+K+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN-- 356
           S  I+V VGDFTKLATP  C    G IVDPSCSGSGIFGRK+ DS+N +K DE+ ++   
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 357 --DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
             D +P+EQEE    + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFR-DGTAHNPRQLAEGCIRAL 473
           VIDLLLDK V+E GW+VAPR++VIP+W RRG V+EF +VFR D  + N +++A+GCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 474 PKEDGGIGFFAVCFER 489
           P+EDGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/506 (62%), Positives = 392/506 (77%), Gaps = 17/506 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E +  K R+SGS+ +LV++SCK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           +E++M K+ IL+DIPKKKGKP++ R            SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVL----SEDITNDLPPVRWIRINPLKCHPNGDTEPVLAEL 176
           LHSE+V       V +L++++     S D T+D+ PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 RKKFTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           RKKFT KV+ WS + PG IYYDEYIPNLFGI PTDKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNII----RIYAFEKDPERAKILQKM 292
           IL+   DD +IDAC+APGNKTTH ASYI S     +I     R++AFEKDPER+KIL KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 293 VKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKM--- 349
           VK+AGC   +++  GDFTK+ATP+K    TGFIVDPSCSGSGIFGRKF D++N  K    
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 350 ---DEKDDDNDVIPDEQE---EFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYST 403
              DE +DD   IP EQE   E  AK++L+TRL+KLSSFQFQ+VKHAMSFP+AKKIVYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 404 CSIHAEENERVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPR 463
           CSIHAEENERVVIDLLLDK V+EWGWKV PR+  IP+W RRG V EF +VF++  A +P+
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 464 QLAEGCIRALPKEDGGIGFFAVCFER 489
           QLAEGCIR LPKEDGGIGFFAVCFER
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFER 506

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 388/495 (78%), Gaps = 10/495 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD+TWVLE +E +  K  R+SGS+QT+VLR CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+K+MKK+ +L+ IP+KKGKP FS+            SK KRIQMGKHPIK+YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 PLHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179
            L++E V       + DLS+VV  +D  +D+ PVRWIRINPL+   N DT+ VL EL+KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179

Query: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F  +VN W D++PGSIYYDE+IPNL+GIH +DKIT+HELYK GKIIIQDRASCFPAHIL+
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGADDIVIDACSAPGNKTTHTASYICSGP--PKDNIIRIYAFEKDPERAKILQKMVKVAG 297
           P ADD+VIDACSAPGNKTTH A++I   P  P+++ ++IYAFEKDPERA+ILQKM+K AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLN---KRKMDEKDD 354
           C  NIDV VGDFT++ATP K    TGFI+DPSCSGSGIFGRK  D LN   K+  DE  D
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359

Query: 355 DNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414
           +ND    E+      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 360 ENDA---EETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALP 474
           VIDLLLDK VQ WGW+VA +  V+P+W RRG  EEF EVF D T    ++LA+GC+RALP
Sbjct: 417 VIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALP 476

Query: 475 KEDGGIGFFAVCFER 489
           KEDGGIGFFAVCF R
Sbjct: 477 KEDGGIGFFAVCFVR 491

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/489 (64%), Positives = 387/489 (79%), Gaps = 5/489 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E+E  K R+SGSMQTLVL+SC++YKLKS+PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK+MK+++I +DIPKKKGKP++SR            SKQKRIQMGK PIK+YVLK K+ 
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L+SE+V       V+ LSE+V  ED +ND+ PVRWIRINPL+C P  D EPVL EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKF 179

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V+ WSD+  G++YYDE++PNLFG+HP DKIT+HELY+ GKIIIQDR+SCFPAHIL+P
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
           G +D+VIDAC+APGNKTTH A++I     ++   +IYAFEKDP RA IL+KM  VAGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
            +++ VGDFTKLA P   K  TG IVDPSCSGSGIFGRK  DS N  K  +K + +  IP
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAK--KKTETDSEIP 357

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           DE+E+ M  +++  RL+KL+SFQFQ+VKHAMS P AKKIVYSTCSIHAEENERVVIDLLL
Sbjct: 358 DEEEK-MVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           D+ ++EWGWKVA R EVIP WPRRGKV+EF +VFRD       +LA+GCIRALP+EDGGI
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPV-KCNELADGCIRALPQEDGGI 475

Query: 481 GFFAVCFER 489
           GFFAVCF+R
Sbjct: 476 GFFAVCFKR 484

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/490 (62%), Positives = 381/490 (77%), Gaps = 15/490 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCK+YKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+DIPKKKG+P FS             SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L +E+        V +LS++V  +D +ND+ PVRWIRINP++C  NG  + V  EL+KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             KV+ WS++VPG+IY+DE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
             +D++ID+CSAPGNKTTH A+++          +I+AFEKDPERAK LQKM++VAGC  
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
           +I+V VGDFTKLA PDK    TGFIVDPSCSGSGIFGRK  D  N +        N+V+P
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK--------NEVLP 348

Query: 361 DEQEEFMA-KEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLL 419
           +E++E     ++L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 349 EEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 408

Query: 420 LDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGG 479
           LD  VQ+WGW+V  R  VIP+W RRG VEEF +V++D      ++LA+GCIRALPKEDGG
Sbjct: 409 LDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGG 466

Query: 480 IGFFAVCFER 489
           IGFFAVCFER
Sbjct: 467 IGFFAVCFER 476

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 374/496 (75%), Gaps = 13/496 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCK+YKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+K++KK+ ILED+PKKKGKPLF++            SK KRIQMGKHPIK ++LK ++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 PLHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179
            L +E+        V  LS+++ ++D   D+ PVRWIRINP+      D   VLAEL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPILVKERYDD--VLAELNKK 177

Query: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F  +VN W  +VPGSIYYDEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHIL+
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PGADDIVIDACSAPGNKTTHTASYICSG-PPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298
           P + D+VIDAC+APGNKTTH A++I      K + ++I+AFEKDPERAK LQ MV  AGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDND- 357
           +  + + VGDFTKL  P+  +  TGFIVDPSCSGSGIFGRK  D +N  K    + D D 
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 358 --VIPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413
             V P EQE+  F  +++L+ RLAKLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 414 VVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRAL 473
           VVIDLLLD  V+EWGWKV  RT VIP+WPRRG   EF EVF    A   ++LAEGCIRAL
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEA---KELAEGCIRAL 474

Query: 474 PKEDGGIGFFAVCFER 489
           PKEDGGIGFFAVCFER
Sbjct: 475 PKEDGGIGFFAVCFER 490

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/492 (59%), Positives = 371/492 (75%), Gaps = 17/492 (3%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +EK  +  R++GS+QTLVL SCKKY LK+NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LEK++KK+ IL+D+PKKKGK +F+             +K KRIQMGKHP+K++VLK K+ 
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L+SE+V       V DL +++  +D  ND+ PVRW RINP++CH  G  E V+AEL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCH--GKHEEVMAELAKKF 176

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V+ W D+VPGSIY+DEYIPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GADDIVIDACSAPGNKTTHTASYI-CSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCS 299
              D++IDAC+APGNKTTH A+++  +  P++ +  I+AFEKDPERAK L+ MVK AGCS
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEPL--IHAFEKDPERAKTLRTMVKTAGCS 294

Query: 300 SNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVI 359
             I++ VGDFTKLA P      +GFIVDPSCSGSGIFGR+  D  NK +      +   +
Sbjct: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR------EEGAL 348

Query: 360 PDEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417
           P ++EE    E  +++ RLAKL+SFQF++VK+A+SFP+AKK+VYSTCSIHAEENER+VID
Sbjct: 349 PTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVID 408

Query: 418 LLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKED 477
           LLLD  V+EWGW+V  R   IP+WPRRG   EF +VFR+G     ++LAE CIR  PKED
Sbjct: 409 LLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDT--AKELAEACIRVAPKED 466

Query: 478 GGIGFFAVCFER 489
           GGIGFFAVCFER
Sbjct: 467 GGIGFFAVCFER 478

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 374/493 (75%), Gaps = 13/493 (2%)

Query: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRD++WVLE IE+E +K  RISGS+QTLVLRSCK+YKLK+NPKHIYA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YLEK++K + +L D+P KKG+P+FS+            SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 PLHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179
            L  E         V+ LSE+V  ED   D+ PVRWIRINP +C   G  + VL ELRKK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELV--EDNDADMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189

Query: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F  +V+ W+ +VPGSIY DEYIPNL+G+HP+DKIT+HELYK GKIIIQDRASCFPA+IL+
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGADDIVIDACSAPGNKTTHTASYIC-SGPPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298
           P   D+VIDACSAPGNKTTH A++I   G   D  ++IYAFE+D +RA+IL+KMV  AGC
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307

Query: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDV 358
            S I + VGDFT+LA P   K  TGFI+DPSCSGSGIFGR+  D  NK K+ EK   N+V
Sbjct: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEK-VPNEV 366

Query: 359 IPDEQEEFMAKEEL-QTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417
             ++  + M + EL +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVID
Sbjct: 367 FEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVID 426

Query: 418 LLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKED 477
           LLLD+ ++++GWKVA R  VIP+W RRG + EF EVF    A   ++LA+GCIRALPKED
Sbjct: 427 LLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKED 483

Query: 478 GGIGFFAVCFERK 490
           GGIGFFAVCFER+
Sbjct: 484 GGIGFFAVCFERE 496

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/491 (60%), Positives = 369/491 (75%), Gaps = 28/491 (5%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VL++C KYK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           LE++M K+ IL+ IP+KKGKP FSR            SKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           LH+E+V       V++LSE+V  +D  +D  PVRWIRINPLKC    D   V+ +L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +V+ W  L PGSIYYDEY+PNLFGIHP++KIT+H+LYK GK+IIQDRASC PAHIL+P
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GADDIVIDACSAPGNKTTHTASYICS--GPPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298
           G +D+V+DAC+APGNKTTH A++I S  G       +I+AFEK+P RAK+LQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDV 358
            S + + VGDFT+LA PD+ +  T  +VDPSCSGSGIFGRK  +S N    D +D     
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN----DSQD----- 346

Query: 359 IPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418
                      ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 347 -----------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395

Query: 419 LLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDG 478
           LLD  V+EWGW+++PR+EV+P+WPRRG  EEF EVFRD      + LAE CIRALP+EDG
Sbjct: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454

Query: 479 GIGFFAVCFER 489
           GIGFFAVCF+R
Sbjct: 455 GIGFFAVCFQR 465

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 366/489 (74%), Gaps = 7/489 (1%)

Query: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60
           MNFYRDATWVLE +E      R++GS+QTLVL SCKKY+LK+NPKHIYA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKSP 120
           L+K++K++ IL+DIPKKKGK +F+             SK KRIQMGKHP+K++VLK+K+ 
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180
           L SE+V       V DL +++  +D  ND+ PVRW R+NP++C     +E +L EL KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240
             +VN W+++ PG IY+DEYIP LFG+HP DKIT+HELYK GK+IIQDRASCFPAHIL+ 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300
            ++D++IDAC+APGNKTTH A++I      +++ RI+AFEKDPERAK L+ M+  AGC+ 
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVESV-RIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360
            I+V VGDFT+LA P K    TGFI+DPSCSGSGIFGRK  D  NK K D      +   
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEK 401

Query: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420
           +E+ E ++ ++L+ RL KL+SFQF++VKHAMSFP+AKK+VYSTCS+HAEENER+V+DLLL
Sbjct: 402 EEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461

Query: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480
           D  V+EWGW+V  R  VIP+W RRG  +EF EVFRD      ++LAE CIR  PKEDGGI
Sbjct: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRD--EDTAKELAEACIRVAPKEDGGI 519

Query: 481 GFFAVCFER 489
           GFFAVCFER
Sbjct: 520 GFFAVCFER 528

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 360/493 (73%), Gaps = 12/493 (2%)

Query: 1   MNFYRDATWVLEDIEKE-AAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59
           M FYRDA+WVLE IE+E A K +++GS+ +LVL+S KKYKLKS+ +H+YA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKARILEDIPKKKGKPLFSRXXXXXXXXXXXXSKQKRIQMGKHPIKDYVLKFKS 119
           YL+++++K+ +L+D+P+KKG+P F R            SK+KRI MGKHP+K +VLK ++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 PLHSEMVXXXXXXXVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179
            L  E         V DLS  VL +D   D  PVRWIR+NP +    G  E VL EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLS--VLVQDEREDATPVRWIRLNPFRI--RGQREEVLQELQKK 176

Query: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239
           F  +V  W +L PGSIY DEY+  L+G+HP DKIT+HELYK GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCS 299
           PG  D++IDAC+APGNKTTH A++I      D+  +I+AFE+DP+RAK L+KM+  AGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGADH-AQIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 SNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVI 359
           + I+V VGDFT+ A P+  K  TGFIVDPSCSGSGIFGR+  D+  + +   + D +  +
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADV 355

Query: 360 PDEQ--EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417
           P+E+  E   +  EL+ RLAKLSSFQFQ+VKHAMSFP+AKK++YSTCS+HAEENERVVID
Sbjct: 356 PEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVID 415

Query: 418 LLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKED 477
           LLLD  VQ+ GWKVA R++VIP+WPRRG   EF EVF D       +LA GCIR LPKED
Sbjct: 416 LLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD----QAEELAGGCIRVLPKED 471

Query: 478 GGIGFFAVCFERK 490
           GGIGFFAVCFER+
Sbjct: 472 GGIGFFAVCFERE 484

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 116/277 (41%), Gaps = 44/277 (15%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDN 272
           I A   Y  G  I+Q  +S  P   L P  ++ V+D  SAPG KTT+ ++ +       N
Sbjct: 319 IGATPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM------KN 372

Query: 273 IIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSG 332
              ++A + + +R K L   +   GC++ I   V ++     P    G    ++D  CSG
Sbjct: 373 TGCVFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSG 429

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+         K+   + D   IP  Q++ +        L+ + S      K  + 
Sbjct: 430 TGVIGKD-----QSVKVSRTEKDFIQIPHLQKQLL--------LSAIDSVDANSKKGGV- 475

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGE 452
                 IVYSTCS+  EE+E VV          ++  +  P  +++ +  + GK E F  
Sbjct: 476 ------IVYSTCSVAVEEDEAVV----------DYALRKRPNVKLVDTGLQIGK-EGFVS 518

Query: 453 VFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
            FR    H   +L     R  P      GFF   F++
Sbjct: 519 -FRGKKFHPSLKLTR---RYYPHTYNVDGFFVAKFQK 551

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 138/348 (39%), Gaps = 68/348 (19%)

Query: 147 TNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKFTLK-VNKWSDLVPGSIYYDEYIPNLF 205
            N++P    IR N LK       +   A + K   L+ +  W+ +  G   +D  +P   
Sbjct: 279 ANEVPRPISIRTNTLKTRRR---DLAQALVNKGVNLQPIGAWTKV--GLQIFDSQVP--- 330

Query: 206 GIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYIC 265
                  I A   Y  G+ I+Q  +S  P   L P  ++ V+D  +APG KTT+ ++ + 
Sbjct: 331 -------IGATSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM- 382

Query: 266 SGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFI 325
                 N   ++A + +  R K L   +   GC++ I   V ++     P    G    +
Sbjct: 383 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRIL 434

Query: 326 VDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+ G+   D   K    EKD            F+    LQ +L         
Sbjct: 435 LDAPCSGTGVIGK---DQSVKSSRTEKD------------FIQIPHLQKQL--------- 470

Query: 386 MVKHAMSFPAAKK----IVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAPRTEVIPSW 441
           ++    S  A  K    IVYSTCS+  EE+E VV          ++  +  P  +++ S 
Sbjct: 471 LLSAIDSVDANSKTGGVIVYSTCSVAVEEDEAVV----------DYALRKRPNVKLVESG 520

Query: 442 PRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
              GK  E    FR    H   +L     R  P      GF+   F++
Sbjct: 521 LAIGK--EGFTSFRGKKFHPSLKLTR---RYYPHTYNVDGFYVAKFQK 563

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 116/277 (41%), Gaps = 44/277 (15%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDN 272
           I A   Y  G  I+Q  +S  P   L P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 317 IGATPEYLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KN 370

Query: 273 IIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSG 332
              ++A + +  R K L   +   GC++ I   V ++     P    G    ++D  CSG
Sbjct: 371 TGCVFANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSG 427

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+   D   K    EKD            FM    LQ +L  L S    +  H+ +
Sbjct: 428 TGVIGK---DQSVKVSRTEKD------------FMQIPHLQKQL--LLSAIDSVDSHSKT 470

Query: 393 FPAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGE 452
                 IVYSTCS+  EE+E+VV          ++  +  P  ++I +    GK E F  
Sbjct: 471 ---GGIIVYSTCSVAVEEDEQVV----------DYALRKRPNIKLIETGLAIGK-EGFAS 516

Query: 453 VFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
            +R    H   +L     R  P      GFF   F++
Sbjct: 517 -YRGKKFHPSLKLTR---RYYPHTYNVDGFFVAKFQK 549

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 101/239 (42%), Gaps = 46/239 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 284 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 333

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 334 ALDPQENERILDMAAAPGGKTTYISALM------KNTGCVFANDANKARTKSLIANIHRL 387

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC + I   V ++     P    G    ++D  CSG+G+ G+   D   K    EKD   
Sbjct: 388 GCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK---DQSVKVSRTEKD--- 438

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVV 415
                    FM    LQ +L  LS+    +  H+ +      IVYSTCS+  EENE VV
Sbjct: 439 ---------FMQIPHLQKQLI-LSAID-SVDAHSKT---GGVIVYSTCSVAVEENEAVV 483

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 101/243 (41%), Gaps = 54/243 (22%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VNK  +L P       G   +D  +P          I A   Y  G+ I+Q  +S  P  
Sbjct: 285 VNKGVNLQPIGTWTKVGLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVV 334

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ V+D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 335 ALDPQLNERVLDMAAAPGGKTTYISALM------KNTGCVFANDANKARTKSLIANIHRL 388

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+   D   K    EKD   
Sbjct: 389 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK---DQSVKVSRTEKD--- 439

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKK----IVYSTCSIHAEENE 412
                    F+    LQ +L         ++    S  A  K    IVYSTCS+  EE+E
Sbjct: 440 ---------FIQIPHLQKQL---------LLSAIDSVDANSKTGGFIVYSTCSVAVEEDE 481

Query: 413 RVV 415
            VV
Sbjct: 482 AVV 484

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 101/243 (41%), Gaps = 54/243 (22%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G+ I+Q  +S  P  
Sbjct: 285 VNRGVNLQPIGNWTKVGLQIFDSQVP----------IGATPEYLAGQYILQAASSFLPVI 334

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  SAPG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 335 ALDPQENERILDMASAPGGKTTYISALM------KNTGCVFANDANKNRTKSLIANIHRL 388

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+   D   K    EKD   
Sbjct: 389 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK---DQSVKVSRTEKD--- 439

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKK----IVYSTCSIHAEENE 412
                    F+    LQ +L         ++    S  A  K    IVYSTCS+  EE+E
Sbjct: 440 ---------FIQIPHLQKQL---------LLSAIDSVDANSKSGGVIVYSTCSVAVEEDE 481

Query: 413 RVV 415
            VV
Sbjct: 482 AVV 484

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 87/199 (43%), Gaps = 33/199 (16%)

Query: 219 YKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYA 278
           Y  G  I+Q  +S  P   L P  ++ ++D  +APG KTT+ ++ +       N   ++A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 362

Query: 279 FEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGR 338
            + +  R K L   +   GC++ I   V ++     P    G    ++D  CSG+G+ G+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 419

Query: 339 KFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQF--QMVKHAMSFPAA 396
                +N+ + D               FM    LQ +L  LS+        KH       
Sbjct: 420 DQSVKVNRTEKD---------------FMQIPHLQKQLI-LSAIDSVDSNSKHGGV---- 459

Query: 397 KKIVYSTCSIHAEENERVV 415
             IVYSTCS+  EENE VV
Sbjct: 460 --IVYSTCSVAVEENEAVV 476

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 100/239 (41%), Gaps = 46/239 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 302 VNRGVNLQPIGNWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 351

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 352 ALDPQENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKNRTKSLIANIHRL 405

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 406 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 457

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVV 415
             IP  Q++ +        L+ + S      K  +       IVYSTCS+  EE+E VV
Sbjct: 458 IQIPHLQKQLL--------LSAIDSVDANSKKGGI-------IVYSTCSVAVEEDEAVV 501

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 99/239 (41%), Gaps = 46/239 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 304 VNRGVNLQPIGAWTKVGLQIFDSQVP----------IGATPEYLAGNYILQAASSFLPVI 353

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ V+D  SAPG KTT+ ++ +       N   I+A + +  R K L   +   
Sbjct: 354 ALDPQENERVLDMASAPGGKTTYISALM------KNTGCIFANDANKARTKSLIANIHRL 407

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 408 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 459

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVV 415
             IP  Q++ +        L+ + S         +       +VYSTCS+  EE+E VV
Sbjct: 460 IQIPHLQKQLI--------LSAIDSLDSNSKNGGV-------LVYSTCSVAVEEDEAVV 503

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 126/313 (40%), Gaps = 61/313 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 290 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 339

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 340 ALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKSRTKSLIANIHRL 393

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 394 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 445

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
             IP  Q++ +        L+ + S      KH         IVYSTCS+  EE      
Sbjct: 446 IQIPHLQKQLL--------LSAIDSVDCNS-KHGGV------IVYSTCSVAVEE------ 484

Query: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476
               D+AV ++  +  P  +++ +    GK E F   +R    H   +LA    R  P  
Sbjct: 485 ----DEAVIDYALRKRPNVKLVETGLAIGK-EAFTS-YRGKNFHPSVKLAR---RYYPHT 535

Query: 477 DGGIGFFAVCFER 489
               GFF   F++
Sbjct: 536 YNVDGFFVAKFQK 548

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 125/313 (39%), Gaps = 61/313 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 292 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 341

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 342 ALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKSRTKSLIANIHRL 395

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 396 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 447

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
             IP  Q++ +        L+ + S      KH         IVYSTCS+  EE+E VV 
Sbjct: 448 IQIPHLQKQLL--------LSAIDSVDCNS-KHGGV------IVYSTCSVAVEEDEAVV- 491

Query: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476
                    ++  +  P  +++ +    GK  E    FR    H   +LA    R  P  
Sbjct: 492 ---------DYALRKRPNVKLVETGLAIGK--EGFTSFRGKKFHPSVKLAR---RYYPHT 537

Query: 477 DGGIGFFAVCFER 489
               GFF   F++
Sbjct: 538 YNVDGFFVAKFQK 550

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 125/317 (39%), Gaps = 69/317 (21%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 287 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 336

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 337 ALDPQENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKARTKSLIANIHRL 390

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+   D   K    EKD   
Sbjct: 391 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK---DQSVKVSRTEKD--- 441

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKK----IVYSTCSIHAEENE 412
                    FM    LQ +L         ++    S  +  K    IVYSTCS+  +ENE
Sbjct: 442 ---------FMQIPHLQKQL---------LLSAIDSVDSNSKTGGVIVYSTCSVAVDENE 483

Query: 413 RVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRA 472
            VV          ++  +  P  +++ +    GK  E    +R  T H   ++     R 
Sbjct: 484 AVV----------DYALRKRPNVKLVETKLAIGK--EGFTSYRGKTFHPSVKMTR---RY 528

Query: 473 LPKEDGGIGFFAVCFER 489
            P      GFF   F++
Sbjct: 529 YPHTYNVDGFFVAKFQK 545

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 126/313 (40%), Gaps = 61/313 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 290 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 339

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 340 ALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKSRTKSLIANIHRL 393

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 394 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 445

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
             IP  Q++ +        L+ + S      KH         IVYSTCS+  EE      
Sbjct: 446 IQIPHLQKQLL--------LSAIDSVDCNS-KHGGV------IVYSTCSVAVEE------ 484

Query: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476
               D+AV ++  +  P  +++ +    GK E F   +R    H   +LA    R  P  
Sbjct: 485 ----DEAVIDYALRKRPNVKLVDTGLAIGK-EAFTS-YRGKKFHPSVKLAR---RYYPHT 535

Query: 477 DGGIGFFAVCFER 489
               GFF   F++
Sbjct: 536 YNVDGFFVAKFQK 548

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 115/281 (40%), Gaps = 54/281 (19%)

Query: 147 TNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKFTLK-VNKWSDLVPGSIYYDEYIPNLF 205
            N++P    IR N LK       + ++    +   LK +  W+ +  G   +D  +P   
Sbjct: 273 ANEVPRPITIRTNSLKTRRRDLAQTLV---NRGVNLKPIGPWTKV--GLQIFDSQVP--- 324

Query: 206 GIHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYIC 265
                  I A   Y  G  I+Q  +S  P   L P  ++ ++D  +APG KTT+ ++ + 
Sbjct: 325 -------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM- 376

Query: 266 SGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFI 325
                 N   ++A + +  R K L   +   GC++ I   V ++     P    G    +
Sbjct: 377 -----KNTGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRIL 428

Query: 326 VDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQ 385
           +D  CSG+G+  +   D   K    EKD            F+    LQ +L         
Sbjct: 429 LDAPCSGTGVIAK---DQSVKVSRTEKD------------FIQIPHLQKQL--------- 464

Query: 386 MVKHAMSFPAAKK----IVYSTCSIHAEENERVVIDLLLDK 422
           ++    S  A  K    IVYSTCS+  EENE  VID  L K
Sbjct: 465 LLSAIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYALRK 504

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 89/203 (43%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDN 272
           I A   Y  G  I+Q  +S  P   L P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 188 IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KN 241

Query: 273 IIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSG 332
              ++A + +  R K L   +   GC++ I   V ++     P    G    ++D  CSG
Sbjct: 242 TGCVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 298

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+ G+         K+   + D   IP  Q++ +        L+ + S      KH   
Sbjct: 299 TGVIGKD-----QSVKVSRTEKDFIQIPHLQKQLL--------LSAIDSVDCNS-KH--- 341

Query: 393 FPAAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EE+E VV
Sbjct: 342 ---GGVIVYSTCSVAVEEDEAVV 361

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 100/239 (41%), Gaps = 46/239 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 297 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGNYILQAASSFLPVI 346

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 347 ALDPHENERILDMAAAPGGKTTYISALM------KNTGTVFANDANKNRTKSLIANIHRL 400

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 401 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 452

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVV 415
             IP  Q++ +        L+ + S      KH         IVYSTCS+  EE+E VV
Sbjct: 453 IQIPHLQKQLL--------LSAIDSVDCNS-KH------GGIIVYSTCSVAVEEDEAVV 496

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 124/313 (39%), Gaps = 61/313 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 291 VNRGVNLQPIGPWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 340

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 341 ALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFANDANKSRTKSLIANIHRL 394

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+ G+         K+   + D 
Sbjct: 395 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD-----QSVKVSRTEKDF 446

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416
             IP  Q++ +        L+ + S      KH         IVYSTCS+  EE+E VV 
Sbjct: 447 IQIPHLQKQLL--------LSAIDSVDCNS-KHGGV------IVYSTCSVAVEEDEAVV- 490

Query: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476
                     +  +  P  +++ +    GK  E    +R    H   +LA    R  P  
Sbjct: 491 ---------NYALRKRPNVKLVETGLAIGK--EGFTSYRGKNFHPSVKLAR---RYYPHT 536

Query: 477 DGGIGFFAVCFER 489
               GFF   F++
Sbjct: 537 YNVDGFFVAKFQK 549

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 87/203 (42%), Gaps = 29/203 (14%)

Query: 213 ITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDN 272
           I A   Y  G  I+Q  +S  P   L P  ++ ++D  +APG KTT+ ++ +       N
Sbjct: 327 IGATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM------KN 380

Query: 273 IIRIYAFEKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSG 332
              ++A + +  R K L   +   GC++ I   V ++     P    G    ++D  CSG
Sbjct: 381 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 437

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
           +G+  +         K+   D D   IP  Q++ +        L+ + S         + 
Sbjct: 438 TGVIAKD-----QSVKVSRTDKDFMQIPHLQKQLL--------LSAIDSVDANSKTGGV- 483

Query: 393 FPAAKKIVYSTCSIHAEENERVV 415
                 IVYSTCS+  EENE VV
Sbjct: 484 ------IVYSTCSVAVEENEAVV 500

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 100/243 (41%), Gaps = 54/243 (22%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 279 VNRGVNLQPIGTWTKVGLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVI 328

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 329 ALDPQENERILDMAAAPGGKTTYISALM------KNTGCVFANDANKARTKSLIANIHRL 382

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  CSG+G+  +   D   K    EKD   
Sbjct: 383 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAK---DQSVKVSRTEKD--- 433

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKK----IVYSTCSIHAEENE 412
                    FM    LQ +L  LS+          S  +  K    IVYSTCS+  EENE
Sbjct: 434 ---------FMQIPHLQKQLI-LSAID--------SVDSNSKTGGIIVYSTCSVAVEENE 475

Query: 413 RVV 415
            VV
Sbjct: 476 AVV 478

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 99/239 (41%), Gaps = 46/239 (19%)

Query: 184 VNKWSDLVP-------GSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236
           VN+  +L P       G   +D  +P          I A   Y  G  I+Q  +S  P  
Sbjct: 287 VNRGVNLQPIGSWTKVGLQIFDSQVP----------IGATPEYLAGNYILQAASSFLPVI 336

Query: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVA 296
            L P  ++ ++D  +APG KTT+ ++ +       N   ++A + +  R K L   +   
Sbjct: 337 ALDPHENERILDMAAAPGGKTTYISALM------KNTGCVFANDANKARTKSLIANIHRL 390

Query: 297 GCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN 356
           GC++ I   V ++     P    G    ++D  C+G+G+ G+         K+   + D 
Sbjct: 391 GCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGVIGKD-----QSVKVSRTEKDF 442

Query: 357 DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVV 415
             +P  Q++ +        L+ + S         +       IVYSTCS+  EE+E VV
Sbjct: 443 IQVPHLQKQLL--------LSAIDSVDSNSKTGGI-------IVYSTCSVAVEEDEMVV 486

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 115/295 (38%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P ++L       V+D C+APG+KT      + +  P+ +   + A + 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGF-VVANDA 204

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGF---IVDPSCSGSGI 335
           D  R+ +L   +K    S+N+ V   D   F ++ T +  K    F   + D  CSG G 
Sbjct: 205 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGT 263

Query: 336 FGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSF-P 394
             RK  +                        + K+        L + Q  ++   ++   
Sbjct: 264 M-RKNIN------------------------VWKDWGTGSGLGLHTVQLNILNRGLTLLK 298

Query: 395 AAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVIPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R+  I SWP 
Sbjct: 299 NGGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRSTGISSWPV 353

Query: 444 RGKVEEFGEVFRDGTAHN---PRQLA------EGCIRALPKEDGGIGFFAVCFER 489
             K  E      DGT      P +        E CIR  P +    GFF   FE+
Sbjct: 354 LDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 116/296 (39%), Gaps = 58/296 (19%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P  +L   ++  V+D C+APG+KT      +     +   I I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI-IVANDS 217

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGAT----GFIVDPSCSGSG 334
           D  R+ +L   +K    SSNI V   D   F  + T       T      + D  CSG G
Sbjct: 218 DMRRSYLLVHQLKRLN-SSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDG 276

Query: 335 IFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFP 394
              RK  +  N  +               +  +    LQ  +        Q++++     
Sbjct: 277 TL-RKNINIWNDWRF--------------QNALGLHRLQNNILNRG---LQLLRNG---- 314

Query: 395 AAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAP-----------RTEVIPSWP- 442
              ++VYSTCS++  ENE V+ +     A++ W  +V+            R+  I SWP 
Sbjct: 315 --GRLVYSTCSMNPIENEAVIAN-----ALRNWAGEVSLVNFDDELPGLIRSRGISSWPV 367

Query: 443 --RRGKVEEFG-----EVFRDGTAHNPRQL-AEGCIRALPKEDGGIGFFAVCFERK 490
             R G++ E G     + +   TA   +    E CIR  P +     FF   FE+ 
Sbjct: 368 IDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 116/303 (38%), Gaps = 72/303 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A ++ +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLATPD-KCKGATGF---IVDPSCS 331
           + D  R+ +L   +K    ++    N D +     KL+  D K K A  F   + D  CS
Sbjct: 202 DSDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGDNKAKDALKFDRILCDVPCS 261

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           ++ ++   D N                Q  L  L + Q+ ++   +
Sbjct: 262 GDGTM---------RKNVNVWKDWN---------------TQAGLG-LHTIQYNILNRGL 296

Query: 392 S-FPAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVIP 439
                  ++VYSTCS++  ENE VV      +A++ WG K+             R+  + 
Sbjct: 297 HLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDDKLPGLIRSNGVT 351

Query: 440 SWP------------RRGKVEE-FGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVC 486
            WP              G +E  F     + TA N     + C+R  P +    GFF   
Sbjct: 352 QWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFN----LQNCMRVYPHQQNTGGFFITV 407

Query: 487 FER 489
            E+
Sbjct: 408 IEK 410

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 116/298 (38%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT     Y+     + +   + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGF-VVANDA 200

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKL-ATPDKC--KGATGF---IVDPSCSG 332
           D +R+ +L   +K    S+N+ V   D   F ++ A PD    K    F   + D  CSG
Sbjct: 201 DAKRSHMLVHQLKRLN-SANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSG 259

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                  +V  D           Q  LA L + Q  ++   + 
Sbjct: 260 DGTMRKNV----------------NVWRDWT--------TQNGLA-LHNVQLNILNRGLH 294

Query: 393 F-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIPS 440
              +  ++VYSTCS++  ENE VV +     A+++WG KV             R+  I  
Sbjct: 295 LLKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGGKVRLVDCSDKLPGLVRSNGINQ 349

Query: 441 WPRRGKVEEFGEVFRDGTAHN---------PRQLAEGCIRALPKEDGGIGFFAVCFER 489
           WP   +  E  E   DGT  +          R   + C+R  P +    GFF    E+
Sbjct: 350 WPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 117/298 (39%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P  +L   ++  V+D C+APG+KT      + +   +   I + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGI-VVANDA 202

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGFI------VDPSCSG 332
           D  R+ +L   +K    S+N+ V   D   F ++A  +    +  F+       D  CSG
Sbjct: 203 DARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSG 261

Query: 333 SGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMS 392
            G   +                      +   ++ ++  L      L + Q  ++   + 
Sbjct: 262 DGTMRKNV--------------------NVWRDWTSQGGL-----GLHNIQLNILNRGLH 296

Query: 393 FPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIPS 440
               K ++VYSTCS++  ENE V+       A+++WG K+             R++ I S
Sbjct: 297 LLKPKGRLVYSTCSMNPIENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDS 351

Query: 441 WP---RRGKVEEFGEVFRDGTAHNPRQLA------EGCIRALPKEDGGIGFFAVCFER 489
           WP   R  ++ + G+     T   P +        + CIR  P +     FF    E+
Sbjct: 352 WPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 114/295 (38%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P  +L   +   V+D C+APG+KT      + S   +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGF-VVANDA 203

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGF---IVDPSCSGSGI 335
           D  R+ +L   +K    S+N+ V   D   F ++ T  +      F   + D  CSG G 
Sbjct: 204 DARRSHMLVHQLKRLN-SANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGT 262

Query: 336 FGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSF-P 394
             RK  +                        + K+        L + Q  ++K  ++   
Sbjct: 263 M-RKNVN------------------------VWKDWGTASGLGLHTVQLNILKRGLNLLK 297

Query: 395 AAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVIPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R++ I +WP 
Sbjct: 298 KGGRLVYSTCSMNPIENEAVVA-----AALRQWGDKIKLVDCSDKLPGLVRSKGISNWPV 352

Query: 444 RGKVEEFGEVFRDGTAHN--PRQLAEG-------CIRALPKEDGGIGFFAVCFER 489
             K  E  E   +GT  +  P    E        CIR  P +    GFF    E+
Sbjct: 353 IDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 123/302 (40%), Gaps = 70/302 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLAT-PDKCKGATGF---IVDPSCS 331
           + D +R+ +L   +K    ++    N D +     KL T  +K K    F   + D  CS
Sbjct: 202 DADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCS 261

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           ++ ++   D N                Q  L  L + Q  ++   +
Sbjct: 262 GDGTM---------RKNVNVWKDWN---------------TQGGLG-LHTVQLNILNRGL 296

Query: 392 SF-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVIP 439
           +   +  ++VYSTCS++  ENE VV +     A+++WG K+             R++ I 
Sbjct: 297 NLLKSGGRLVYSTCSMNPIENEAVVAE-----ALRKWGSKIKLVNCDDKLVGLVRSKGIS 351

Query: 440 SWP---RRGKVEEFGEVFRDGT-------AHNPRQL--AEGCIRALPKEDGGIGFFAVCF 487
           +WP   R   V+  G+   +GT           R++   + CIR  P +    GFF   F
Sbjct: 352 NWPVLDRNMAVKNKGD---EGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVF 408

Query: 488 ER 489
           E+
Sbjct: 409 EK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 114/299 (38%), Gaps = 64/299 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A ++ +  P   ++   A 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVV---AN 202

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLAT-PDKCKGATGF---IVDPSCS 331
           + D  R+ +L   +K    ++    N D +     K++   DK K    F   + D  CS
Sbjct: 203 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCS 262

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           ++ ++   D N                Q+ L  L + Q+ ++   +
Sbjct: 263 GDGTM---------RKNVNVWKDWN---------------TQSGLG-LHTVQYNILNRGL 297

Query: 392 SF-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVIP 439
           +   +  ++VYSTCS++  ENE VV      +A++ WG K+             R++ I 
Sbjct: 298 NLLKSGGRLVYSTCSLNPIENEAVVA-----QALRTWGDKIKLVNCGDKLPGLVRSQGIS 352

Query: 440 SWP---------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
            WP          +G        F            E CIR  P +    GFF    E+
Sbjct: 353 QWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 114/295 (38%), Gaps = 59/295 (20%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEK 281
           G I  Q+  S  P  +L       V+D C+APG+KT      + +  P+ +   + A + 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGF-VVANDA 203

Query: 282 DPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGF---IVDPSCSGSGI 335
           D  R+ +L   +K    S+N+ V   D   F ++ T +  K    F   + D  CSG G 
Sbjct: 204 DYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGT 262

Query: 336 FGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSF-P 394
             RK  +                        + K+        L + Q  ++   ++   
Sbjct: 263 M-RKNIN------------------------VWKDWATASGLGLHTVQVNILNRGLNLLK 297

Query: 395 AAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAP-----------RTEVIPSWPR 443
              ++VYSTCS++  ENE VV       A+++WG K+             R++ I  WP 
Sbjct: 298 DGGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPV 352

Query: 444 RGK---VEEFGEVFRDGTAHNPRQLA------EGCIRALPKEDGGIGFFAVCFER 489
             K    ++  +   D +   P          E C+R  P +    GFF   FE+
Sbjct: 353 YDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 114/303 (37%), Gaps = 70/303 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     + +I S  P   +I   A 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVI---AN 196

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLATPDKCKGA----TGFIVDPSCS 331
           + D +R+ +L   +K    S+    N D +     K+ T D            + D  CS
Sbjct: 197 DADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCS 256

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G   +                                  Q  L  L + QF ++   +
Sbjct: 257 GDGTMRKNV------------------------NVWKNWNTQNALG-LHNVQFNILDRGL 291

Query: 392 S-FPAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIP 439
           +      K+VYSTCS++  ENE VV  +L     ++WG KV             R++ + 
Sbjct: 292 TLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLT 346

Query: 440 SWPRRGKVEEFGEVFR-------DGTAHNPRQLA------EGCIRALPKEDGGIGFFAVC 486
           +WP   +  +  EV R       + + + P +        + C+R  P +    GFF   
Sbjct: 347 TWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITM 404

Query: 487 FER 489
           FE+
Sbjct: 405 FEK 407

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 116/300 (38%), Gaps = 65/300 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVV---AN 199

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLATPDKCKGATGF-----IVDPSC 330
           + D +R+ +L   +K    ++    N D +     K +  D    A        + D  C
Sbjct: 200 DADSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVPC 259

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G   +    ++N  +        D  P            Q  L  L + QF ++   
Sbjct: 260 SGDGTMRK----NVNVWR--------DWTP------------QGGLG-LHTVQFNILNRG 294

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +     K ++VYSTCS++  ENE VV +     A+++WG K+             R++ +
Sbjct: 295 LHLLKNKGRLVYSTCSMNPIENEAVVAE-----ALRKWGDKIRLVSCEDKLPGLVRSKGV 349

Query: 439 PSWP---RRGKVEEFGEVFRDGTAHNPRQLA------EGCIRALPKEDGGIGFFAVCFER 489
             WP   R     E G+     +   P +        E CIR  P +    GFF   FE+
Sbjct: 350 SQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 114/300 (38%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTH--TASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGFI------VDPSC 330
           + D  R+ +L   +K    S+N+ V   D   F ++ T    +  +  +       D  C
Sbjct: 202 DADNRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q  L  L   Q  ++   
Sbjct: 261 SGDGTM---------RKNVNVWRDWN---------------TQNALG-LHQVQANILNRG 295

Query: 391 MSF-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +       ++VYSTCS++  ENE VV      +A+++WG KV             R + I
Sbjct: 296 LHLLKKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVRNKGI 350

Query: 439 PSWPRRGKVEEFGEVFRDGTAHNPRQ---------LAEGCIRALPKEDGGIGFFAVCFER 489
             WP   +  E  E  ++G   +  Q           E CIR  P +    GFF   FE+
Sbjct: 351 SKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 112/297 (37%), Gaps = 63/297 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTH--TASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L    +  V+D C+APG+KT     A +     P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGF---IVDPSCSGS 333
           + D +R+ +L   +K    S+N+ V   D   F ++ +    K    F   + D  CSG 
Sbjct: 202 DADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGD 260

Query: 334 GIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSF 393
           G   RK  +                        + ++        L + Q  ++   ++ 
Sbjct: 261 GTM-RKNVN------------------------VWRDWGTASGLGLHTVQLNILNRGLNL 295

Query: 394 -PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIPSW 441
                ++VYSTCS++  ENE V+       A+++WG K+             R++ I  W
Sbjct: 296 LKDGGRLVYSTCSLNPIENESVIA-----AALRKWGDKIRLVNCDEKLPGLVRSKGITQW 350

Query: 442 PRRGKVEEFGEVFRDGTAHN---------PRQLAEGCIRALPKEDGGIGFFAVCFER 489
           P   K     E   +G              R   E CIR  P +    GFF   FE+
Sbjct: 351 PVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 110/302 (36%), Gaps = 70/302 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  S  P   ++   A 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVV---AN 195

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGF------IVDPSC 330
           + D  RA +L   +K    S+N+ V   D   F K+         +G       + D  C
Sbjct: 196 DSDSRRAYMLVHQLKRLN-SANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPC 254

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q  L  L + Q  ++   
Sbjct: 255 SGDGTM---------RKNVNVWKDWN---------------TQNALG-LHNVQLNILNRG 289

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVA-----------PRTEVI 438
           +       ++VYSTCS++  ENE VV       A+++WG K+             R+  I
Sbjct: 290 LQLLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGI 344

Query: 439 PSWPRRGKVEEFGEVFRDGTAHNPRQLA-----------EGCIRALPKEDGGIGFFAVCF 487
             W    +  E   + +D  +                  E C+R  P +    GFF   F
Sbjct: 345 SHWSVYDR--EMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVF 402

Query: 488 ER 489
           E+
Sbjct: 403 EK 404

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 112/300 (37%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A ++    P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGDFTKLATPDKCKGATG---------FIVDPSC 330
           + D +R+ +L   +K    S+N+ V   D          + AT           + D  C
Sbjct: 202 DADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPC 260

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q+ L  L + Q  ++   
Sbjct: 261 SGDGTM---------RKNVNVWRDWN---------------TQSGLG-LHTVQLNILNRG 295

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +     K ++VYSTCS++  ENE VV       A+++WG K+             R++ I
Sbjct: 296 LHLLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGI 350

Query: 439 PSWP---------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
            +WP         ++G        F        +     CIR  P +    GFF   FE+
Sbjct: 351 STWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 113/300 (37%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATGFI------VDPSC 330
           + D  R+ +L   +K    S+N+ V   D   F ++   D  +     +       D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G   +                      +  +++ A+  L      L + Q+ ++   
Sbjct: 261 SGDGTMRKNV--------------------NVWKDWNAQGAL-----GLHTVQWNILNRG 295

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKVAPRT--EVIPSWPRRGKV 447
           +       ++VYSTCS++  ENE VV      +A+++WG K+      E +P   R   +
Sbjct: 296 LHLLKPNGRLVYSTCSLNPIENEAVVA-----QALRKWGNKIRLVNCDEKLPGLVRSKGI 350

Query: 448 EEFGEVFRDGTAHNPRQLA------------------EGCIRALPKEDGGIGFFAVCFER 489
            ++  + RD    N                       + CIR  P +    GFF   FE+
Sbjct: 351 SQWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 110/302 (36%), Gaps = 70/302 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLATPDKCKGAT----GFIVDPSCS 331
           + D  R+ +L   +K    ++    N D +     +L      K         + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCS 261

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           ++ ++   D N                Q  L  L + Q  ++   +
Sbjct: 262 GDGTM---------RKNVNVWKDWN---------------TQAGLG-LHTVQLNILNRGL 296

Query: 392 SFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIP 439
                  ++VYSTCS++  ENE VV +     A+++WG K+             R++ + 
Sbjct: 297 HLLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVS 351

Query: 440 SWP------------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCF 487
            WP              G +E F   F        R   + C+R  P +    GFF   F
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLESF---FSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVF 408

Query: 488 ER 489
           E+
Sbjct: 409 EK 410

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 113/294 (38%), Gaps = 66/294 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KTT    A +  +  P   ++   A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVV---AN 199

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLAT---PDKCKGATGF---IVDPSC 330
           + D  R+ +L   +K    S+N+ V   D   F ++     P K K    F   + D  C
Sbjct: 200 DADSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPC 258

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q  L  L + Q  ++   
Sbjct: 259 SGDGTM---------RKNVNVWKDWN---------------TQGALG-LHTVQLNILDRG 293

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +       ++VYSTCS++  ENE VV +     A++ WG KV             R++ I
Sbjct: 294 LHLLQNNGRLVYSTCSMNPIENEAVVAE-----ALRRWGDKVRLVDCSEKLPGLIRSQGI 348

Query: 439 PSWP------RRGKVEEFGEV---FRDGTAHNPRQLAEGCIRALPKEDGGIGFF 483
             WP         K E+ G +   F        +   E C+R  P +    GFF
Sbjct: 349 TQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 114/303 (37%), Gaps = 72/303 (23%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKL---ATPDKCKGATGF---IVDPSC 330
           + D  R+ +L   +K    S+N+ V   D   F ++      +K      F   + D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q  L  L + Q  ++   
Sbjct: 261 SGDGTM---------RKNVNVWKDWN---------------TQAGLG-LHTVQLNILNRG 295

Query: 391 MSF-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +       ++VYSTCS++  ENE V+ +     A+++WG K+             R++ +
Sbjct: 296 LHLLKDGGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLSGLVRSKGV 350

Query: 439 PSWP------------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVC 486
             WP              G +E F   F        +   + C+R  P +    GFF   
Sbjct: 351 SKWPVYDRNLTEKTKGDEGTLESF---FAPSEEEASKFNLQNCMRVYPHQQNTGGFFITV 407

Query: 487 FER 489
           FE+
Sbjct: 408 FEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 108/299 (36%), Gaps = 64/299 (21%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSS----NIDVKVGDFTKLATPDKCKGAT----GFIVDPSCS 331
           + D  R+ +L   +K    ++    N D +     +L      K         + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCS 261

Query: 332 GSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAM 391
           G G           ++ ++   D N                Q  L  L + Q  ++   +
Sbjct: 262 GDGTM---------RKNVNVWKDWN---------------TQAGLG-LHAVQLNILNRGL 296

Query: 392 SFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVIP 439
                  ++VYSTCS++  ENE VV +     A+++WG K+             R++ + 
Sbjct: 297 HLLKNNGRLVYSTCSLNPIENEAVVAE-----ALRKWGDKIRLVNCDDKLPGLIRSKGVS 351

Query: 440 SWP---------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
            WP          +G        F        +   + C+R  P +    GFF   FE+
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 113/300 (37%), Gaps = 66/300 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  +  P   ++   A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD---FTKL---ATPDKCKGATGF---IVDPSC 330
           + D  R+ +L   +K    S+N+ V   D   F ++      +K      F   + D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPC 260

Query: 331 SGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHA 390
           SG G           ++ ++   D N                Q  L  L + Q  ++   
Sbjct: 261 SGDGTM---------RKNVNVWKDWN---------------TQAGLG-LHTVQLNILNRG 295

Query: 391 MSFPAAK-KIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEVI 438
           +    +  ++VYSTCS++  ENE V+ +     A+++WG K+             R++ +
Sbjct: 296 LHLLKSNGRLVYSTCSLNPIENEAVIAE-----ALRKWGDKIRLVNCDDKLTGLIRSKGV 350

Query: 439 PSWP---------RRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFAVCFER 489
             WP          +G        F        +   + C+R  P +    GFF   FE+
Sbjct: 351 SKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 107/305 (35%), Gaps = 75/305 (24%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYI-CSGPPKDNIIRIYAFE 280
           G I  Q+  S  P  +L       V+D C+APG+KT      +   GP       + A +
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGF--VVAND 196

Query: 281 KDPERAKILQKMVKVAGCSSNIDVKVGD---FTKLATPDKCKGATG--------FIVDPS 329
            D +R+ +L   +K    S+N+ V   D   F K+   D  KG            + D  
Sbjct: 197 SDSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPKIQL-DSNKGRHNKEYLKFDRILCDVP 254

Query: 330 CSGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKH 389
           CSG G           ++ ++   D N                Q  L  L + Q  ++  
Sbjct: 255 CSGDGTI---------RKNVNIWKDWNT---------------QNSLG-LHNVQLNILNR 289

Query: 390 AMS-FPAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWG-------------------- 428
            +    +  ++VYSTCS+   ENE V+        +++WG                    
Sbjct: 290 GIQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPG 344

Query: 429 ---WKVAPRT-EVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGIGFFA 484
              W+V  RT  ++     + K   F     +    N       CIR  P +    GFF 
Sbjct: 345 ISKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFN----LSHCIRVFPHQQNTGGFFI 400

Query: 485 VCFER 489
              E+
Sbjct: 401 AVLEK 405

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 115/301 (38%), Gaps = 67/301 (22%)

Query: 222 GKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHT--ASYICSGPPKDNIIRIYAF 279
           G I  Q+  S  P  +L       V+D C+APG+KT     A +  S  P   +I   A 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVI---AN 201

Query: 280 EKDPERAKILQKMVKVAGCSSNIDVKVGD--FTKLATPDKCKGATG--------FIVDPS 329
           + D +R+ +L   +K    S+N+ V   D  F      D  +G+ G         + D  
Sbjct: 202 DADYKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVP 260

Query: 330 CSGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKH 389
           CSG G           ++ ++   D N                      L   Q  +++ 
Sbjct: 261 CSGDGTM---------RKNVNVWKDWN----------------TGSGLGLHIVQLNILER 295

Query: 390 AMSF-PAAKKIVYSTCSIHAEENERVVIDLLLDKAVQEWGWKV-----------APRTEV 437
            ++      K+VYSTCS++  ENE V+       A++ WG KV             R++ 
Sbjct: 296 GLNLLKEGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVRSKG 350

Query: 438 IPSWP---RRGKVEEFG-----EVFRDGTAHNPRQL-AEGCIRALPKEDGGIGFFAVCFE 488
           I  W    ++ +V E G     + +   TA    +   E C+R    +    GFF   FE
Sbjct: 351 ITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVFE 410

Query: 489 R 489
           +
Sbjct: 411 K 411

>KLTH0H03102g Chr8 (275767..277179) [1413 bp, 470 aa] {ON} highly
           similar to uniprot|Q12464 Saccharomyces cerevisiae
           YPL235W RVB2 RUVB-like protein TIP49b Homologue
          Length = 470

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 166 NGDTEPVLAELRKKFTLKVNKW-----SDLVPGSIYYDE 199
            GDT  + +E+R +   KV +W     +D+VPG ++ DE
Sbjct: 259 TGDTGEIRSEVRDQINTKVAEWKEEGKADIVPGVLFIDE 297

>Kwal_56.24270 s56 complement(930311..931723) [1413 bp, 470 aa] {ON}
           YPL235W (RVB2) - RUVB-like protein [contig 165] FULL
          Length = 470

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 166 NGDTEPVLAELRKKFTLKVNKW-----SDLVPGSIYYDE 199
            GDT  + +E+R +   KV +W     +D+VPG ++ DE
Sbjct: 259 TGDTGEIRSEVRDQINTKVAEWKEEGKADIVPGVLFIDE 297

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 11/83 (13%)

Query: 244 DIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSSNID 303
           DIV++     GN TT            +   ++ A E DP  A  L K V        ++
Sbjct: 58  DIVLEVGPGTGNLTTRIL---------EKARKVVAVEFDPRMAAELTKRVHGTAAEKKLE 108

Query: 304 VKVGDFTKLATP--DKCKGATGF 324
           + +GDFTK   P  D C   T +
Sbjct: 109 IILGDFTKTELPYFDVCISNTPY 131

>ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa]
            {ON} similar to uniprot|P36126 Saccharomyces cerevisiae
            YKR031C SPO14 Phospholipase D catalyzes the hydrolysis of
            phosphatidylcholine producing choline and phosphatidic
            acid involved in Sec14p-independent secretion required
            for meiosis and spore formation differently regulated in
            secretion and meiosis
          Length = 1610

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASCFPAHILHPGADDIVIDACSAPGNKTTHTASYI 264
            + P DK+   ELY HGK++I D  +C              I+  S  GN+ +  A+ I
Sbjct: 1016 LGPHDKLVTEELYVHGKVLIVDDRACI--------VGSANINERSQLGNRDSEVAAII 1065

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 33/88 (37%), Gaps = 11/88 (12%)

Query: 239 HPGADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298
           H    DIV++     GN T             +   ++ A E DP  A  L K V     
Sbjct: 53  HIKPSDIVLEVGPGTGNLTVRIL---------EKAKKVVAVEMDPRMAAELTKRVHGTPA 103

Query: 299 SSNIDVKVGDFTKLATP--DKCKGATGF 324
              +D+ +GDF K   P  D C   T +
Sbjct: 104 EKKLDIMLGDFMKTELPYFDICISNTPY 131

>NCAS0B07800 Chr2 complement(1477435..1482504) [5070 bp, 1689 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1689

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASC 232
            I P DK+   +LY H KI+I D  SC
Sbjct: 1101 IGPHDKLMTEQLYVHAKILISDDRSC 1126

>TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {ON}
           Anc_1.251 YKR031C
          Length = 1551

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 206 GIHPTDKITAHELYKHGKIIIQDRASC 232
            I P DK+   +LY H K++I D  SC
Sbjct: 946 AIGPQDKLVTEQLYVHAKVLIADDRSC 972

>Kwal_23.4862 s23 complement(898390..903585) [5196 bp, 1731 aa] {ON}
            YPL231W (FAS2) - alpha subunit of fatty acid synthase
            [contig 5] FULL
          Length = 1731

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 329  SCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIPDEQEEFMAKEELQTRLAKLSS 381
            +CSGSGI G K      + +M E D  ND++   QE F+        +  LSS
Sbjct: 1262 NCSGSGIGGMKSHRLTRQARMKEDDVQNDIL---QETFINASAAWVNMLLLSS 1311

>TBLA0H02990 Chr8 complement(732711..737957) [5247 bp, 1748 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1748

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 207  IHPTDKITAHELYKHGKIIIQDRASC 232
            I P DKI   +LY H KI+I D  +C
Sbjct: 1051 IGPFDKIVTEQLYVHAKILISDDRNC 1076

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,727,059
Number of extensions: 2377325
Number of successful extensions: 8675
Number of sequences better than 10.0: 79
Number of HSP's gapped: 8742
Number of HSP's successfully gapped: 94
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)