Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.3062.288ON97097050820.0
YNL023C (FAP1)2.288ON96596042360.0
Smik_14.3082.288ON96596642320.0
Suva_14.3242.288ON96896941800.0
NDAI0G006702.288ON96893932700.0
NCAS0G037802.288ON95791031880.0
KAFR0H033002.288ON96691230330.0
KNAG0H019902.288ON97392330320.0
TDEL0G021902.288ON93689830250.0
TBLA0B059502.288ON99598129540.0
ZYRO0A01936g2.288ON95389828460.0
CAGL0M06919g2.288ON95689928400.0
Kpol_1039.452.288ON96891027060.0
SAKL0E07634g2.288ON97490726620.0
KLTH0G10406g2.288ON96391426350.0
Kwal_27.115182.288ON95392726260.0
TPHA0D015302.288ON96290925880.0
KLLA0E08317g2.288ON92189924690.0
ADL213W2.288ON90890822430.0
Ecym_33272.288ON92688822360.0
NCAS0E017407.210ON317157781.1
TPHA0H019506.275ON221130733.0
NCAS0A024504.238ON192856736.5
Ecym_81431.134ON1443112736.5
Ecym_44737.153ON101158718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.306
         (970 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1962   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1636   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1634   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1614   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1264   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1232   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1172   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1172   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1169   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1142   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1100   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1098   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1046   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1030   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1019   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...  1016   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1001   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   955   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   868   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   865   0.0  
NCAS0E01740 Chr5 (339699..340652) [954 bp, 317 aa] {ON} Anc_7.21...    35   1.1  
TPHA0H01950 Chr8 complement(457304..457969) [666 bp, 221 aa] {ON...    33   3.0  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    33   6.5  
Ecym_8143 Chr8 complement(306516..310847) [4332 bp, 1443 aa] {ON...    33   6.5  
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    32   8.9  

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1962 bits (5082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/970 (98%), Positives = 958/970 (98%)

Query: 1   MLQITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQYYER 60
           MLQITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQL            LQYYER
Sbjct: 1   MLQITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLSSYEFEEESDDDLQYYER 60

Query: 61  AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP 120
           AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP
Sbjct: 61  AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP 120

Query: 121 NCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPEC 180
           NCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPEC
Sbjct: 121 NCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPEC 180

Query: 181 TRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPE 240
           TRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPE
Sbjct: 181 TRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPE 240

Query: 241 FIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDY 300
           FIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDY
Sbjct: 241 FIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDY 300

Query: 301 ACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSR 360
           ACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSR
Sbjct: 301 ACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSR 360

Query: 361 CSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLM 420
           CSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLM
Sbjct: 361 CSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLM 420

Query: 421 SCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQR 480
           SCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQR
Sbjct: 421 SCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQR 480

Query: 481 KCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMP 540
           KCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMP
Sbjct: 481 KCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMP 540

Query: 541 HTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCH 600
           HTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCH
Sbjct: 541 HTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCH 600

Query: 601 LLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSA 660
           LLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSA
Sbjct: 601 LLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSA 660

Query: 661 KRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFE 720
           KRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFE
Sbjct: 661 KRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFE 720

Query: 721 ELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAY 780
           ELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAY
Sbjct: 721 ELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAY 780

Query: 781 NLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTA 840
           NLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTA
Sbjct: 781 NLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTA 840

Query: 841 KLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDS 900
           KLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDS
Sbjct: 841 KLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDS 900

Query: 901 RSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQ 960
           RSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQ
Sbjct: 901 RSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQ 960

Query: 961 EVSSPEEKDM 970
           EVSSPEEKDM
Sbjct: 961 EVSSPEEKDM 970

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1636 bits (4236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/960 (81%), Positives = 846/960 (88%), Gaps = 2/960 (0%)

Query: 4   ITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQYYERAIQ 63
           +TEHESL LEQ+Q+GG  ++HH+LS+G + SVED++EQ             +QYYERAIQ
Sbjct: 1   MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQ--PSSYEEESDDDMQYYERAIQ 58

Query: 64  EIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCY 123
           EI+ GDSY+CMICTVEMDYTCQMFACK+CYRVFDY CIREWALKSTEKTVD+IWKCPNCY
Sbjct: 59  EISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCY 118

Query: 124 HVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRM 183
           +V K+VP +NRPTCWCG VVNPDPN LDPNSCGQTCNA TC+HGC KICHLGPHPECTRM
Sbjct: 119 YVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHLGPHPECTRM 178

Query: 184 VEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFII 243
           VEI CHCG+HSK+IFCYQSK M++ FNCQE CGL LSC +H CKKKCH GLCG CPE II
Sbjct: 179 VEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMII 238

Query: 244 NDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACH 303
           + DS KKQIKCYCGNH + +IKCSE +FPKSG++SKDE+GN W GVFACAD R VDY+C 
Sbjct: 239 SKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCR 298

Query: 304 KHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSK 363
           KHSFIE C+SPPTI+G+K CPFLPS LKTCPCGRTALEELTKPRKHC DPIPTC+SRC K
Sbjct: 299 KHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGK 358

Query: 364 PLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCR 423
           PLKCGKH CPFTCHD ACM+PCLQIDS  C+CEQSTFS+PCGFQ  PRCNIKCESLMSCR
Sbjct: 359 PLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCR 418

Query: 424 RHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCH 483
           RHRC DRCCSGRPSAIRRKK+ FR+QDLLDESLVEAKHICLKPCNLTLSCG+HKCQRKCH
Sbjct: 419 RHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCH 478

Query: 484 PGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTC 543
           PGKCPPCLESDSNDL+C CG TVVPAPVRCGTKLPTCNHPCIKVVRGES CGHKPMPHTC
Sbjct: 479 PGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTC 538

Query: 544 HPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLG 603
           H  ++SCPPCTETVFKPC+CGKK KVRTVCFQ DVSCG  CGIPLS CYHTCQKTCHL G
Sbjct: 539 HSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPG 598

Query: 604 KCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRD 663
            CQKVCKQ CGQKRL+C H CPKPCHGKTECPDLPCA LVKI C+CGRIKKS+TC AK D
Sbjct: 599 NCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSD 658

Query: 664 TVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEELQ 723
            VSV  SS+LDCNEECE LKRLKEL+EAFG+ E  NN   NELDAL +LVSVA TFEELQ
Sbjct: 659 RVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQ 718

Query: 724 LPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLY 783
           LPFTEA LSVYSKQERWC QIE ILNKLMD + RSSLHFKPMRPPQRHFI E+AKAY LY
Sbjct: 719 LPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLY 778

Query: 784 AESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLI 843
           +ESQDREPMRSVFIKKEDN  S KPVLSLAEAYPLYESFKQ QKERK QEFQARTTAKLI
Sbjct: 779 SESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLI 838

Query: 844 NFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSA 903
           NFEVQD E K+E AK NGFLVQNLV+GNT EDL+RFFEPHLKHTLV NPQYLILDD ++A
Sbjct: 839 NFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTA 898

Query: 904 LIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQEVS 963
           L+YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCS +EE+ +RLD+P IQE S
Sbjct: 899 LVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDS 958

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1634 bits (4232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/966 (80%), Positives = 856/966 (88%), Gaps = 2/966 (0%)

Query: 4   ITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQYYERAIQ 63
           +T+HESLDL+Q+Q GGG+ + HSLS+    SVED++EQ             +QYYER+IQ
Sbjct: 1   MTDHESLDLKQNQEGGGVCRRHSLSSEQDSSVEDNNEQ--PSSYEEETDDDMQYYERSIQ 58

Query: 64  EIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCY 123
           EI+KGDSYICMICTVEMDYTCQMFACK+CYRVFDY CIREWA+KSTEKTVD+IWKCPNCY
Sbjct: 59  EISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCY 118

Query: 124 HVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRM 183
           HVGKKVP  NRPTCWCG VVNPDPN LDPNSCGQTC+AP C+HGC K CHLGPHPECTRM
Sbjct: 119 HVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRM 178

Query: 184 VEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFII 243
           VEI CHCG+HS++IFCYQSKAM++ F CQEECGL LSC VH CK+KCH+GLCG CPE I 
Sbjct: 179 VEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELIT 238

Query: 244 NDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACH 303
           + DS+++QIKCYCGNH + SIKCSEARFPKSGR+SKD +GNEW GVFAC DIRTVD++C 
Sbjct: 239 SKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCR 298

Query: 304 KHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSK 363
           KHSFIEPCLSPP+++G+K CPFLPSLLKTCPCGRTAL+ELTKPRKHC DPIPTCNSRCSK
Sbjct: 299 KHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSK 358

Query: 364 PLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCR 423
           PLKCGKH CPF CHD ACMDPCLQIDSA C+CEQSTFS+PCGFQ  PRCNIKCESLMSCR
Sbjct: 359 PLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCR 418

Query: 424 RHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCH 483
           RHRC DRCCSGRPSA++R+K+FFRSQDLLDESLVEAKHICLKPCNLTLSCG+HKCQRKCH
Sbjct: 419 RHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCH 478

Query: 484 PGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTC 543
           PGKCPPCLESDSNDLIC CGKTVVPAPVRCGT+LP CNHPCIKVVRGES CGHKPMPHTC
Sbjct: 479 PGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTC 538

Query: 544 HPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLG 603
           HP  + CPPCTETVFKPC+CGKKDKVRTVCFQ DVSCGT CG+ L  C HTCQKTCHL G
Sbjct: 539 HPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPG 598

Query: 604 KCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRD 663
            CQKVCKQICG +RL C HTCPKPCHGKTECPDLPC  LVKITC+CGR +KS+TCSAK  
Sbjct: 599 NCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSG 658

Query: 664 TVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEELQ 723
            V    SS+LDC+EECE LKRLKELREAFG+ E  NNV  NELDAL +LVSVA TFEEL 
Sbjct: 659 VVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELH 718

Query: 724 LPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLY 783
           LPFTE TLSVYSKQERWC QIE ILNKLMD + RSSLHFKPMRPPQRHFI E+AKAY LY
Sbjct: 719 LPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLY 778

Query: 784 AESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLI 843
           +ESQDREPMRSVFIKKEDN TS KPVLSL EA PLYESFKQ QKERK+QEFQ+RTTAKLI
Sbjct: 779 SESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLI 838

Query: 844 NFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSA 903
           NFEVQDA+ K+E AKNNGFLV+NLV+GNTVEDLKRFFEPHLKHTLV NPQYLILDD ++A
Sbjct: 839 NFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTA 898

Query: 904 LIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQEVS 963
           L+YPENYETASVNTERDMELLVGHFDFMAKEAFLADSI LCS DEE+GKRLD+P IQE +
Sbjct: 899 LVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGKRLDTPVIQEDT 958

Query: 964 SPEEKD 969
           S E+K+
Sbjct: 959 SIEDKN 964

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1614 bits (4180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/969 (79%), Positives = 848/969 (87%), Gaps = 1/969 (0%)

Query: 1   MLQITEHESLDLEQDQNGGGIHKHHSLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQYYER 60
           MLQ  E ESLDLEQ QNG  +H+H  L++ HV  VE S EQ             +QYYER
Sbjct: 1   MLQTNERESLDLEQSQNGSDVHEH-CLNDEHVSGVEVSHEQSSTYDSEEESDDDMQYYER 59

Query: 61  AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP 120
           AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP
Sbjct: 60  AIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCP 119

Query: 121 NCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPEC 180
           NCYH+GKKVPTRNRPTCWCG VVNPD N LDPNSCGQTCNAPTCVHGC KICHLGPHPEC
Sbjct: 120 NCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHLGPHPEC 179

Query: 181 TRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPE 240
           TR VEIKC CG+HSK+IFCYQSKAM++ F+CQEECGL LSCG+HKCKKKCHSGLCG CPE
Sbjct: 180 TRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPE 239

Query: 241 FIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDY 300
            I+++D +   IKCYCG H ++SIKC E  FPKSGR+SKDESGNEW GVFAC DIRTVDY
Sbjct: 240 LIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDY 299

Query: 301 ACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSR 360
           ACHKHSFIEPC+SPPT++G+KTCPFLPSLLKTCPCGRTALEELTKPRKHC DPIPTC+SR
Sbjct: 300 ACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSR 359

Query: 361 CSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLM 420
           CSKPLKCGKH CPF CHDGACMDPCLQ DS  C+CEQSTF +PCGFQE P CNIKCESLM
Sbjct: 360 CSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLM 419

Query: 421 SCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQR 480
           SCRRHRCIDRCCSGRPSA+ RKK  FRSQDL+DESLVEA+HICLKPCNLTLSCG+HKCQR
Sbjct: 420 SCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQR 479

Query: 481 KCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMP 540
           KCHPGKCPPCLESDSNDL+C CGKTV+PAPVRCGTKLP CN+ CIKVVRGES CGHKPMP
Sbjct: 480 KCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMP 539

Query: 541 HTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCH 600
           HTCHP +++CPPCTETVFKPC+CGKKDKVRTVCFQ DVSCGT+CG PLSGC+HTCQKTCH
Sbjct: 540 HTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCHHTCQKTCH 599

Query: 601 LLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSA 660
           L   CQKVCKQIC QKR +C H CPKPCHG++ECPDLPCA+LVKITC+CGRI+K + C A
Sbjct: 600 LPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGA 659

Query: 661 KRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFE 720
           K + VSV  +  LDCNEECE LKRLKELREAFG+SE  N    NELD L +LVSVA TFE
Sbjct: 660 KSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKLVSVATTFE 719

Query: 721 ELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAY 780
           ELQLPFTE  LSVY+KQE WCLQIE I+NKLM  + RSSLHFKPMRPPQRHFI E+AKAY
Sbjct: 720 ELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAY 779

Query: 781 NLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTA 840
           NLY+ESQDREPMRSVFIKKEDN  S +P+LSLAEA+PLYESFK+ QKERK+QEFQARTTA
Sbjct: 780 NLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTA 839

Query: 841 KLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDS 900
           KLINFEV+DAE K+E AKNNGFLVQ LV+GN V+DL+RFFEPHLKHTLV  PQYLI+DD 
Sbjct: 840 KLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDG 899

Query: 901 RSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRLDSPAIQ 960
           ++AL+YPENY+  SVNTERDM++LVGHFDFMAKEAFLADSI LCS+DEE+G+RLD P  Q
Sbjct: 900 KTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELGRRLDPPVTQ 959

Query: 961 EVSSPEEKD 969
             S  +E++
Sbjct: 960 GDSLAKEEN 968

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1264 bits (3270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/939 (63%), Positives = 725/939 (77%), Gaps = 5/939 (0%)

Query: 26  SLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQYYERAIQEIAKGDSYICMICTVEMDYTCQ 85
           S  N    S  D  +Q             ++YYER IQEIAKGDSY+CMICTVEMDYTCQ
Sbjct: 29  SSENVSSTSDNDEYDQEDEYAAATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQ 88

Query: 86  MFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNP 145
           M+ACK+CYRVFDY CIREWA+KSTEKTVD+IWKCPNCYHV KKVP +NR TCWCG VVNP
Sbjct: 89  MYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNP 148

Query: 146 DPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAM 205
           + N L+PNSCGQTCNA  CVHGC  ICHLGPHPECTRM+ I C CG+H+K IFCYQSK  
Sbjct: 149 EANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTF 208

Query: 206 R--RRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNS 263
           +   +F C++ECGL LSCG+HKCK+KCHSGLCG CPE +  ++ +   +KCYCG+  Q S
Sbjct: 209 KGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKS 268

Query: 264 IKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQKTC 323
           +KC + + P+S + S D  GN+W GVFAC +IRTV Y C KHSFIE C++PPT+S +K C
Sbjct: 269 MKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPC 328

Query: 324 PFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMD 383
           P+ P LLKTCPCG+T L++L KPR  C DPIPTC S C+KPLKCGKH CPF CH GACMD
Sbjct: 329 PYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMD 388

Query: 384 PCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKK 443
           PCLQI++  CSCEQ +F +PC F  SP CNIKCESLMSCRRHRC++RCCSGRP+A +RKK
Sbjct: 389 PCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKK 448

Query: 444 SFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACG 503
           + FRSQDL+DE+LVEA+HICLK CNL LSCG+H+CQRKCHPGKCPPCLESDSNDL+C CG
Sbjct: 449 TLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCG 508

Query: 504 KTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRC 563
           KT+V APVRCGTKLP C   CIKVVR E  CGH PMPHTCHP +  CPPCT  VFKPC+C
Sbjct: 509 KTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKC 568

Query: 564 GKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHT 623
           GK  +VRT+CFQ DVSCG  CG+PL  C H C K CH+ G CQ  CKQICG++R++C HT
Sbjct: 569 GKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHT 628

Query: 624 CPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRDTVSVITSSILDCNEECETLK 683
           C +PCHG TECPD+PC    K+TCECGR +  +TC A  +  S +T++IL+C+EECE L+
Sbjct: 629 CSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLE 688

Query: 684 RLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQ 743
           R ++L+EAFG+ E  ++    E + L ++V  A  FEELQLPFTEATLS++S+QERWC Q
Sbjct: 689 RHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQ 748

Query: 744 IEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNC 803
           IE I+NK MD + R SLHFKPMRPPQRHFIHE++KAYNLY ESQD EP RSVFIKK  N 
Sbjct: 749 IEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NT 806

Query: 804 TSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFL 863
           TS KP  SL++  PLY++FK+ +KERKLQEF+ART+ +L+N EV +  +    A+ NGFL
Sbjct: 807 TSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFL 866

Query: 864 VQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSALIYPENYETASVNTERDMEL 923
           +++L  G TVEDL+R F  +LK TL+ NPQYL+L D +S +IYPE+Y T + N ERD + 
Sbjct: 867 IKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKS 926

Query: 924 LVGHFDFMAKEAFLADSIHLCSVDEEIG-KRLDSPAIQE 961
           LVGHFD +AK+ F+++ + LC +D+ +  +RL +PAI E
Sbjct: 927 LVGHFDVLAKDTFISEGVELCKIDDVLSTERLATPAIDE 965

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/910 (65%), Positives = 717/910 (78%), Gaps = 5/910 (0%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYERAIQEIAKGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWALKSTEKTVD
Sbjct: 50  MHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVD 109

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           +IWKCPNCYHV KKVP +NRPTCWCG VVNP+PN L+PNSCGQTCNA TCVHGC KICHL
Sbjct: 110 RIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHL 169

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMR--RRFNCQEECGLSLSCGVHKCKKKCHS 232
           GPHPECTR++ IKC CG+H+K I CYQS  +R   +F C E CGL L+CG+H+C+KKCHS
Sbjct: 170 GPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHS 229

Query: 233 GLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFAC 292
           GLCG CPE +   +     I+CYCG+  +++IKC +   P S   S++  G +W GVF C
Sbjct: 230 GLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKC 289

Query: 293 ADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHD 352
            +IR VDY CH+HSF+E C++PPTI G K CPF P LLKTCPCG+T L+EL + RK C D
Sbjct: 290 DNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTD 349

Query: 353 PIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRC 412
           PIPTC+SRC KPLKCG+H CPF CH G CMDPCLQID   CSC Q +F +PC F + P+C
Sbjct: 350 PIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQC 409

Query: 413 NIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLS 472
             KCESLMSCRRHRC +RCC+GRP A  RKK  FRSQDL+DESLVE +HICLK CNL LS
Sbjct: 410 TTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLS 469

Query: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532
           CG HKCQRKCHPGKCPPCLESDSNDL+C CG+T++ APVRCGTKLP C +PCIKVVRGE 
Sbjct: 470 CGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEY 529

Query: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592
            CGH PMPHTCHP N  CPPCT +VFKPC+CGK DKVRT+CFQ DVSCG  CG+PL  C 
Sbjct: 530 PCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCN 589

Query: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652
           HTCQK CHLLG+CQK CKQIC +KR++C HTC KPCHGKT+CPD+PC+  +KITCECGR 
Sbjct: 590 HTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRK 649

Query: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712
           +  +TC A     S  T + ++C+EECE L+R ++L+EAFG+ +  N     E++ L +L
Sbjct: 650 ETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDS-NRSTSLEVEKLKDL 708

Query: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772
             VA TFEELQLP+ E TLS+Y+KQE+WC QIE ILNKLMD + R SLHFKPMRPPQRHF
Sbjct: 709 AKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHF 768

Query: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832
           I E AK++NLYAE+QDREP RSVF+KKE++ +S KP++SL +A PLY++FK+ +KERKL+
Sbjct: 769 IQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLK 828

Query: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892
           EF+ARTT +LIN E    E  +  AK +GFL++ +  G TVEDL+R F   L  TL+ NP
Sbjct: 829 EFEARTTTRLINVEAPQ-EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNP 887

Query: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVD-EEIG 951
           QYLI+ D + ALIYPENY+  S   ERD+E LVGHFDF++KE F+AD + LC V+   +G
Sbjct: 888 QYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLG 947

Query: 952 KRLDSPAIQE 961
           +RL++P ++E
Sbjct: 948 ERLETPILEE 957

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/912 (60%), Positives = 690/912 (75%), Gaps = 13/912 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYERAIQEIA GDSYICMICTVEMDYTC+M+ACKKC R+FDY CIREWALKSTEKT +
Sbjct: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           +IWKCPNCYHV KKVPT+NR TCWCG VVNP+ N L+PNSCGQTCNAP C+HGC KICHL
Sbjct: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAM---RRRFNCQEECGLSLSCGVHKCKKKCH 231
           GPHPEC R + +KC CG+H + I C+QSK+    R RF+C+EECGL LSCG+H CKKKCH
Sbjct: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232

Query: 232 SGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFA 291
           SGLCGSCPE +  ++     IKCYCG   + S  C + + P +   S+D  GN+W GVF+
Sbjct: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVGVFS 290

Query: 292 CADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCH 351
           C  IR V+Y+C KHSF+E C++PPT+SG K CPF P+LLKTCPCGRT L  L+KPR  C 
Sbjct: 291 CNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCT 350

Query: 352 DPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPR 411
           DP+PTC + C+KPLKCGKH CPFTCH+G CMDPC+QID   CSC QS F  PC F+  P 
Sbjct: 351 DPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPH 410

Query: 412 CNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTL 471
           CNIKCESLMSCRRHRC +RCCSGRP A +RKK+ FRS D+ DE+LVEA+H+CLK CNL L
Sbjct: 411 CNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLML 470

Query: 472 SCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGE 531
           SCG H+CQRKCHPGKCPPCLESDSNDL+C CGKTVV APVRCGTKL  C  PCIKV+R E
Sbjct: 471 SCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNE 530

Query: 532 SWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGC 591
           S CGH P+PH+CHP +  CPPCT TVFKPC+CGK+DKVRTVCFQ DVSCG  CG+PL  C
Sbjct: 531 SVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTC 590

Query: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651
           +H CQK CH  G+CQ  CKQ+C +KR++C+H C K CHG TEC D PC    KI+C CGR
Sbjct: 591 HHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGR 650

Query: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGV--SEGPNNVIRNELDAL 709
            +  +TC+A     S    + LDCNEECE +KR +ELREAFG+   E P N+    L + 
Sbjct: 651 RESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSF 710

Query: 710 SELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQ 769
           ++    A  +++LQLP+TE  L  Y+KQ  WC QIE +L K MD   R SLHFKPMRPPQ
Sbjct: 711 AQ---SATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQ 767

Query: 770 RHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKER 829
           R+FIHE+AKA+NLYAESQDREP RSVF+KK D+ TS KP L L++  P+Y++FK+ +KER
Sbjct: 768 RYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKER 827

Query: 830 KLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLV 889
           K ++F+ARTTA+L+N  + D   + +  +NNG +++NL +G T+E L  FF    K TL+
Sbjct: 828 KAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLI 887

Query: 890 ANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEE 949
            NPQYLI+++  + LIYPE++   +     D+++LVGHF+ + KE  + DS+ +C+++ E
Sbjct: 888 KNPQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENE 945

Query: 950 I-GKRLDSPAIQ 960
           +  +RL++P ++
Sbjct: 946 LPEERLETPRLE 957

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1172 bits (3032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/923 (59%), Positives = 688/923 (74%), Gaps = 18/923 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           L YYERA++EIAKGD Y CMICTVEMDYTC+MFAC+KCYRVFDY C+REWA+KST+KTVD
Sbjct: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           +IWKCPNCY V KKVPT+NRPTCWCG VVNP+PN LDPNSCGQTC+A  C+HGC KICHL
Sbjct: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHKCKKKCHS 232
           GPHPEC R   +KC CG+ +K I C+++K  R R  F C E C   L CG+H+C+K CHS
Sbjct: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230

Query: 233 GLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFAC 292
           GLCGSCPE +   +     I CYCG H +NSIKC +     +GR SK+ +G+EW GV+AC
Sbjct: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYAC 288

Query: 293 ADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHD 352
            DIR+V+Y+C +HSF E C++PPT++G K CPF P  LKTC CG+T L+ L K R+ C D
Sbjct: 289 KDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCID 348

Query: 353 PIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRC 412
           PIP C SRC K LKCGKH CPF CHDG CMDPC+QID   C+CE++TF +PCGFQ +P C
Sbjct: 349 PIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHC 408

Query: 413 NIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLS 472
            +KCESL+SCRRH+C +RCCSGRP+A  R+K+  R QD+ DE+L+EA+H+CLK CNLTLS
Sbjct: 409 QLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLS 468

Query: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532
           CG H+CQRKCHPGKCPPCLESDSNDL+C CGKT+VPAPVRCGTKLP+C HPCIKVV G S
Sbjct: 469 CGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGIS 528

Query: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592
            CGHKP+PH CHP +  CPPCT TVFKPC+CGK  +VRT+CFQ DVSCG +CG PL  C+
Sbjct: 529 ECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCH 588

Query: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652
           H CQKTCHL G+CQ  CKQ+C +  ++C H C K CHG+  CPD+ C ALVKI C CGR 
Sbjct: 589 HFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRK 648

Query: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNN---VIRNELDAL 709
           +  +TC A     S + +  L+C+EECE   R ++L+EAFG+++   N   +   E   L
Sbjct: 649 EVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRL 708

Query: 710 SELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQ 769
             L S A TFEELQ PFTE+T+S Y +Q +WC +IE  LN  MD+E +SSLHFKPM+PPQ
Sbjct: 709 EGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQ 768

Query: 770 RHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKER 829
           R FI E+AKAYNLY+E+QD EP RSVF+KK D+ +S KP+ SL+E  PLY+SFK  +KER
Sbjct: 769 RLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKER 828

Query: 830 KLQEFQARTTAKLINFEVQD--AESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHT 887
           K+Q+F A+TT  LIN ++ D  A     + +NN FL++N+ +G T++DLK  F  +++ T
Sbjct: 829 KMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKT 888

Query: 888 LVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSV- 946
           L+ NPQY  L +  SA++YPE+Y T S N   DME LVGH +F+  +AFLADS  LC   
Sbjct: 889 LIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDAS 948

Query: 947 --------DEEIGKRLDSPAIQE 961
                   + +I +RL++P +QE
Sbjct: 949 SKLPEEISENDISERLETPEVQE 971

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/898 (60%), Positives = 687/898 (76%), Gaps = 6/898 (0%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYERA+QEIA GD Y+CMICTVEMDYTC+M+AC+ CYRVFDY CIREWALKSTEKT+D
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           ++WKCPNCY V K+VP +NRPTCWCG  VNPDPN LDPNSCGQTC+AP C HGC K CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHKCKKKCHS 232
           GPHP+C R +  KC CG+H++  FCYQ+ +M+ +  F C E CGL L+CG+HKC++ CHS
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217

Query: 233 GLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFAC 292
           G+CG CP  ++N  S+K +I+CYCG   ++S KC + R   +   SKD  G+ W G F C
Sbjct: 218 GICGPCPA-VLNAKSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIGAFGC 274

Query: 293 ADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHD 352
           + IR ++YAC +HSF+E C   P+ISG+  CPF P LLKTCPCGRT+L+ L +PRK C  
Sbjct: 275 SGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTS 334

Query: 353 PIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRC 412
           PIP C+S C K L CG+H CPFTCHDG CMDPC+QI++  CSC ++ +S+PC F+E PRC
Sbjct: 335 PIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRC 394

Query: 413 NIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLS 472
           + KCESLMSCRRHRC +RCC GRP A RR+K+   S++L+DES VE++HICLK CNLTLS
Sbjct: 395 DTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLS 454

Query: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532
           CG HKCQRKCHPGKCPPCLESDSNDL+C CGKTVV APVRCGT+LP C++PCI+V++   
Sbjct: 455 CGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAY 514

Query: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592
            CGHKPMPHTCHP N  CP CT  VFKPC+CGKKDKVRT+CFQ DVSCGT+CG PL  C 
Sbjct: 515 KCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCP 574

Query: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652
           H CQK+CH+ G+CQK CKQIC +KR+ C H C   CHG  +CPD+PC   VKI CEC   
Sbjct: 575 HMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVK 634

Query: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712
           +  ITC A  +T S  T++IL C+EECE  KR  +LREAFG+S   +N  R++  +L  L
Sbjct: 635 ESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENL 694

Query: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772
            +VA +FEEL+LPF+E  L  ++KQE WC QIE +LN  MD+E ++SLHFKPMRP QRHF
Sbjct: 695 AAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHF 754

Query: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832
           IHE+AK+YNLY ESQDREP RSVF+KK+DN  S KPV+ L ++ P+Y+ FK+++KE+K Q
Sbjct: 755 IHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQ 814

Query: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892
            F+A+TT + +NF +   E ++E AKNN F ++N+ +G T EDL+R F  HLK TLV NP
Sbjct: 815 RFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873

Query: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEI 950
           Q+ I D +++ LIYPE+Y   SVN ERD+E LVGHFD++ KE+F+ D I LC +D ++
Sbjct: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKV 931

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/981 (56%), Positives = 701/981 (71%), Gaps = 27/981 (2%)

Query: 11  DLEQDQNGGGIHKHHS----LSNGHVLSVE-----------------DSSEQLXXXXXXX 49
           D EQ+Q+   I+K  S    L  GH L +E                    E         
Sbjct: 4   DKEQEQDQETINKQQSSNGKLFKGHSLVLEFSDDDASDSGSDNNSDLSRDEDESDVDTDN 63

Query: 50  XXXXXLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKST 109
                L YYERA++EIAKGDSY CMICTVEMD+TC+M+AC+ CYRVFDY CIREWALKST
Sbjct: 64  EYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKST 123

Query: 110 EKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCF 169
           +KTVDK WKCPNCYH  KKVP ++RPTCWCG VVNPDPN LDPNSCGQTCNA  C H C 
Sbjct: 124 QKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCL 183

Query: 170 KICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKK 229
           K CHLG HPECT++++I C CGR +K I+C++S+  +  F+C +ECGL+L CG+HKC++K
Sbjct: 184 KQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRK 243

Query: 230 CHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGV 289
           CHSGLCGSCPE +I+++ S K IKCYCG H    + C +  FP SG+ S+++   EW G+
Sbjct: 244 CHSGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGI 302

Query: 290 FACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKH 349
           F C ++R+V Y C++H F+E C++PPT+     CPF P+LLKTCPCG+TAL+++   R  
Sbjct: 303 FDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTK 362

Query: 350 CHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQES 409
           C DPIPTC++ C+K LKCGKH CPFTCH G CMDPC+QID  +C+CE+ TF +PC F+  
Sbjct: 363 CTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGK 422

Query: 410 PRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNL 469
           P C  KCESLMSCRRHRC++ CCSGRP A RRKK+  RS D  DE+LVEA+H+CLK CNL
Sbjct: 423 PVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNL 482

Query: 470 TLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVR 529
            LSCG+H CQRKCHPG CPPCLESDSNDL+C CGKTV+PAPVRCGT LP C +PCIKV+R
Sbjct: 483 KLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIR 542

Query: 530 GESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLS 589
           GES CGHKPMPH+CH  +  CP CT  VFKPC+CGKKDKVRT+CFQ DVSCG  CG+PL 
Sbjct: 543 GESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLK 602

Query: 590 GCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCEC 649
            CYH CQK CHL G+CQ  C QIC  KR +C H C + CH    CPD+PC   V + C+C
Sbjct: 603 DCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDC 662

Query: 650 GRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEG-PNNVIRNELDA 708
           GR K    CS+     SV  +S L+C+EEC  L R  EL+ AFG+  G  ++     ++ 
Sbjct: 663 GRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIER 722

Query: 709 LSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPP 768
           +   +SVAK +EEL+LPF EA L+VY+KQ +WC QIEGILNK MD +++SSLHFK M+ P
Sbjct: 723 IQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAP 782

Query: 769 QRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKE 828
           QR F+H +A AY +Y+ESQD EP+RSVF+KK  N TS KP+L+L EA PLYESFK+ QKE
Sbjct: 783 QRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKE 842

Query: 829 RKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTL 888
           +K QE++ART   LIN E +  +++  A K NGFL++NLV G T EDL+R F   LK TL
Sbjct: 843 KKKQEYEARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTL 901

Query: 889 VANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDE 948
           V +PQYL++D+S    I P +Y   S+N ERDME L+G FD + KE F+ D + LC++DE
Sbjct: 902 VKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDE 961

Query: 949 EIGKR---LDSPAIQEVSSPE 966
            + +    L+    ++++SPE
Sbjct: 962 ALLQENVDLEDSEEEKLTSPE 982

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/898 (58%), Positives = 648/898 (72%), Gaps = 11/898 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYERA++EIA+GD+Y+CMICTVEMDYTC+MFAC KCYRVFDY CIREWALKST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K WKCPNC     KVP ++RPTCWCG VVNPDPN LDPNSCGQTC+AP C HGC K+CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMR-RRFNCQEECGLSLSCGVHKCKKKCHSG 233
           GPHPECTR++ IKC CGRH++ + C +  + R ++F C+E CGL L CGVHKC KKCHSG
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 234 LCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACA 293
           LCG C E + +       IKCYCG H   SI+C + R   + R S D+ GN W GVF C 
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRV--ADRDSVDDQGNGWIGVFRCK 293

Query: 294 DIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDP 353
           D+R V+YAC +HSF+E C   P++  Q  CPF P++L++CPCGRT L +L + R  C D 
Sbjct: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353

Query: 354 IPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCN 413
           IPTC S+C K L CGKH CP+ CH+G CMDPC+Q +  NC CE  +F +PC F+E PRCN
Sbjct: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413

Query: 414 IKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSC 473
            KCESLMSCRRHRC ++CCSG+P A RRKK+ F S++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473

Query: 474 GLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESW 533
           G HKCQRKCHPG+CPPCLESD NDL+C CGKTVV APVRCGTKLP C + CI VVR    
Sbjct: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533

Query: 534 CGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYH 593
           CGH PMPH CHP    CPPCT  V KPC+CGKK  VRT+CFQ DVSCG  C  PL  C H
Sbjct: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593

Query: 594 TCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIK 653
           TCQK CH  G CQ  C+QICG+KR++C H CPKPCHG   CPD PC   V I C CGR +
Sbjct: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652

Query: 654 KSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNEL-DALSEL 712
            +  C     T+S   +  L C+EECE +KR  +L++A G+ E  ++ + N + +AL   
Sbjct: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709

Query: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772
             VA  FEEL LPF E  L++YS+Q+R+C  IE +LN  +D E +SSLHFKPM+P QRHF
Sbjct: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767

Query: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832
           +HE+AKAY LY+ESQD EP RSV++KKE N  S KP ++L EA P+Y++FKQ +KE K++
Sbjct: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827

Query: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892
            ++ +    L+NF V   E  +E AK NGFL++NL  G   EDL+R +  HLK TLV NP
Sbjct: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886

Query: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEI 950
            Y  L D   ALI+PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC V E +
Sbjct: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/899 (58%), Positives = 650/899 (72%), Gaps = 2/899 (0%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYE+A+QEI KGDSY C+ICTVE+DYTC+++AC+KCYRV+DY CIREWA KST K  D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K+W CPNC++  K +P +NRPTCWCG  VNP+PN L+PNSCGQTCNA  C HGC +ICHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234
           GPH ECTRM+ IKC CG+ +K I C+Q +   + FNC+  C   L CG+HKC +KCH+GL
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGL 238

Query: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294
           CGSCPE II+ +++ K I+CYCG   ++ IKC + RFP +   SKD+ G  W GVF C  
Sbjct: 239 CGSCPETIISKNTNMK-IRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDK 297

Query: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354
           IR V Y C +HSF E C +PP+ISG+  C F P  LKTCPCG+  L +L+KPR  C D I
Sbjct: 298 IRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAI 357

Query: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414
           PTC   C K LKCGKH CPF CH G CMDPC QI+   C+CEQ  F+IPCGF +  RCN+
Sbjct: 358 PTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNL 417

Query: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSF-FRSQDLLDESLVEAKHICLKPCNLTLSC 473
           KCESLMSCRRHRC +RCC+GRP A RR+K+     +DL DES +E  HICLK CNLTLSC
Sbjct: 418 KCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSC 477

Query: 474 GLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESW 533
           G+HKC RKCH GKCPPCLESDSNDL+C CGKT+V APVRCGTKLP C +PCI+VVRGE+ 
Sbjct: 478 GIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETD 537

Query: 534 CGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYH 593
           CGH PMPH CHP +I CP CT TVFKPC+CGK+ +VRTVCF  DVSCG  CG  L  CYH
Sbjct: 538 CGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYH 597

Query: 594 TCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIK 653
            CQK CH  G CQ VCKQ C   RL C H CPKPCH   ECPD+PC ALVKITC CGRI+
Sbjct: 598 KCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIE 657

Query: 654 KSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELV 713
           K +TC           S+ + C+EEC  L+R  +L+EAFG+ + P N    E+  L +++
Sbjct: 658 KEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVI 717

Query: 714 SVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFI 773
           S A TF +L LPFTE  ++ Y + E WC  IE  LNKL+D   R+SLHFKPMRPPQR+FI
Sbjct: 718 STASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFI 777

Query: 774 HEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQE 833
            E+AKAYNLY+ESQD EP RSVF+KK  + +S KP+LS++EA PLY+S+K+ +KE+K   
Sbjct: 778 RELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQAN 837

Query: 834 FQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQ 893
           F++ TT +LINF  + +     AA+ NGFLV N+    + +DL+  F P+LK TLV  PQ
Sbjct: 838 FESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQ 897

Query: 894 YLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGK 952
           + IL + + A+IYP  Y+  S+N ERDME LV HFDF+ KE+ LA  + LC+++  + +
Sbjct: 898 FQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/910 (55%), Positives = 643/910 (70%), Gaps = 19/910 (2%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           L +YERAI++IAKGD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K++D
Sbjct: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K+WKCPNC H   K+P +NRPTCWCG  VNPDPN   PNSCGQTCNA +C+H C   CHL
Sbjct: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCY---QSKAMRRRFNCQEECGLSLSCGVHKCKKKCH 231
           GPHP+C R   I C CG+H+K +FCY     K   ++FNC E+C ++LSCG+HKC + CH
Sbjct: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245

Query: 232 SGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFA 291
           SG CG CPE I       K++ CYCG+   + I+CS  +   SG+ SKD+ GN W GVF 
Sbjct: 246 SGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299

Query: 292 CADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCH 351
           C  IRTV+YAC  HSF E C SPPTISG K CP+ P LLKTCPCG+T L++    R+ C 
Sbjct: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359

Query: 352 DPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPR 411
           DPI TC +RC KPLKCGKH CPFTCH+G CMDPC QI+   CSC    FS+PC F E PR
Sbjct: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419

Query: 412 CNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTL 471
           CN+KCESLMSCRRHRC  RCCSG+P A +RKK  F   DLLDESLVEA+HICLK CNL L
Sbjct: 420 CNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479

Query: 472 SCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGE 531
           SCG+H C RKCH GKCPPCLESDS+DL+C CGKTVV APVRCGTKLP C  PCIK + G 
Sbjct: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539

Query: 532 SWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGC 591
             CGHKP  H CHP++I CPPCTE VFKPC+CGK+ K + +CFQ   SCG  C   L GC
Sbjct: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599

Query: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651
           +H CQ  CHL G+CQK C QIC ++R++C HTC + CHG + CPD+PC    ++ C CGR
Sbjct: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659

Query: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGV---SEGPNNVIRNELDA 708
            K+ + C A   T SV  + +L C++ C   +RL+ELR AFG+   SE P     +EL+ 
Sbjct: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDP----ESELER 715

Query: 709 LSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPP 768
           L ++V    ++EEL+LPF+E  LSVYSKQ  WC QIE ++NK ++ + + SLHFKPM  P
Sbjct: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775

Query: 769 QRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKE 828
           QR+FIH + +AY +Y+ESQDREP RSV++KK  N  ++ P +SL EA PLY+S+K+ +KE
Sbjct: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKE 833

Query: 829 RKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTL 888
           RK+Q F+++     +N++  +  S     K NGFL++ +  G T +DL   F  HLK TL
Sbjct: 834 RKVQSFESKKNVTYLNYQPPE-RSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTL 892

Query: 889 VANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDE 948
           + + QY IL D +SA++YP++Y T S N ERD+E L GHFD+M KEA L +S+ +C++ +
Sbjct: 893 IKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952

Query: 949 EIGKRLDSPA 958
            +      P+
Sbjct: 953 ILQTESAEPS 962

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/907 (55%), Positives = 631/907 (69%), Gaps = 15/907 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           L YYE+ I EI KGDSY CMICT+EMDYTC M+AC +CYRV+D+ CIREWALKS++K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K WKCPNCY+V  ++P +NR TCWCG VV+P+ N +DPNSCGQTCNAP C HGC K CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234
           GPHPEC R  ++KC CG+H+K +FCYQS+  +  + C E C L L CGVHKC++KCHSG 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294
           CG+C E I        +I CYCG   +  I C +    KS   SK++SG  W GVF+CA 
Sbjct: 228 CGNCEETISG------KIMCYCGMETREQIICKDV---KSVAKSKNKSGEIWIGVFSCAH 278

Query: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354
           +R+V+Y+C  HSF E C +PPT SG+  CPF P LLKTCPCG T L+ L  PRK C DPI
Sbjct: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338

Query: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414
           PTC +RC+KPLKCGKH CPF CHDG CMDPC+ +D  +CSC   +F +PC F +   CN 
Sbjct: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398

Query: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCG 474
           KCESLMSCRRHRC +RCCSGR  AI+R+K+ F ++D LDESLVEA+HICLKPCNL LSCG
Sbjct: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 475 LHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWC 534
           +H C+RKCHPGKC PCLESDSNDL C CGKTVVPAPVRCGTKLP C HPCIK ++ ++ C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 535 GHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHT 594
           GH PMPH CH     CP CT  ++K C+C K +KVRT+CFQ DVSCG  CG+PL  C HT
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 595 CQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKK 654
           C++TCH  G+CQ +CKQICG  R  C H C   CH   +CPD  C   VK+TC CGR + 
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 655 SITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVS 714
            + C A  D  S      L C+++CE  KR + L EAFG+ E     +   ++ L +LV 
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694

Query: 715 VAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIH 774
            AK+F+EL LPFTE+TLSVYSKQ  WC QIE  L+KLM    R+SLHFKPM+ PQR FIH
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 775 EMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEF 834
           E+A AY LY+ESQDREP RSVF+KK +N  S  P+L L EA PLY SFKQ QKERK++E 
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 835 QARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQY 894
           +  TT +L N+ V DA      A+ N FLV+ +  G T ++L      +L+ TL+ NP Y
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 895 LILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRL 954
             L++    LIYPE++ + S N E D++ L  +   + KE  +++ + L  +DE +    
Sbjct: 874 QTLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932

Query: 955 DSPAIQE 961
               +QE
Sbjct: 933 SEEYLQE 939

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/914 (54%), Positives = 629/914 (68%), Gaps = 20/914 (2%)

Query: 57  YYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKI 116
           YYE+ I+EIAKGD Y CMICTVEMD+TC M+AC +CYRVFDY CIREWA+KST+K+V K 
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 117 WKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGP 176
           WKCPNCY   K VP +NRPTCWCG  ++P+PN L+PNSCGQTC+AP CVHGC   CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 177 HPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCG 236
           HP C RMV+ KC CG+ SK +FC +++  +  F C   CGL+L CGVHKC+++CH+G+CG
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGVCG 242

Query: 237 SCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACADIR 296
            CPE I       K+I CYCG     SIKC + +       S+D SG +W G FAC+ IR
Sbjct: 243 ECPETIA------KEINCYCGLESLPSIKCQDVKIQSK---SQDGSGKKWIGAFACSRIR 293

Query: 297 TVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPT 356
           TV+Y+C +HSF EPC +PP+I+G+  CP+ P  LKTCPCG T LE +  PR  C DPIPT
Sbjct: 294 TVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPT 353

Query: 357 CNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKC 416
           C++ C K L CG+H CPF CH G CM+ C   D   CSC    F +PC FQ  PRCN KC
Sbjct: 354 CDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKC 413

Query: 417 ESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLH 476
           ESLMSCRRHRC +RCC GR  A  R+K  F ++D LDESLVEA+HICLK CNL LSCG H
Sbjct: 414 ESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRH 473

Query: 477 KCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGH 536
            CQRKCHPG CPPCLESDSNDL+C CGKTV PAPVRCGT LP C +PCIK ++G   CGH
Sbjct: 474 FCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGH 533

Query: 537 KPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQ 596
            PMPH CH  +  CP CT  VFK C+CGK  KVRT+CFQ +VSCG  CG  L  C+H+C 
Sbjct: 534 PPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCT 593

Query: 597 KTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKKSI 656
           KTCH  G+CQ +CKQ+CG  R +C H C   CH  + CPD+PC   V++ C CG      
Sbjct: 594 KTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFA 653

Query: 657 TCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVA 716
           TC+A  +         L+C E+C   +R  EL EAFG++          +D L+ L    
Sbjct: 654 TCAA-HEGQDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVD-LAALAEKV 711

Query: 717 KTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEM 776
            TF+EL LPFTEA+LS+++KQ  WC QIE  LN+LM    + SLHFKPM+PPQRHFIHE+
Sbjct: 712 TTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHEL 771

Query: 777 AKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQA 836
           A+AY LY ESQD+EP RSV++KK  +  S+KP LSL EA PLY+SFK +QKERKL+E + 
Sbjct: 772 AQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKELER 829

Query: 837 RTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLI 896
            TT +++N+     ES    A+ NG L+Q +  G   + ++  F  +LKHTL+ +P YL 
Sbjct: 830 STTTRILNY-TSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLK 888

Query: 897 LDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGK---R 953
           L DS   +++ ENY TAS+N ERD+  +VGH D +AK++FLA+ + +C V++ + +   R
Sbjct: 889 L-DSGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEETNR 947

Query: 954 LDSPAIQEVSSPEE 967
            D  ++ E  +PE+
Sbjct: 948 SDESSVAE--APED 959

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/927 (55%), Positives = 644/927 (69%), Gaps = 22/927 (2%)

Query: 25  HSLSNGHVLSVEDSSEQLXXXXXXXXXXXXLQ---YYERAIQEIAKGDSYICMICTVEMD 81
           + LSNG+VL V+ SSE+             L+   YYE+ ++EI KGD Y CMICTVEMD
Sbjct: 11  NDLSNGYVL-VDASSEESEDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMD 69

Query: 82  YTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGN 141
           +TC M+AC  CYRVFD+ CIREWALKST+K+V K WKCPNCY   K+VP +NRPTCWCG 
Sbjct: 70  FTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGK 129

Query: 142 VVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHLGPHPECTRMVEIKCHCGRHSKTIFCYQ 201
            V P+PN L+PNSCGQTC+A  C HGC  ICHLGPHP C RMV++KC+CG+ +K++FC++
Sbjct: 130 SVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHE 189

Query: 202 SKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQ 261
           +      F C   CGL+L CG+HKC++KCHSG+CG CPE I         I CYC    +
Sbjct: 190 AGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYG------TINCYCKLESK 243

Query: 262 NSIKCSEARFPKSGRTSKDESGNEWAGVFACADIRTVDYACHKHSFIEPCLSPPTISGQK 321
            S+KC+E R    GR S+D SGN+W G F+C +IRTV+++C KHSF EPC +PP+ISGQ 
Sbjct: 244 PSLKCTEVRI--EGR-SRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV 300

Query: 322 TCPFLPSLLKTCPCGRTALEELTKPRKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGAC 381
            CPF P  LKTCPCGR+ L E+   R  C DPIPTC+S C K L+CGKH CPF CH G+C
Sbjct: 301 PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC 360

Query: 382 MDPCLQIDSANCSCEQSTFSIPCGFQESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRR 441
           M+ CL  D   CSC    F +PC FQE  RCN KCE+LMSCRRHRCI+RCC GR  A  R
Sbjct: 361 MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR 420

Query: 442 KKSFFRSQDLLDESLVEAKHICLKPCNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICA 501
           +K  F ++D LDESLVEA+HICLK CNL LSCG H C+RKCHPG C PCLESDSNDL+C 
Sbjct: 421 EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP 480

Query: 502 CGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPC 561
           CGKTVVPAPVRCGT LP C HPCIK ++G + CGH PMPH CHP    CP CT  VFK C
Sbjct: 481 CGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSC 540

Query: 562 RCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCI 621
           +C K DKVRT+CFQ DVSCG  CG  L+GC H CQK CH  G+CQ  CKQ CG+ R +C 
Sbjct: 541 KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE 600

Query: 622 HTCPKPCHGKTECPDLPCAALVKITCECGRIKKSITCSAKRDTVSVITSSILDCNEECET 681
           H C   CH  T CPD PC  LV I C CG    ++TC A  +       + L+CN +C+ 
Sbjct: 601 HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPA-EETALECNNDCDV 659

Query: 682 LKRLKELREAFGVSEGPNNVIRN--ELDALSELVSVAKTFEELQLPFTEATLSVYSKQER 739
            +R  EL EAFG+    N   ++  +L+AL+E VS   TF+EL LPF+EATLS++SKQ  
Sbjct: 660 ARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVS---TFQELLLPFSEATLSIFSKQTT 716

Query: 740 WCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKK 799
           WC QIE  L +LM+ + + SLHFKPMRPPQRHFIHE+ +AY+LY ESQD+EP RSVF+KK
Sbjct: 717 WCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKK 776

Query: 800 EDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEFQARTTAKLINFEVQDAESKIEAAKN 859
             +  S++P +SL  A PLY SFK +Q+E+KL+E +  TT ++IN+ V D      AA+ 
Sbjct: 777 TAD--SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARF 834

Query: 860 NGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLILDDSRSALIYPENYETASVNTER 919
           NG LVQN+++G   + ++  F  +LKHTL+ +P YL+L  S   L+Y ++Y TASVN E 
Sbjct: 835 NGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLL-ASGDVLVYCDDYSTASVNVEN 893

Query: 920 DMELLVGHFDFMAKEAFLADSIHLCSV 946
           D+E +VGH D + KE  LA+ ++   V
Sbjct: 894 DIERIVGHLDHIVKEQLLAEGVYATRV 920

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/909 (52%), Positives = 631/909 (69%), Gaps = 15/909 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           L YYE+ I++I+KGD Y CMICT+EMDYTC+M+AC+ CYRVFDY CI+EWA KS  KT+D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K+WKCPNC H  K++P RNRPTCWCG V+NPDPN+L PNSCGQTCN  TCVHGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHKCKKKCHS 232
           GPH EC+ +  +KC CGR+ K IFC+Q K   +   + C E C L L+CGVHKCK+ CHS
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 233 GLCGSCPEFIINDD------SSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEW 286
           GLCG+CPE + ++       +  ++ KCYCG + +N I C   +   +G  SK+  G++W
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282

Query: 287 AGVFACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKP 346
            G FAC   R V YAC++HSFIEPC +  +ISG+K CP+ P LL +CPCG+T+L++L + 
Sbjct: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342

Query: 347 RKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGF 406
           RK C DPIPTC +RC K LKCGKH CP+ CH+G+CMDPC+Q++  NCSC Q  F +PC F
Sbjct: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402

Query: 407 QESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKP 466
           +++P+C  KCESLMSCRRHRC  +CC+G+P A +RKK     ++L DESLVEA HICLK 
Sbjct: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462

Query: 467 CNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIK 526
           CNL LSCG+H C RKCHPG+CP CL SDSNDL+C CGKTV+ APVRCG+KLP C   CIK
Sbjct: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522

Query: 527 VVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGI 586
           V+     CGHKP PH CHPS   CPPCT  V +PC+CGK   V+ VCFQ   SCG  C  
Sbjct: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582

Query: 587 PLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKIT 646
            L  C+H CQ  CH +G+CQK CKQ+C + R +C H C   CHG + CPD+PC  + K++
Sbjct: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642

Query: 647 CECGRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNEL 706
           C+CGR ++   C A  D  S  +  +L C+E+CE   R  +LR+AFG     +   +N  
Sbjct: 643 CKCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701

Query: 707 DALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMR 766
           D +  L+    T+EEL+LP+ ++ +S YSKQ +WC QIE IL K +  + +++LHFKPM+
Sbjct: 702 D-IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760

Query: 767 PPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQ 826
           P QRHF+ E++ ++NLY+ESQD EP RSVF+K++ +  ++ P +SL E  PL+  FK+ +
Sbjct: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818

Query: 827 KERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKH 886
           KERK+Q F++ +  K IN+E ++   K  +   NGF ++ +  G T EDL   F   LK 
Sbjct: 819 KERKIQHFESTSQRKYINYEPKEVIVK-SSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877

Query: 887 TLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSV 946
           TL+ N  Y IL +S  A+IYPE Y + + +  +D+E+LVGHFDF+ KEA + DSI LC+V
Sbjct: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937

Query: 947 DEEIGKRLD 955
           +  I +  D
Sbjct: 938 EGYINQISD 946

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/899 (51%), Positives = 600/899 (66%), Gaps = 16/899 (1%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYE+ ++EI  GD Y+CMICTVE+D TC+M+AC  CYRVFDY C+REWALKST KT+D
Sbjct: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           K WKCPNCY +  K+P + R TCWCG VVNPD N+LDPNSCGQTCNA +CVHGC K+CHL
Sbjct: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234
           GPHPEC   V+IKC CG+H K I C +SK +   +NC + CGL L CG H C+K CH+G 
Sbjct: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGF 211

Query: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294
           CG C   I      K ++ CYCG+ +++ I+CS+ R       SKD SG +W GV++C +
Sbjct: 212 CGPCESII------KTELPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCGE 262

Query: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354
           +RT+ Y+C  H+++E CL+P  I   + CPF P  LKTCPCG+T L+EL KPR+ C D I
Sbjct: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322

Query: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414
           PTC++ C K L CGKH CPF+CH G CMDPCL I    C+C   TF  PC   ++PRCNI
Sbjct: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382

Query: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCG 474
           KCES MSCRRH+C++ CCSG+P+A +R+K+ F  +DL +E+LVE +H+CLK CNL LSCG
Sbjct: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442

Query: 475 LHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWC 534
           +H C  KCHPGKCPPCLESD NDL+C CGKTVVPAPVRCGTKLP C +PCIK+  G + C
Sbjct: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502

Query: 535 GHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQAD--VSCGTSCGIPLSGCY 592
           GH+  PH CHP+   CPPCT  V K CRC KK  +RT+C   D  V+CGT CG+PL+ C+
Sbjct: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562

Query: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652
           H CQK CH+ G+C+  C + CG KR  C H C + CHG + CP+  C   V ITC+C R 
Sbjct: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622

Query: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712
            K + C A  DT S   +  L C+EEC  L+R  EL EAFG++E P    +N  + L  +
Sbjct: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKP----KNTKEQLESI 678

Query: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772
           V VAK F++L +P++E  L+VY KQ  WC QI  + +K ++   + SLH KPMR PQR F
Sbjct: 679 VLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQF 738

Query: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832
           I E+A AY LY+ESQDREP RSV++KK  +  SKKP L+L +A  LY+ FK  +KER  +
Sbjct: 739 IKELASAYALYSESQDREPNRSVYLKKIQS-QSKKPELTLKDASELYQLFKTLEKERMQE 797

Query: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892
            +  + T  LIN    +          N  ++  +   + +++++      LK+TLV  P
Sbjct: 798 HYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTP 857

Query: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIG 951
           QY  L D  S LI+PENY   + NT  DME ++       ++  LA  + +C VDE + 
Sbjct: 858 QYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/908 (48%), Positives = 568/908 (62%), Gaps = 25/908 (2%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           + YYE+ + E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WALK+T  TVD
Sbjct: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
           + WKCPNCYHV +KVP +NR TCWCG  VN DPN ++PNSCGQTC AP C HGC K+CHL
Sbjct: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234
           GPH EC   ++ KC CG+ ++ I CY++KA +R F+C + CGL + CG+HKC++ CH+G 
Sbjct: 136 GPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGP 195

Query: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294
           CG C E I  D      IKCYCG   +N + CSE       + SK +S   W G FAC  
Sbjct: 196 CGPCKEEIAGD------IKCYCGLTTRNKMVCSEVSVVARSKVSKYKS---WIGAFACDR 246

Query: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354
           +R V Y+C KHSF E C++PP++  +  CP+ P    TCPCG+T L EL   R  C D I
Sbjct: 247 MREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHI 306

Query: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414
            +C   C K L CG H CP TCHDG CMDPCL I    C+CEQ  F +PC F  SP C  
Sbjct: 307 SSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTA 366

Query: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCG 474
           KCESLMSCRRHRC +RCCSGRP +++R  S  R +   DES VEA+H+CLK CN  L CG
Sbjct: 367 KCESLMSCRRHRCAERCCSGRPHSVKR-NSRRRRESPDDESEVEAQHVCLKDCNRVLLCG 425

Query: 475 LHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWC 534
           +H C  KCH GKCPPCLESDSNDLIC CGKT+VPAPVRCGTKLP C HPC   +     C
Sbjct: 426 IHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPC 485

Query: 535 GHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHT 594
           GH P  H CHP +  CPPCT TV K CRCG K+++RT C+  DVSC   C  PLS C H 
Sbjct: 486 GHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCNHF 544

Query: 595 CQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKK 654
           CQ  CH  G+CQ+ CKQ CG  R  C H C   CHG T CP+ PC     ITC CG    
Sbjct: 545 CQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSS 604

Query: 655 SITCS--AKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712
           +  CS  A +D   +  S  L C+E+C   +R ++L  AFGV E       +E D    L
Sbjct: 605 TKICSEYAGKDD-GIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKAT----SEEDEALLL 659

Query: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772
              +++F++L LPFTE  LSV++KQ +WC QIE  L KLMD     +LHFKPMR  QR F
Sbjct: 660 AQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRF 719

Query: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832
           +HE++ ++ LY+ESQD EP RSV++KK     S+ P + L++A PLY SFK+ ++E K  
Sbjct: 720 VHELSSSFGLYSESQDPEPKRSVYVKKTG--ISRVPAIGLSKAAPLYTSFKKLEREFKAN 777

Query: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892
             ++  T KL++  + D+      A  N  L+  L S  +   L+  F  +   TL+  P
Sbjct: 778 S-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCP 836

Query: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGK 952
           QY++        I+P +Y + S N E+D+  L G+F  + +E  L   I  C +D  + +
Sbjct: 837 QYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNR 894

Query: 953 --RLDSPA 958
               +SPA
Sbjct: 895 IGSCESPA 902

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/888 (48%), Positives = 567/888 (63%), Gaps = 18/888 (2%)

Query: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114
           L YYE+AI++I  G  Y C+ICTVE+D TC+M+AC  CYRV+DY CI EWA KS++++ D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174
             WKCPNCYH   KV  + R TCWCG  +NP+ N   PNSCGQTC A  C HGC   CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234
           GPHP+C   V +KC CG+ ++ I CYQ+KA++ + +C+  CGL L CGVH C+K CHSG 
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSGP 207

Query: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294
           CG C   +        + KCYCG++  +SI C +    K  R+ K +   +W GVF+C +
Sbjct: 208 CGRCNTVM------SGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHK---KWIGVFSCKN 258

Query: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354
           IR V Y C +HSF E C   P+   +  CP+ P++ KTC CG T L ++ + R+ C DPI
Sbjct: 259 IREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPI 318

Query: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414
           PTC+ RC KPL CGKH CP TCH G CMDPCLQI+   CSC++ TF  PC F   P CNI
Sbjct: 319 PTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNI 378

Query: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCG 474
           KCE+LMSCRRHRCI RCCSG+P A+ R  +     D  DESL+EA+HIC K CN  LSCG
Sbjct: 379 KCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCG 438

Query: 475 LHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWC 534
           LH C  KCHPGKCPPCLESDSNDL+C CGK+V+ APVRCGT  P CN+PCI  +RG   C
Sbjct: 439 LHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPC 498

Query: 535 GHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHT 594
           GH+   H CHPS   CPPCT  V+KPC+CGK    RT+CFQ D+SCG  C   L+ C+H 
Sbjct: 499 GHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHL 558

Query: 595 CQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKK 654
           CQK CH  G+C   C ++CG KR  C H C   CHG   CPD+PC   V ++C CGR   
Sbjct: 559 CQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSL 618

Query: 655 SITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVS 714
            + C A +D  S   +  L C+++C  +++ + L +    SE  N          S +++
Sbjct: 619 KVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGS----SSVIN 674

Query: 715 VAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIH 774
              ++E+L LP++E  + V+SKQ  WC  I+  L +L++ + R SLHFKPM+ PQR F+H
Sbjct: 675 KPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVH 734

Query: 775 EMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEF 834
           E++KA+ LY+ESQDREP RSVF+K     TSK P + L+EA  LY+  K  QKER+  E 
Sbjct: 735 ELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRDLEL 792

Query: 835 QARTTAKLINFEVQD-AESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQ 893
           Q  TT  LI+  + D ++SK   A  N  L+  +    TVE++K  F+  LK TL+ +PQ
Sbjct: 793 QHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQ 852

Query: 894 YLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSI 941
           + +++   +A IYP N+   S N E D++ LV +F  + +   +  ++
Sbjct: 853 FRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898

>NCAS0E01740 Chr5 (339699..340652) [954 bp, 317 aa] {ON} Anc_7.210
           YER044C-A
          Length = 317

 Score = 34.7 bits (78), Expect = 1.1,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 20/157 (12%)

Query: 699 NNVIRNELDALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRS 758
           N   RN +D L + + + ++F E     ++  +      + W L    IL  +M S+ R 
Sbjct: 29  NITFRNVMDQLGQKLEIFESFGE---GISQTDI------QNWYLPRYKILLNIMSSKRRD 79

Query: 759 SLHFKPMRPPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPL 818
           +++ KP     R F   +  +Y    E       ++   KK   C S+  + S      +
Sbjct: 80  NINLKPTFYIFRCFQLLLLSSYCFQLE-------KTYSFKK---CISQTLLYSFIRK-EM 128

Query: 819 YESFKQSQKERKLQEFQARTTAKLINFEVQDAESKIE 855
           ++ ++++ +     EF ++T   LIN  +Q A+ K +
Sbjct: 129 WQIYQETGQLDTFMEFHSKTIVNLINLRLQAAQQKTQ 165

>TPHA0H01950 Chr8 complement(457304..457969) [666 bp, 221 aa] {ON}
           Anc_6.275 YMR188C
          Length = 221

 Score = 32.7 bits (73), Expect = 3.0,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 18/130 (13%)

Query: 775 EMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQE- 833
           E+  A   YA++Q+       F+K+     SK+ V+ + +   + ++  + +   +L E 
Sbjct: 93  EVNVAKEEYAKAQE-------FLKRRAEIDSKQDVVLINDIRTIQDALSEGKNPEELTEI 145

Query: 834 --------FQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLK 885
                   F  +T  KL+   V   E+++E+ KN    +QN + G  ++D  +  E  LK
Sbjct: 146 KNRYGIESFTPQTIKKLLTLNVSGLEAQVESQKNKISNIQNKL-GELMKDDAKAIE-FLK 203

Query: 886 HTLVANPQYL 895
              V  P+ L
Sbjct: 204 THGVQEPELL 213

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%)

Query: 666  SVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVSVAKTFEE 721
            S  + +++  NE  ++ K LK+L+E+F ++E  +  ++NEL  L   V   K +EE
Sbjct: 1306 STKSDTVVAKNEFAKSQKELKKLQESFSINEKKSEELQNELQELQRSVQTMKEWEE 1361

>Ecym_8143 Chr8 complement(306516..310847) [4332 bp, 1443 aa] {ON}
            similar to Ashbya gossypii AFR630C
          Length = 1443

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 20/112 (17%)

Query: 688  LREAFGVSEGPNNVIRN----------ELDALSELVSVAKTFEELQLPFTEATLSVYSKQ 737
            L++   ++EG N+  RN           +D   ++     T +  Q+P+     SV+ K+
Sbjct: 1329 LQDITFINEG-NSTFRNPESFRPHKIVNIDKYFKITKTISTVQFFQVPYDTEKKSVFGKR 1387

Query: 738  ERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIHEMAKAYNLYAESQDR 789
            +        I N  M  E+  S   +PM   Q   ++E+ +   LYA + DR
Sbjct: 1388 D-------SIFN--MSGEVDDSRRIEPMPVLQEFILYELFRINTLYAANHDR 1430

>Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar to
           Ashbya gossypii ADR011C
          Length = 1011

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 862 FLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQYLIL-DDSRSALIYPENYETASVNTE 918
            LVQ  ++G  +E  KR++E  +K T+   P +  L  D  ++ IYP NYE      E
Sbjct: 37  LLVQRDLTGKVLEGEKRYYE-EIKTTVTYKPTHHQLCYDQLNSFIYPTNYEVRDYQYE 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,550,590
Number of extensions: 4369224
Number of successful extensions: 11144
Number of sequences better than 10.0: 57
Number of HSP's gapped: 10303
Number of HSP's successfully gapped: 64
Length of query: 970
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 851
Effective length of database: 39,836,145
Effective search space: 33900559395
Effective search space used: 33900559395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)