Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.3052.289ON24924912191e-171
YNL024C2.289ON24624610801e-150
Smik_14.3072.289ON24624610761e-150
Suva_14.3232.289ON25324610641e-148
NCAS0G03850singletonON2512507951e-107
NCAS0G037702.289ON2512507951e-107
NDAI0G006802.289ON2552557731e-103
KNAG0H019802.289ON2492497711e-103
SAKL0E07612g2.289ON2522437271e-96
CAGL0M06897g2.289ON2482437243e-96
KAFR0H032902.289ON2452506774e-89
KLTH0G10428g2.289ON2512426438e-84
ADL212W2.289ON2512466184e-80
Ecym_33282.289ON2542546115e-79
Kwal_27.115132.289ON2512426091e-78
KLLA0E08295g2.289ON2662445727e-73
NDAI0J028604.352ON347118960.001
Skud_10.3524.352ON336212960.001
Suva_12.2204.352ON337146920.003
SAKL0D06798g1.325ON42191900.007
Smik_10.4224.352ON340180870.012
AER240W1.325ON39079830.044
Skud_2.4031.325ON417129830.048
KNAG0C018001.325ON42164820.053
Kwal_47.166354.352ON322168810.066
KAFR0C042501.325ON39170810.072
Smik_2.4141.325ON41767800.10
TDEL0D019401.325ON405128800.12
KAFR0E042804.352ON315204770.22
YJR129C4.352ON339180770.23
KNAG0B067204.352ON283130760.33
KNAG0E019002.259ON37586720.94
Suva_4.5321.325ON41664692.3
Ecym_11274.352ON320163692.4
TBLA0D052001.325ON39967692.5
Kwal_14.25501.325ON41868683.1
YBR271W (EFM2)1.325ON41964673.9
Smik_6.2475.141ON32640664.8
Skud_7.4665.141ON32640664.9
YGR144W (THI4)5.141ON32640664.9
Suva_7.4345.141ON32740665.2
NCAS0B074101.325ON41464665.8
TPHA0L003404.352ON34183658.4
SAKL0H13508g8.405ON37229649.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.305
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   474   e-171
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   420   e-150
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   419   e-150
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   414   e-148
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               310   e-107
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   310   e-107
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   302   e-103
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   301   e-103
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   284   1e-96
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   283   3e-96
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   265   4e-89
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   252   8e-84
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   242   4e-80
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   239   5e-79
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   239   1e-78
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   224   7e-73
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    42   0.001
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    42   0.001
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    40   0.003
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    39   0.007
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    38   0.012
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    37   0.044
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    37   0.048
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    36   0.053
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    36   0.066
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    36   0.072
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    35   0.10 
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    35   0.12 
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    34   0.22 
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    34   0.23 
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    34   0.33 
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    32   0.94 
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    31   2.3  
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    31   2.4  
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    31   2.5  
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    31   3.1  
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    30   3.9  
Smik_6.247 Chr6 (399759..400739) [981 bp, 326 aa] {ON} YGR144W (...    30   4.8  
Skud_7.466 Chr7 (763159..764139) [981 bp, 326 aa] {ON} YGR144W (...    30   4.9  
YGR144W Chr7 (780399..781379) [981 bp, 326 aa] {ON}  THI4Thiazol...    30   4.9  
Suva_7.434 Chr7 (750806..751789) [984 bp, 327 aa] {ON} YGR144W (...    30   5.2  
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    30   5.8  
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    30   8.4  
SAKL0H13508g Chr8 complement(1157406..1158524) [1119 bp, 372 aa]...    29   9.5  

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  474 bits (1219), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/249 (93%), Positives = 234/249 (93%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLV 120
           ILEKSLHHLLSEATHGRRQFKKVLE               EKNTFHDGSKVYVTDIDKLV
Sbjct: 61  ILEKSLHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLV 120

Query: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240
           LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL
Sbjct: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240

Query: 241 FQLIRKHTV 249
           FQLIRKHTV
Sbjct: 241 FQLIRKHTV 249

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  420 bits (1080), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/246 (82%), Positives = 221/246 (89%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M++IFGGF DLVVPR  EHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLV 120
           ILEKS+ HLLS+  +G +QFKKVLE               EKNTFHDG+KVYVTDIDKL+
Sbjct: 61  ILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLL+RNIELD+VQYEVLARELWWGEPLS DFSPQEG +Q NNVDLVLAADCVYLE+AFPL
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180

Query: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240
           LE+TLLDLT+CI+PPVILMAYKKRRKADKHFF+KIKRNFDVLEITDFSKF+HYLK+RTHL
Sbjct: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  419 bits (1076), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 204/246 (82%), Positives = 220/246 (89%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD+IFGGF DLVVPR  EHLGQTDLSF GKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLV 120
           ILEKS+ HLLS+   G+++FKKVLE               EKN +HDG+KVYVTDIDKLV
Sbjct: 61  ILEKSVDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLV 120

Query: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PLL+RNIELDKVQYEVLAREL WGEPLS DFSPQEGDLQTNNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240
           LE+TLLDLT+C+SPPVILMAYKKRRKADKHFF+KIKRNFDVLEI++FSKFD+YLKQRTHL
Sbjct: 181 LEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHL 240

Query: 241 FQLIRK 246
           FQLIRK
Sbjct: 241 FQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  414 bits (1064), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 204/246 (82%), Positives = 213/246 (86%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFGGFEDLVVPR  EH GQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  ILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLV 120
           ILEKS  HLLSE  H +R F KVLE               EKN FHD +KVYVTDID+LV
Sbjct: 61  ILEKSDDHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLV 120

Query: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PL+ERNIELDKVQYEVLARELWWGEPLS DFSPQEGDLQ NNVDLVLAADCVYLEKAFPL
Sbjct: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPL 180

Query: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240
           LE+TLLDLTNCISPPVILMAYKKRRKADK FF+KIKRNFDVLEI DF KFD+YLKQ+THL
Sbjct: 181 LEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHL 240

Query: 241 FQLIRK 246
           FQL+RK
Sbjct: 241 FQLVRK 246

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  310 bits (795), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFG FE LVVPR  EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-LHHLLSEATH-GRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDK 118
           ILEKS    LL++  H G R+F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGD--LQTNNVDLVLAADCVYLEK 176
           LVPL++RNIEL+ V  EV+A  LWWGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQ 236
           AFPLLERTLLDLT   +PPVILM+Y+KRRKADKHFF+KIK+NFDV+E+ DF+K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  310 bits (795), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 188/250 (75%), Gaps = 4/250 (1%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           MD IFG FE LVVPR  EHLG +DLSFGGKL   LKI EDGGESGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  ILEKS-LHHLLSEATH-GRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDK 118
           ILEKS    LL++  H G R+F+ VLE               EKN FH    V++TDID+
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGD--LQTNNVDLVLAADCVYLEK 176
           LVPL++RNIEL+ V  EV+A  LWWGEPL   F+P   D   +TN VDL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 177 AFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQ 236
           AFPLLERTLLDLT   +PPVILM+Y+KRRKADKHFF+KIK+NFDV+E+ DF+K++ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 237 RTHLFQLIRK 246
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  302 bits (773), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 186/255 (72%), Gaps = 9/255 (3%)

Query: 1   MDTIFG-GFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           MD IFG GF+DLVV R  EHLG +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YILEKS-LHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDK 118
           +ILEKS    LL+      +QF+K++E               EKN FH     Y+TDID+
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDL-------QTNNVDLVLAADC 171
           +VPL+++NI+L+ ++ EV A ELWWGEPL   F+P E          +   VDL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 172 VYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFD 231
           VYLEKAFPLLE+TLLDLT   +PP ILMAY+KRRKADKHFF KIK+NFD++EI DF K++
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 232 HYLKQRTHLFQLIRK 246
           +YLKQRTHLFQLIR+
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 183/249 (73%), Gaps = 3/249 (1%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ IFG F DLVV R  EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  ILEKSLHH--LLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDK 118
           I+EKS     L +  T   ++F+ ++E               EK  FH G KV +TDID+
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177
           LVPL+++NIEL+ V  E++A ELWWGEPLS  F+P  EG  +  +VDL+LAADCVYLEKA
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 178 FPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQR 237
           FPLLE+TLLDLTNC  PPVILMAY+KRR ADK FF KI ++F V EITDFS +D YLKQR
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 238 THLFQLIRK 246
           THLF+LIR 
Sbjct: 241 THLFELIRN 249

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  284 bits (727), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 145/243 (59%), Positives = 177/243 (72%), Gaps = 7/243 (2%)

Query: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-- 65
           F DLV  R TEHLG +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 66  --LHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLVPLL 123
             L    +  T  +   KK++E                K        +YVTDID+LV L+
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183
           +RNI+L+++++ V  +ELWWGEPL  +F+P   +     VDL+LAADCVYLEKAFPLLE 
Sbjct: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSN--QRQVDLILAADCVYLEKAFPLLEV 187

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243
           TLLDLT+C  PP+ILM+YKKRRKADKHFF +IK+NFDVLEI +F++FDHYLKQ+THLFQL
Sbjct: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247

Query: 244 IRK 246
           +RK
Sbjct: 248 VRK 250

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  283 bits (724), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 176/243 (72%), Gaps = 3/243 (1%)

Query: 7   GFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSL 66
           GF DL+  R  EH+GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65

Query: 67  H-HLLSEATHGRR-QFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLVPLLE 124
              LL +  +     F  VLE                K       K Y+TDID+LVPL+E
Sbjct: 66  DGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLME 125

Query: 125 RNIELDKVQYEVLARELWWGEPLSVDFSP-QEGDLQTNNVDLVLAADCVYLEKAFPLLER 183
           +N+EL+ +  +V A+EL WGE L ++F+P + G   T+++DLVLAADCVYLEKAFPLLE+
Sbjct: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243
           TLLDLT C +PPVILMAY+KRRKADKHFF KI++NF+V+ I DF  +D YLKQRTHLFQL
Sbjct: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245

Query: 244 IRK 246
           +RK
Sbjct: 246 VRK 248

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  265 bits (677), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 171/250 (68%), Gaps = 9/250 (3%)

Query: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  R  EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  ILEKS-LHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKL 119
           ++EKS   +LL + +      K +LE               EK  FH   KV +TDI  L
Sbjct: 61  LIEKSDSENLLCDGS-----IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGL 115

Query: 120 VPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQ---TNNVDLVLAADCVYLEK 176
           VPL+ERNI L+K+    +A+EL WG+ L  ++     D      +NVDLV+AADCVY EK
Sbjct: 116 VPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175

Query: 177 AFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQ 236
           AFPLLE+ LLDLTNC +PP+ILMAY+KRRKADK FF +I++NFDV+EI DFS  + Y+KQ
Sbjct: 176 AFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQ 235

Query: 237 RTHLFQLIRK 246
           RTHLF+L RK
Sbjct: 236 RTHLFELKRK 245

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  252 bits (643), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 169/242 (69%), Gaps = 8/242 (3%)

Query: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSLH 67
           F DLV  R  EH G +DL+FGG++ PALKI EDGGESGCGGK+WIAGELLCEY+LE S  
Sbjct: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70

Query: 68  H-LLSEATH--GR-RQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLVPLL 123
           + +LS+  +  GR + F  +LE                +    + +KV++TDID+LV L+
Sbjct: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129

Query: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183
           E N+EL+ +   V A +LWWGEPL  +F P   D  +N  DLVLAADCVYLE AFPLLE+
Sbjct: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP---DAISNKTDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243
           TLLDLT   +PPV+LM+Y+KRRKAD+ FF  I++NF V+ IT F + D +LKQRTHLFQL
Sbjct: 187 TLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQL 246

Query: 244 IR 245
           IR
Sbjct: 247 IR 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  242 bits (618), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 170/246 (69%), Gaps = 8/246 (3%)

Query: 2   DTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYI 61
           +T    FEDLV PR  EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+I
Sbjct: 3   ETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFI 62

Query: 62  LEKSLH-HLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLV 120
           LEKS    +LS+     RQFK ++E                K      + VY+TDI+ L 
Sbjct: 63  LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLC 122

Query: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180
           PL+++N+EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLEKAFPL
Sbjct: 123 PLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPL 175

Query: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240
           LE+TLLDLT   S P++LM+YKKRRKADK FF KIK+ FD++EI DF  ++ Y +QRT+L
Sbjct: 176 LEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYL 235

Query: 241 FQLIRK 246
           FQL+RK
Sbjct: 236 FQLVRK 241

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  239 bits (611), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 131/254 (51%), Positives = 172/254 (67%), Gaps = 12/254 (4%)

Query: 1   MDTIFGG-FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59
           M  +F   FE+LV     EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YILEKSLH-HLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGS--KVYVTDI 116
           ++LEKS    LLS+     +QF KVLE                 N  H+ +   VY+TDI
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118

Query: 117 DKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEK 176
           D L PL+ RN+ ++ ++  V  REL+WG+ L  +F  ++     + VDL+LAADCVYLEK
Sbjct: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEK 173

Query: 177 AFPLLERTLLDLT-NCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLK 235
           AFPLLE  LL+LT N    PV+LM+Y+KRRKADK FF KIK++F + E+TDF ++D Y+K
Sbjct: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIK 233

Query: 236 QRTHLFQLIRKHTV 249
           QRTH+FQL+R+ ++
Sbjct: 234 QRTHIFQLVRRSSI 247

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  239 bits (609), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 165/242 (68%), Gaps = 8/242 (3%)

Query: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-L 66
           F DLV  R  EHLG +DLSFGG++ PALKI EDGGE+GCGGK+W+AGELLC+Y+LE S  
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 67  HHLLSE---ATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLVPLL 123
             +LS+       +  F  +LE                +    D +KVY+TDID+LV L+
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ-LHGDRTKVYITDIDRLVGLM 129

Query: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183
           E N+ L+ +   V    L WGEPL   F P   D + + VDLVLAADCVYLE AFPLLE+
Sbjct: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP---DAKADKVDLVLAADCVYLETAFPLLEK 186

Query: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243
           TLLDLT   +PP +LM+Y+KRRKADK+FF  I++NF ++ IT+F ++D+YLK++THLFQL
Sbjct: 187 TLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQL 246

Query: 244 IR 245
           +R
Sbjct: 247 VR 248

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  224 bits (572), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 162/244 (66%), Gaps = 17/244 (6%)

Query: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-- 65
           FE+LV  R  EHLG+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 66  ---LHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFHDGSKVYVTDIDKLVPL 122
              L HL  +          VLE               ++   +   +VY++DID+L+ L
Sbjct: 94  EHLLSHLFPDGN-----CNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGL 148

Query: 123 LERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLE 182
           +E NI+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLE
Sbjct: 149 MESNIQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLE 201

Query: 183 RTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQ 242
           +TLL+LT+  + P+ILMAYKKRRKADKHFF KIK+NF ++EI DF  FD YLKQRTHLFQ
Sbjct: 202 KTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQ 261

Query: 243 LIRK 246
           L+R+
Sbjct: 262 LMRE 265

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 48/118 (40%), Gaps = 23/118 (19%)

Query: 110 KVYVTDIDK--LVPLLERNIELDKVQYE---VLARELWWGEPLSVDFSPQEGDLQTNNVD 164
           KVYVTD D   +  +L +N EL+ V  E   V+ R+LWW +P         G      + 
Sbjct: 197 KVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGEDNG-----KIG 251

Query: 165 LVLAADCVYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVL 222
           LV+ AD  Y     P       DL  C      L  +  + +  K   S   RN D +
Sbjct: 252 LVVGADITYDNSVIP-------DLCAC------LKQFMDKNRDCKAIISATVRNIDTI 296

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 85/212 (40%), Gaps = 26/212 (12%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K L  L       R++   VLE               
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLALMQKEDRKKLN-VLEIGAGTGIVSLVLLEK 185

Query: 101 EKNTFHDGSKVYVTDIDK--LVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQ 154
            +   +   ++YVTD D   +   L+RN EL+    E    V  + LWWG          
Sbjct: 186 YREFVN---RMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG---------- 232

Query: 155 EGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFS- 213
             D   +++DLV+AAD  Y    FP L + L +        + L++   R ++    F+ 
Sbjct: 233 -SDRIPDDIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQ 291

Query: 214 ---KIKRNFDVLEITDFSKFDHYLKQRTHLFQ 242
              KI  N+ V+  T+  K D   + +T  F+
Sbjct: 292 ECNKIGLNYTVVSSTEHDK-DSESRMKTLTFK 322

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (44%), Gaps = 25/146 (17%)

Query: 109 SKVYVTDIDK--LVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQEGDLQTNN 162
           SK+YVTD D   +   L RN EL+    E    +  + LWWG     D  P E       
Sbjct: 191 SKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWGS----DRVPDE------- 239

Query: 163 VDLVLAADCVYLEKAFPLLERTL---LDLTNCISPPVILMAYKKRRKADKHFFS---KIK 216
           V+LV+AAD  Y    FP L + L   L +++C     +L A  +    DK F     K+ 
Sbjct: 240 VNLVVAADVTYDSTIFPELCQCLAECLAMSHC--KVCLLSATIRSYSTDKEFAQECHKVG 297

Query: 217 RNFDVLEITDFSKFDHYLKQRTHLFQ 242
             + V+  T++ +      + + LF+
Sbjct: 298 LKYSVVTSTEYDRNSEARMEESLLFK 323

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 10/91 (10%)

Query: 101 EKNTFHDGSKVYVTDIDKLVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQEG 156
           E  T     ++Y+TD+ ++VP L++N+E++ +  +    V A  L W  P+S  F+ + G
Sbjct: 271 ESKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYG 328

Query: 157 DLQTNNVDLVLAADCVYLEKAFPLLERTLLD 187
           D   +  D++L AD +Y     P+   T++D
Sbjct: 329 D---DKFDVILIADPIY-SPQHPVWVVTMID 355

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 18/180 (10%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K L  L +     + + KK L                
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQEL-ALTQEEQEEDKKKLNVLEIGAGTGIVSLVL 185

Query: 101 EKNTFHDGSKVYVTDIDK--LVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQ 154
            +N  +  +K+YVTD D   +   L++N EL+    E    +  + LWWG          
Sbjct: 186 SQNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWG---------- 235

Query: 155 EGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSK 214
             D   +++DLV+ AD  Y    FP L + L +        + L++   R ++    F++
Sbjct: 236 -SDKVPDDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLFAQ 294

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 107 DGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLV 166
           D   V+VTD+ ++VP L  N+ L+ +   V A  L W +P S  F  + G+LQ    D +
Sbjct: 252 DADDVFVTDLPEIVPNLRHNLALNNLT-NVRASVLDWSDPTS--FLHEHGELQ---FDAI 305

Query: 167 LAADCVYLEKAFPLLERTL 185
             AD +Y      LL +T+
Sbjct: 306 FVADPIYSPNHPQLLVQTV 324

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 47  GGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFK-KVLEXXXXXXXXXXXXXXXEKNTF 105
           G K W    L+   +L   LH +    T    Q K KVLE                K  +
Sbjct: 219 GWKTW-GSSLILSQLLVDYLHTVGVHITASCNQKKIKVLELGSGTGLVGLSWASKWKELY 277

Query: 106 -HDGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVD 164
             D  +++VTD+ ++V  L++N+ L+ +Q  V A  L W  P   DF  + G    N  D
Sbjct: 278 GTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDFIDRFG--HENEFD 333

Query: 165 LVLAADCVY 173
           ++L AD +Y
Sbjct: 334 IILVADPIY 342

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 110 KVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAA 169
           ++Y+TD+ ++V  L++N++L+K+++ V+A  L W  P   +F  +    Q+   DL+L A
Sbjct: 286 QIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPY--NFIERYNGEQS--FDLILVA 341

Query: 170 DCVY 173
           D +Y
Sbjct: 342 DPIY 345

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 65/168 (38%), Gaps = 46/168 (27%)

Query: 37  ICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXX 96
           +C  G     G + W A   L EY+++       ++  + + +F ++LE           
Sbjct: 127 LCASGT---TGFRTWEAALYLAEYLVQ-------NQEYYAQDRFSRILELGAGTGLVSLV 176

Query: 97  XXXXEKNTFHDGSKVYVTDIDKLV--PLLERNIELDKV----------QYEVLARELWWG 144
                + T  +   +YVTD D  +    +  N +L+ V          QY+   + LWWG
Sbjct: 177 WSQLFQATMKE---LYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKF--QRLWWG 231

Query: 145 EPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCI 192
           E    D  P        +VD+VLAAD  Y     P        L NCI
Sbjct: 232 E----DVVP--------DVDIVLAADVTYDASVVP-------SLVNCI 260

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 107 DGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLV 166
           D  ++Y+TD+ ++V  LE+NI ++++   V++  L W  P S  F    GD +    D++
Sbjct: 250 DEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNPES--FVSNYGDTR---FDVL 304

Query: 167 LAADCVYLEK 176
           L +D +Y  K
Sbjct: 305 LISDPIYSSK 314

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 107 DGSKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLV 166
           D ++++VTD+  +V  L++N+ L+ +Q  V A  L W  P S  F  + G    N  D++
Sbjct: 280 DNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQS--FIDRFG--YENEFDII 335

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 336 LIADPIY 342

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 47  GGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKNTFH 106
           G K W A      +IL + L ++L+E+T   +   +VLE                   + 
Sbjct: 214 GWKTWGAS-----FILSQKLINVLAESTFNFK--PRVLELGSGTGLAGISWLCKWVQKYG 266

Query: 107 DG-SKVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDL 165
           +G +++++TD+  +V  L++N+E++KV+       L W +P   DF     D   +  D+
Sbjct: 267 NGHTEIFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDP--TDFINSYTD---DEFDI 321

Query: 166 VLAADCVY 173
           ++ +D +Y
Sbjct: 322 LIVSDPIY 329

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 81/204 (39%), Gaps = 30/204 (14%)

Query: 44  SGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXXEKN 103
           S  G + W A   LC+YI      ++ +E+ +G      VLE                K 
Sbjct: 113 STTGFRTWEAASYLCDYI-----SNVDTESLNG---CSTVLELGAGTGLCSLTLL---KG 161

Query: 104 TFHDG-SKVYVTDIDK--LVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQEG 156
            F D   KVYVTD D   +   L  N +L+++++E    V  + L WGE           
Sbjct: 162 KFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE----------- 210

Query: 157 DLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCISPPVILMAYKKRR-KADKHFFSKI 215
           D   N++D V+ AD  Y +  F  L + L       S  + L+A   R  + D+ F    
Sbjct: 211 DSIPNDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFLEHC 270

Query: 216 KRNFDVLEITDFSKFDHYLKQRTH 239
             +   +EI   ++ D   K R  
Sbjct: 271 HDSDFKVEIIQSTELDPQSKARVE 294

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 66/180 (36%), Gaps = 19/180 (10%)

Query: 41  GGESGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXXXXXX 100
              S  G + W A   + ++++ K L  L      G+   KK L                
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQEL--APVQGQDDGKKKLNVLEVGAGTGIVSLVI 184

Query: 101 EKNTFHDGSKVYVTDIDK--LVPLLERNIELDKVQYE----VLARELWWGEPLSVDFSPQ 154
            +      +K+YVTD D   +   L+RN EL+    E    +  + LWWG          
Sbjct: 185 LQKYHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWG---------- 234

Query: 155 EGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSK 214
             D    ++DLV+ AD  Y     P L   L +        + L++   R ++    FS+
Sbjct: 235 -SDRVPEDIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLFSQ 293

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 22/130 (16%)

Query: 110 KVYVTDIDK--LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVL 167
           K+YVTD D   L  +   N+ L+KV+ +V  + L W    S D  P  GD     +D+V+
Sbjct: 155 KLYVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWA---SEDRVP--GD-----IDVVV 204

Query: 168 AADCVYLEKAFPLLERTLLDLTNCISPP----VILMAYKKRRKADKHFFSKIKR---NFD 220
            AD  Y    FP L  T LD   C+  P     IL   ++ R+      S+  +   + +
Sbjct: 205 GADITYDPTVFPEL-CTCLD--ECLQQPKCQCAILACTERNRETVHELHSQCAQHSLSME 261

Query: 221 VLEITDFSKF 230
            L+  D  K 
Sbjct: 262 CLQAEDAVKI 271

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 32.3 bits (72), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 14/86 (16%)

Query: 122 LLERNIELDKVQYEVLARELWWGEPLSV---DFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177
           L ER++ LD V          WG   +       PQ EG   T    LVL ++ +Y  + 
Sbjct: 260 LAERHVTLDFVSGS-------WGRKFTDIVHSLLPQCEG---TTAASLVLTSETIYQPEN 309

Query: 178 FPLLERTLLDLTNCISPPVILMAYKK 203
            PL+  TLLDL   I  P  ++   K
Sbjct: 310 LPLITETLLDLKGYIGGPTTVLVAAK 335

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 110 KVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAA 169
           ++YVTD+ ++V  L++N+ L+ ++  V A  L W  P   +F  Q G     + D++L A
Sbjct: 282 EIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNFINQFG--HEMDFDIILVA 337

Query: 170 DCVY 173
           D +Y
Sbjct: 338 DPIY 341

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 55/163 (33%), Gaps = 47/163 (28%)

Query: 37  ICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSEATHGRRQFKKVLEXXXXXXXXXXX 96
           +C  G     G + W A   LC Y+ E             R +F  +LE           
Sbjct: 124 VCASGST---GFRTWEAALYLCHYLCE------------SRPRFGTMLELGAGTGIVSLT 168

Query: 97  XXXXEKNTFHDGSKVYVTDIDKLV-------PLLERNIELDKVQYEVLARELWWGEPLSV 149
               +   F      Y TD DK +         +   ++LDK     L R LW     +V
Sbjct: 169 WHKLQSGQF----MTYATDGDKNIIGKQLKETFISNGVDLDKGNVH-LQRLLW-----NV 218

Query: 150 DFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLERTLLDLTNCI 192
           D  P+         D++LAAD  Y   A P       DL  CI
Sbjct: 219 DSIPKN--------DIILAADVTYDHTAIP-------DLCACI 246

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 109 SKVYVTDIDKLVPLLERNIELD--KVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLV 166
           S+V++TD+ ++VP L  N +L+       V+A  L W    S  F  + GD+Q    D++
Sbjct: 260 SQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDWTNHDS--FVEKYGDIQ---FDII 314

Query: 167 LAADCVY 173
           L AD +Y
Sbjct: 315 LIADPIY 321

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 110 KVYVTDIDKLVPLLERNIELDKV----QYEVLARELWWGEPLSVDFSPQEGDLQTNNVDL 165
           +V++TD+  +VP L++N++L+K       EV    L W +P S  F  + G       D+
Sbjct: 278 RVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSS--FQEKYG---YKKFDV 332

Query: 166 VLAADCVY 173
           +L AD +Y
Sbjct: 333 LLIADPIY 340

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 110 KVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAA 169
           +++VTD+ ++V  L++N+ L+ +   V A  L W  P   DF  + G    N  D++L A
Sbjct: 285 EIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNPH--DFIDKFG--HENEFDVILIA 340

Query: 170 DCVY 173
           D +Y
Sbjct: 341 DPIY 344

>Smik_6.247 Chr6 (399759..400739) [981 bp, 326 aa] {ON} YGR144W
           (REAL)
          Length = 326

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSE 72
           P LK+C        GG  W+ G+L    ++ K  H  L E
Sbjct: 89  PDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQE 128

>Skud_7.466 Chr7 (763159..764139) [981 bp, 326 aa] {ON} YGR144W
           (REAL)
          Length = 326

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSE 72
           P LK+C        GG  W+ G+L    ++ K  H  L E
Sbjct: 89  PDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQE 128

>YGR144W Chr7 (780399..781379) [981 bp, 326 aa] {ON}  THI4Thiazole
           synthase, abundant protein involved in the formation of
           the thiazole moiety of thiamine during thiamine
           biosynthesis; acts more as a co-substrate rather than an
           enzyme by providing the sulphur source for thiazole
           formation; undergoes a single turnover only; required
           for mitochondrial genome stability in response to DNA
           damaging agents
          Length = 326

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSE 72
           P LK+C        GG  W+ G+L    ++ K  H  L E
Sbjct: 89  PDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQE 128

>Suva_7.434 Chr7 (750806..751789) [984 bp, 327 aa] {ON} YGR144W
           (REAL)
          Length = 327

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query: 33  PALKICEDGGESGCGGKVWIAGELLCEYILEKSLHHLLSE 72
           P LK+C        GG  W+ G+L    ++ K  H  L E
Sbjct: 91  PDLKVCIIESSVAPGGGSWLGGQLFSAMVMRKPAHLFLQE 130

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 110 KVYVTDIDKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAA 169
           +++VTD+  +V  L++N++ + +   V A  L W  P   DF  + GD +    D++L A
Sbjct: 281 EMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGDEK---FDVILVA 335

Query: 170 DCVY 173
           D +Y
Sbjct: 336 DPIY 339

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 15/83 (18%)

Query: 109 SKVYVTDIDK--LVPLLERNIELDKVQYE--VLARELWWGEPLSVDFSPQEGDLQTNNVD 164
           + +Y+TD D   L   L RN+ L+ +     V  ++L W E    D  P       +N+D
Sbjct: 193 TTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE----DHIP-------DNLD 241

Query: 165 LVLAADCVYLEKAFPLLERTLLD 187
           L++AAD  Y     P L   +LD
Sbjct: 242 LIVAADVTYDSSVIPSLCHCILD 264

>SAKL0H13508g Chr8 complement(1157406..1158524) [1119 bp, 372 aa]
           {ON} similar to uniprot|P14905 Saccharomyces cerevisiae
           YDR197W CBS2 Translational activator of COB mRNA soluble
           protein cytochrome b translational activator
          Length = 372

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 206 KADKHFFSKIKRNFDVLEITDFSKFDHYL 234
           + +KH  SK+KR+ DVL  TD ++ + Y 
Sbjct: 306 EVNKHGISKMKRDMDVLNSTDINQLNGYF 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,068,322
Number of extensions: 1069684
Number of successful extensions: 2499
Number of sequences better than 10.0: 53
Number of HSP's gapped: 2510
Number of HSP's successfully gapped: 54
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)