Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_14.3062.291ON72723352e-42
YNL024C-A (KSH1)2.291ON72723352e-42
Skud_14.3042.291ON72723325e-42
Suva_14.3222.291ON72723326e-42
Cgla_YGOB_Anc_2.2912.291ON72723101e-38
NCAS0G037602.291ON72723082e-38
NDAI0G006902.291ON72723048e-38
KNAG0H019702.291ON72722971e-36
TDEL0G022102.291ON72722943e-36
TBLA0B069702.291ON72712926e-36
KAFR0H032802.291ON72722892e-35
ZYRO0A01980g2.291ON72722882e-35
SAKL0E07568g2.291ON72722864e-35
Kpol_1003.412.291ON72722841e-34
Kwal_YGOB_Anc_2.2912.291ON72722822e-34
KLTH0G10472g2.291ON72722789e-34
KLLA0E08251g2.291ON72722762e-33
TPHA0C034302.291ON72722641e-31
ADL210W2.291ON72722632e-31
Ecym_33302.291ON72722459e-29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.304
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   133   2e-42
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   133   2e-42
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   132   5e-42
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   132   6e-42
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   124   1e-38
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   123   2e-38
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   121   8e-38
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   119   1e-36
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   117   3e-36
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   117   6e-36
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   115   2e-35
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   115   2e-35
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   114   4e-35
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   114   1e-34
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   113   2e-34
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   111   9e-34
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   110   2e-33
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   106   1e-31
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   105   2e-31
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...    99   9e-29

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  133 bits (335), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  133 bits (335), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  132 bits (332), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 64/72 (88%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  132 bits (332), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 63/72 (87%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSCSYVHGQWPSLLDRYKNHEV GAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMAISQFNS
Sbjct: 61 ACILMAISQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  124 bits (310), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICSC+Y+H QWPSLLDRYKNH++LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACILMAISQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAINQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  123 bits (308), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 61/72 (84%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICSC+YVH QWPSLLDRYK+HE LGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACIIMAINQFNS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  121 bits (304), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 61/72 (84%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSC+YVH QWPS+LDRYK+H  LGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MAI+QFNS
Sbjct: 61 ACIIMAINQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  119 bits (297), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 59/72 (81%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICSC+YVH QWPSLLDRYK HE LGAFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA++QF S
Sbjct: 61 ACILMALNQFMS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  117 bits (294), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (84%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF+S        +CSC+YVH QWPSLLDRYK+H V GAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACILMAISQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAINQFNS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  117 bits (292), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 58/71 (81%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALF+FRS        ICS +Y+H QWPSLLDRYKNH  LGAFWKMARIGERASPYVSL
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAISQFN 71
          ACI MAISQFN
Sbjct: 61 ACIAMAISQFN 71

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  115 bits (289), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (81%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICSC+Y+H QWPSLL+RYK+HE LG FWKMAR+GER SPYVSL
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA++QFNS
Sbjct: 61 ACILMAVNQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  115 bits (288), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (81%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF+S        +CSC+YVH QWPSLLDRYK H VL AFWKMAR+GERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACILMA+SQ NS
Sbjct: 61 ACILMALSQLNS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  114 bits (286), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 53/72 (73%), Positives = 57/72 (79%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNFRS        ICSC+Y+H QWPSLLDRYKNH +L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI MAISQF S
Sbjct: 61 ACICMAISQFKS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  114 bits (284), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 58/72 (80%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICS +Y+H QWPS LDRYK+  VLGAFWK+ARIGERASPYVSL
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QFNS
Sbjct: 61 ACIIMAVNQFNS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  113 bits (282), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF++        ICSC+Y+H QWPSLLDRYK+H +LGAFWK ARIGERASPYVSL
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QF +
Sbjct: 61 ACIIMAVNQFQT 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  111 bits (278), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (81%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF++        ICSC+Y+H QWPSLLDRYK H +LGAFWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QF +
Sbjct: 61 ACIIMAVNQFQT 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  110 bits (276), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 57/72 (79%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF+S        ICSC+Y+H Q PSLLDRYK+  +LG FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI MA+SQFNS
Sbjct: 61 ACIAMAVSQFNS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  106 bits (264), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (77%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALFNF S        ICS +Y+H QWPSL DRYK+  VL  FWK++RIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI+MA++QFNS
Sbjct: 61 ACIIMAVNQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  105 bits (263), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALF F +        ICS +YVH QWPSLL+RYK H VLG FWK ARIGERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACILMAISQFNS 72
          ACI MAI+Q NS
Sbjct: 61 ACIAMAINQINS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score = 99.0 bits (245), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 53/72 (73%)

Query: 1  MSALFNFRSXXXXXXXXICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60
          MSALF F S        ICS +YVH QWPSLL+RYK H VL  FWK ARIGERASPYVSL
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACILMAISQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACIVMVANQFNS 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.135    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,811,980
Number of extensions: 153600
Number of successful extensions: 327
Number of sequences better than 10.0: 20
Number of HSP's gapped: 327
Number of HSP's successfully gapped: 20
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)