Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.2982.283ON38938920750.0
Smik_14.2962.283ON38938917120.0
YNL035C2.283ON38938917100.0
Suva_14.3112.283ON38938917030.0
ZYRO0A01804g2.283ON37638912881e-177
NDAI0G006302.283ON39734912661e-174
NCAS0G038702.283ON38934612641e-174
Kpol_1003.342.283ON38839612541e-172
KNAG0H020402.283ON39936712501e-171
KLTH0G10296g2.283ON42638612431e-170
Ecym_33212.283ON40940912321e-168
KAFR0H033402.283ON36734312121e-166
SAKL0E07766g2.283ON39834312051e-165
TBLA0B059202.283ON40333912041e-164
Kwal_27.115502.283ON40734112031e-164
ADL218C2.283ON40340211951e-163
TDEL0G021402.283ON39239211781e-161
KLLA0E08449g2.283ON42236511681e-158
TPHA0C033702.283ON41335711231e-152
CAGL0G01628g2.283ON37635810721e-145
CAGL0B03575g6.9ON4192091551e-10
ZYRO0F00462g6.9ON3931851381e-08
SAKL0E00814g6.9ON3982061354e-08
ACR017W6.9ON4231831338e-08
NDAI0K029006.9ON4382041283e-07
KAFR0L003206.9ON3911871264e-07
KLTH0C11550g6.9ON3981801265e-07
Kpol_1045.786.9ON3921701231e-06
TBLA0A071206.9ON4071771212e-06
KLLA0D00814g6.9ON4081831194e-06
Suva_5.126.9ON4012001194e-06
KNAG0E009806.9ON4141881185e-06
Ecym_30126.9ON3971901185e-06
Skud_5.336.9ON4011951169e-06
TBLA0D041307.231ON5741641097e-05
Smik_11.2981.247ON6621021098e-05
SAKL0F08404g7.231ON6431631081e-04
TBLA0H036508.548ON4191961071e-04
KLTH0F16192g5.429ON4621661052e-04
Smik_10.1261.247ON7121531053e-04
Smik_5.316.9ON4271261043e-04
TBLA0H030601.247ON730821043e-04
YEL056W (HAT2)6.9ON4011351034e-04
KLLA0E04819g7.534ON4591411034e-04
TDEL0D013101.247ON7092041044e-04
CAGL0G04345g1.247ON7111961034e-04
CAGL0H08932g6.239ON9021731034e-04
KLLA0E07085g3.25ON4521421024e-04
Suva_6.1871.247ON7141531026e-04
KLLA0E21187g5.429ON4291751008e-04
Skud_10.1021.247ON7081531000.001
NCAS0A151707.534ON4742461000.001
KLTH0E12694g8.548ON418180990.001
YJL112W (MDV1)1.247ON7141531000.001
Suva_11.2681.247ON645175990.001
KNAG0F038707.534ON465158980.001
KNAG0B016101.247ON674194980.002
KNAG0D027205.49ON1541194980.002
KNAG0D016907.231ON654165970.002
TPHA0M001906.9ON391204960.002
KLLA0E23541g8.548ON417166950.003
KLTH0D10648g8.651ON449135950.003
Kwal_55.220763.22ON128663960.003
KLTH0F19338g3.22ON129063960.003
ZYRO0A08690g2.401ON516190950.004
KAFR0F025901.247ON700157950.004
KLLA0F21406g1.247ON705130950.004
SAKL0C13266g3.25ON459138950.004
SAKL0C13332g3.22ON135364950.004
Suva_4.3483.344ON548196940.005
Ecym_25236.363ON646167940.006
TPHA0P014903.25ON459136930.007
SAKL0F15972g7.534ON470155930.007
ZYRO0G02618g2.450ON88088930.008
Kpol_1041.202.401ON515187920.009
NDAI0K023506.363ON793164920.010
Kwal_27.120708.548ON41873910.010
ZYRO0A09636g8.435ON808109920.010
ADL186C3.22ON136160920.010
NCAS0E037507.310ON1276184920.010
Ecym_20243.22ON131760910.012
KLLA0F19734g8.288ON113357910.012
AGL234W6.363ON629165910.012
ACR097W8.631ON46798900.013
NCAS0C044503.25ON461138900.013
Kwal_56.223456.9ON396168900.014
Kwal_55.214505.429ON503166900.015
TDEL0A077806.363ON657169900.016
Suva_10.3168.435ON818107900.018
NCAS0G011206.276ON494132890.020
ZYRO0D03828g1.247ON726140890.022
KAFR0A064804.122ON568137890.023
NDAI0H027502.401ON512188880.023
Kpol_2002.995.201ON487115880.023
TBLA0B087303.25ON461160880.025
KLLA0F15598g5.201ON478163880.025
Kwal_26.87008.651ON381135870.026
KAFR0A069906.239ON885157880.030
NDAI0E015008.631ON42859870.031
ZYRO0D01122g7.534ON466157870.031
Skud_4.1097.322ON1201165870.035
YDL145C (COP1)7.322ON1201165870.036
KAFR0A033801.247ON666128870.038
Smik_4.907.322ON1201165870.040
KLLA0A08822g4.122ON582185860.041
Suva_16.5107.534ON465162860.043
Suva_4.997.322ON1201165870.044
YLR222C (UTP13)8.435ON817148860.045
KLLA0A04653g4.77ON700174860.045
KNAG0A036708.548ON426111860.047
TPHA0B042501.107ON507160860.049
Skud_11.2711.247ON646200860.049
TPHA0E030805.201ON488160850.052
NCAS0A139407.322ON1205163860.053
TDEL0G046206.9ON392188850.054
YKR036C (CAF4)1.247ON643133850.056
TPHA0D045007.322ON1208169860.057
NCAS0A055206.363ON671159850.060
Kpol_2001.657.322ON1206169860.061
Suva_14.891.107ON422126850.062
TBLA0F005206.363ON663167850.067
NCAS0A096101.247ON695161850.073
CAGL0L02761g8.631ON41978840.075
TPHA0B011201.247ON719193840.078
TBLA0F042406.363ON727164840.082
Ecym_80901.247ON71668840.084
ZYRO0G10406g4.119ON39136830.087
Kpol_1014.193.25ON452143830.090
TDEL0C022407.322ON1201163840.092
Kpol_1028.236.363ON744186840.095
ADR077C7.322ON1204164840.097
YHR186C (KOG1)5.49ON1557173840.097
Ecym_70428.548ON414107830.099
TDEL0G012805.104ON63581830.100
NCAS0F014502.450ON90893830.10
KLTH0E15576g1.247ON723140830.11
CAGL0L00781g7.231ON673163830.11
Smik_16.4427.534ON470108820.12
NCAS0F019702.401ON511191820.12
Skud_7.5615.104ON59362820.13
Kpol_1041.354.77ON70181820.13
TPHA0G018408.631ON43159820.13
ZYRO0D07744g5.49ON1525164830.14
Kwal_27.126671.247ON721157820.14
KNAG0B027207.322ON1204165820.14
Kpol_1028.546.325ON905211820.15
Smik_14.143.25ON466142820.15
ABL024W2.450ON73464820.16
KAFR0I018807.231ON591163810.16
KLTH0D05346g2.469ON507146810.16
KNAG0A012503.25ON452129810.17
KLLA0E20967g3.22ON132160820.17
CAGL0K03377g2.450ON97844820.17
TPHA0M020006.363ON699173810.18
ZYRO0E07392g6.239ON897155810.18
KNAG0C014101.247ON65394810.19
TDEL0C066901.34ON765136810.19
KNAG0I010508.288ON115956810.19
YPR178W (PRP4)7.534ON465108810.20
NDAI0A020907.322ON1200165810.20
NCAS0F001906.9ON411156800.20
TPHA0J025406.239ON866159810.21
Suva_14.223.25ON469142800.21
Skud_16.326.276ON522143800.24
KAFR0G019708.631ON42559800.25
Suva_6.518.67ON763183800.25
CAGL0A00561g4.119ON41252790.26
TPHA0F005204.77ON71381800.26
CAGL0J01265g2.469ON517111800.26
Skud_14.223.25ON467142800.26
Smik_8.2755.49ON1556173800.27
KLTH0D10186g8.631ON42159790.28
Suva_13.3112.401ON510188790.29
YBR103W (SIF2)3.344ON535195790.29
ZYRO0F07282g8.672ON427169790.29
TBLA0G014904.122ON732190800.30
TBLA0B046805.49ON1549172800.30
Kwal_23.64296.363ON750166790.30
SAKL0E03520g2.450ON96636800.31
Suva_16.606.276ON52673790.32
Kpol_1018.1037.405ON359181780.32
TDEL0E054806.239ON881166790.34
Kpol_1072.418.631ON42059780.34
TDEL0A068906.276ON44757780.35
KNAG0E021802.401ON517190790.36
Kpol_1031.361.247ON706193790.36
SAKL0G12892g5.201ON476115780.37
Kwal_26.77362.469ON50756780.37
Suva_4.537.310ON1271174790.38
AEL314W1.247ON715131790.38
Ecym_42558.324ON937122790.40
KLLA0A08866g4.119ON42387780.41
Skud_7.4674.77ON70884780.41
KLTH0E08162g4.122ON556182780.41
CAGL0M02277g8.672ON427168780.42
CAGL0E01485g3.22ON133657790.42
TBLA0H020005.201ON473116780.44
TPHA0L021305.49ON1508161780.44
KAFR0F010606.276ON553136780.45
YGL137W (SEC27)6.239ON889156780.45
TBLA0B040708.631ON41761770.46
Skud_8.2525.49ON1556174780.47
NCAS0A018504.77ON70181780.48
AAL157C5.201ON479116770.49
KAFR0I028403.25ON456129770.51
NDAI0H023302.450ON99393780.51
CAGL0L03201g1.247ON579159770.52
YMR102C2.450ON83459780.52
KLTH0A07282g6.363ON725166770.52
SAKL0D04796g1.247ON769140770.55
AEL246C8.544ON81541770.57
TBLA0B092502.401ON526189770.57
TDEL0A057708.631ON43379770.58
Skud_13.2612.450ON83459770.59
TDEL0A061808.672ON434162760.61
Kpol_1016.111.247ON66983770.62
NDAI0A033104.106ON81749770.62
KNAG0F018406.239ON911168770.63
Suva_15.3895.49ON1555173770.64
TPHA0A003803.22ON131084770.64
TBLA0H002303.22ON133359770.65
YCR057C (PWP2)6.325ON923154770.65
YNL317W (PFS2)3.25ON465142760.67
SAKL0H07656g8.631ON42661760.68
SAKL0A03872g6.239ON878120770.68
Ecym_70388.544ON80041760.71
ZYRO0C07898g6.16ON97461760.71
Smik_13.2892.450ON83736760.72
Suva_13.2802.450ON84336760.72
Sklu_YGOB_Anc_2.4012.401ON520190760.75
Kpol_1038.203.22ON131357760.75
TPHA0G026502.401ON516188760.77
KNAG0G027908.717ON47175760.79
TBLA0F022307.322ON1216163760.81
CAGL0D05588g5.201ON477332750.82
Smik_3.1576.325ON924154760.84
Smik_14.2352.197ON40083750.84
YGR145W (ENP2)4.77ON70786760.84
SAKL0H09988g8.544ON74940760.85
ZYRO0G03146g2.469ON510143750.85
Skud_12.565.201ON489191750.85
Suva_7.519na 1ON20562740.86
Suva_7.5185.104ON59362750.90
NDAI0E024008.672ON43454750.92
YLL011W (SOF1)5.201ON489191750.92
KAFR0J009805.201ON480160750.93
TBLA0C018408.672ON423170750.93
KAFR0A003802.401ON516190750.95
Ecym_62288.721ON445119750.95
Smik_7.1356.239ON887156750.95
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.298
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   803   0.0  
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   664   0.0  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   663   0.0  
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   660   0.0  
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   500   e-177
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   492   e-174
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    491   e-174
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   487   e-172
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   486   e-171
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   483   e-170
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   479   e-168
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   471   e-166
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   468   e-165
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   468   e-164
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   468   e-164
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   464   e-163
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   458   e-161
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   454   e-158
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   437   e-152
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   417   e-145
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    64   1e-10
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    58   1e-08
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    57   4e-08
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    56   8e-08
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      54   3e-07
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    53   4e-07
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    53   5e-07
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    52   1e-06
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    51   2e-06
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    50   4e-06
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    50   4e-06
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    50   5e-06
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    50   5e-06
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    49   9e-06
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    47   7e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    47   8e-05
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    46   1e-04
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    46   1e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    45   2e-04
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    45   3e-04
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    45   3e-04
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    45   3e-04
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    44   4e-04
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    44   4e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    45   4e-04
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    44   4e-04
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    44   4e-04
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    44   4e-04
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    44   6e-04
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    43   8e-04
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    43   0.001
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    43   0.001
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    43   0.001
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    43   0.001
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    43   0.001
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.001
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    42   0.002
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    42   0.002
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    42   0.002
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    42   0.002
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    41   0.003
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    41   0.003
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    42   0.003
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    42   0.003
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    41   0.004
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    41   0.004
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    41   0.004
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    41   0.004
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    41   0.004
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    41   0.005
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    41   0.006
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    40   0.007
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    40   0.007
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    40   0.008
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    40   0.009
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    40   0.010
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    40   0.010
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    40   0.010
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    40   0.010
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    40   0.010
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.012
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    40   0.012
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    40   0.012
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    39   0.013
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      39   0.013
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    39   0.014
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    39   0.015
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    39   0.016
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    39   0.018
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    39   0.020
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    39   0.022
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    39   0.023
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    39   0.023
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    39   0.023
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    39   0.025
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    39   0.025
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    38   0.026
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    39   0.030
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    38   0.031
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    38   0.031
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    38   0.035
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    38   0.036
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    38   0.038
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    38   0.040
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    38   0.041
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    38   0.043
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    38   0.044
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    38   0.045
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    38   0.045
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    38   0.047
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    38   0.049
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    38   0.049
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    37   0.052
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    38   0.053
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    37   0.054
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    37   0.056
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    38   0.057
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    37   0.060
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    38   0.061
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    37   0.062
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    37   0.067
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    37   0.073
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    37   0.075
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    37   0.078
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    37   0.082
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    37   0.084
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    37   0.087
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    37   0.090
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    37   0.092
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    37   0.095
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    37   0.097
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    37   0.097
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    37   0.099
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    37   0.100
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    37   0.10 
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    37   0.11 
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    37   0.11 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    36   0.12 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    36   0.12 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    36   0.13 
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    36   0.13 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    36   0.13 
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    37   0.14 
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    36   0.14 
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    36   0.14 
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    36   0.15 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    36   0.15 
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    36   0.16 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    36   0.16 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    36   0.16 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    36   0.17 
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    36   0.17 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    36   0.17 
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    36   0.18 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    36   0.18 
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    36   0.19 
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    36   0.19 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    36   0.19 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    36   0.20 
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    36   0.20 
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    35   0.20 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    36   0.21 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    35   0.21 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    35   0.24 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    35   0.25 
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    35   0.25 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    35   0.26 
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    35   0.26 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    35   0.26 
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    35   0.26 
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    35   0.27 
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    35   0.28 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    35   0.29 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    35   0.29 
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    35   0.29 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    35   0.30 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    35   0.30 
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    35   0.30 
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    35   0.31 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    35   0.32 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    35   0.32 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.34 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.34 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    35   0.35 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    35   0.36 
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    35   0.36 
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    35   0.37 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    35   0.37 
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    35   0.38 
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    35   0.38 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    35   0.40 
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    35   0.41 
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    35   0.41 
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    35   0.41 
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    35   0.42 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    35   0.42 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    35   0.44 
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    35   0.44 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    35   0.45 
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    35   0.45 
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    34   0.46 
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    35   0.47 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    35   0.48 
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    34   0.49 
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    34   0.51 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    35   0.51 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    34   0.52 
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    35   0.52 
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    34   0.52 
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    34   0.55 
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    34   0.57 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    34   0.57 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    34   0.58 
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    34   0.59 
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    34   0.61 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    34   0.62 
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     34   0.62 
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    34   0.63 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    34   0.64 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    34   0.64 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    34   0.65 
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    34   0.65 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    34   0.67 
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    34   0.68 
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    34   0.68 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    34   0.71 
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...    34   0.71 
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    34   0.72 
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    34   0.72 
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    34   0.75 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    34   0.75 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    34   0.77 
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    34   0.79 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    34   0.81 
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   0.82 
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    34   0.84 
Smik_14.235 Chr14 (431155..432357) [1203 bp, 400 aa] {ON} YNL092...    33   0.84 
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    34   0.84 
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    34   0.85 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    33   0.85 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    33   0.85 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   0.86 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   0.90 
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     33   0.92 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    33   0.92 
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    33   0.93 
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    33   0.93 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    33   0.95 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    33   0.95 
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    33   0.95 
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   0.97 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    33   0.97 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    33   0.99 
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    33   1.00 
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    33   1.0  
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    33   1.0  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    33   1.0  
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    33   1.0  
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    33   1.1  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    33   1.1  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    33   1.1  
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    33   1.1  
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    33   1.1  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   1.1  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    33   1.2  
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    33   1.2  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    33   1.2  
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    33   1.2  
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    33   1.2  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    33   1.3  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    33   1.3  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    33   1.3  
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    33   1.3  
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    33   1.3  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    33   1.3  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    33   1.3  
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    33   1.3  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    33   1.3  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    33   1.3  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...    33   1.4  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    33   1.4  
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    33   1.4  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    33   1.4  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    33   1.4  
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    33   1.5  
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    33   1.5  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    33   1.5  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    33   1.5  
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    33   1.5  
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    33   1.5  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    33   1.5  
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     33   1.6  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    33   1.6  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    33   1.6  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    33   1.6  
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    33   1.6  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    33   1.6  
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    33   1.7  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    33   1.7  
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      33   1.7  
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    33   1.7  
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    33   1.7  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    33   1.7  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    33   1.7  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   1.8  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    33   1.8  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    33   1.8  
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    32   1.9  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   1.9  
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    33   2.0  
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    33   2.0  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    33   2.0  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    33   2.0  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    33   2.0  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    32   2.0  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    33   2.0  
TBLA0I03150 Chr9 complement(762920..764122) [1203 bp, 400 aa] {O...    32   2.1  
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    32   2.1  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    32   2.1  
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    32   2.2  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    32   2.2  
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    32   2.2  
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    32   2.3  
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    32   2.4  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    32   2.4  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   2.4  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    32   2.4  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    32   2.5  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    32   2.5  
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    32   2.5  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   2.5  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    32   2.5  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    32   2.6  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    32   2.6  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    32   2.7  
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    32   2.7  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    32   2.7  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    32   2.8  
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    32   2.8  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    32   2.8  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    32   2.8  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    32   2.8  
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    32   2.9  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    32   2.9  
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    32   3.1  
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    32   3.1  
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    32   3.2  
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    32   3.2  
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    32   3.2  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   3.2  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    32   3.3  
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    32   3.3  
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    32   3.3  
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    32   3.4  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    32   3.5  
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    32   3.5  
Suva_2.29 Chr2 complement(47586..55955) [8370 bp, 2789 aa] {ON} ...    32   3.5  
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    32   3.5  
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    32   3.7  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    32   3.7  
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    32   3.8  
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    32   3.8  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    32   3.8  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    31   3.9  
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    32   3.9  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    31   4.0  
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    32   4.1  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    32   4.2  
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    32   4.2  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    32   4.2  
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    32   4.3  
NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {O...    32   4.3  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    32   4.3  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    31   4.4  
NDAI0B02680 Chr2 (668741..670354) [1614 bp, 537 aa] {ON}               31   4.5  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    32   4.6  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   4.7  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    32   4.7  
TPHA0L00930 Chr12 (188776..189960) [1185 bp, 394 aa] {ON} Anc_8....    31   4.8  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    32   4.8  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    31   4.8  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    32   4.8  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    31   4.9  
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    31   5.0  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    31   5.0  
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    31   5.0  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    31   5.1  
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    31   5.1  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    31   5.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    31   5.2  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    31   5.2  
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    31   5.3  
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    31   5.4  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    31   5.5  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    31   5.5  
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    31   5.8  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    31   5.8  
KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} simila...    31   5.8  
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    31   6.0  
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    31   6.1  
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    31   6.4  
KLTH0F12364g Chr6 (1041008..1043299) [2292 bp, 763 aa] {ON} weak...    31   6.5  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    31   6.5  
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    31   6.6  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    31   6.7  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    31   6.7  
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    31   6.7  
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    31   6.8  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    31   6.8  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    31   6.9  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    31   7.0  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    30   7.1  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    31   7.1  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    31   7.2  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    30   7.2  
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    31   7.3  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    31   7.4  
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       31   7.4  
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    31   7.6  
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    31   7.7  
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    31   7.7  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    31   7.8  
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    30   8.0  
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    30   8.0  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    30   8.1  
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    30   8.1  
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    30   8.3  
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    30   8.4  
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    30   8.6  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    30   8.9  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    30   9.1  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     30   9.1  
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    30   9.2  
NCAS0B05510 Chr2 complement(1038543..1040039) [1497 bp, 498 aa] ...    30   9.4  
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    30   9.5  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    30   9.7  
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    30   9.8  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    30   9.9  

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
           DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
           DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI
Sbjct: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360
           SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII
Sbjct: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360

Query: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           QKESAVTKPRKEKHKKSNKLSTKSRFKPY
Sbjct: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/389 (83%), Positives = 361/389 (92%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           M+SYSLVESN FGSENWCLKLQPSYK+GLLTGLSNGEIRLLDW + +SLQ IKASET+IN
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
           DLKVIDSDF+AGHLVSSASIDAVKVFDIRTN+C+A I NE+NSPF+SLDSRHGLLACGTE
Sbjct: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           LQGIDAAV+IYDIR+WD PLRS+IDSHHDDVTCIKFHPSDVN+LLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
           DEEEDALHQVINYASIHSCGWLS KRIYTLSHMETFAIHELNDKSDE +EP+P DFGD+R
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           +AW+CDYVVD+YPGLIATGKTQE AGELRL+PF++EK+  E   VIP AHGDEVVRD+FI
Sbjct: 241 KAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFI 300

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360
           SA QSD+LYSCGEDG+VKIWK+  GPLNTPE+FWDYSEK+NVL +D K++  +L+EP+II
Sbjct: 301 SAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLII 360

Query: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           QK+ A TKPRKEKHKKS K STKSRF+PY
Sbjct: 361 QKDLASTKPRKEKHKKSKKHSTKSRFRPY 389

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/389 (83%), Positives = 358/389 (92%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           M+SYSLVESNSFGSENWCLKLQPSYK+GLLTGLSNGEIRLLDW++G+S+QKIKASET+IN
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
           D+KVI SDF+AGHLVSSASIDAVKVFDIRTN  +A+I NEANSPFISLDSRHGLLACGTE
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           LQGIDAAVYIYDIR+WD PLRS+IDSHHDDVTCIKFHPSDVN+LLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
           DEEEDALHQVINYASIHSCGWLS KRI+TLSHMETFAIHELNDKSDE KEP+P DFGD+R
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVR 240

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           E WNCDYVVD+YPGLIATGKTQE  GEL LLPF+DEKVD EN IVIP AHGDEVVRD+FI
Sbjct: 241 EIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFI 300

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360
            A  S++LYSCGEDG VKIW+N  GPL+ PE+FWDYS+K+NVL +D ++ SI+L EP+II
Sbjct: 301 PAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLII 360

Query: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           QKES  T+PRKEKHKK+ K S KSRFKPY
Sbjct: 361 QKESVSTRPRKEKHKKAKKHSMKSRFKPY 389

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/389 (81%), Positives = 362/389 (93%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           M+SYSLV+ NSFGSENWCLKLQP+YK+GLLTGLSNGEI LLDWN+G+ LQKI+ASET+IN
Sbjct: 1   MNSYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
           D+K+IDSDF AG+L+SSASID+VKVFDIR+N CVAKI+NE NSPF+SLDSRHGLLACGTE
Sbjct: 61  DMKIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           LQGIDAA++IYD+R+WDAPLRS++DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ
Sbjct: 121 LQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
           D+EEDALHQVINYASIHSCGWLS KRIYTLSHMETF+IHELNDKSDE KEP+P DFGDIR
Sbjct: 181 DDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIR 240

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           +AWNCDYVVDVYPG IATGKTQEGAGELRLLPF+DEK+D  N IVIP AHGDEVVRDVF+
Sbjct: 241 KAWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFV 300

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIII 360
           S   +D+LYSCGEDG VKIWKN+LG LNTP SFWDYSE+++VL++++K++  SL+EP+II
Sbjct: 301 SEQNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLEDENKEAPTSLEEPLII 360

Query: 361 QKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           QKES  TKPRKEKHKK+ K S KSRFKPY
Sbjct: 361 QKESVATKPRKEKHKKTKKHSKKSRFKPY 389

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  500 bits (1288), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/389 (61%), Positives = 302/389 (77%), Gaps = 16/389 (4%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SYSLV S SFG+ NWCL LQP+Y++ LL  LSNG++  LDW +G+S+  IK  E ++N L
Sbjct: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           K+I++D       ++A++ AVK++DIR+N C+A I N+ N+PF+SLDSRH +LACGTEL 
Sbjct: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G DA ++IYD+R+WD+PLRS++DSHHDD+T I FHPSD NVL+SGSTDGYTNIYDL+Q E
Sbjct: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           EEDALHQVIN+ASIHSCGWL+ +RI+TLSHMETF+IHELNDKSDE KEPRP +F D+RE+
Sbjct: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W CDYVVD++PG +A G +QEG G+LR+LPF+ E+VD  N I I  AHGDEVVRDVF+ A
Sbjct: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIIIQ- 361
             S LLYSCGEDG VK W+N  GPLN  + FWDYS+ LNVLDE          +P++++ 
Sbjct: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE----------QPVVVEE 351

Query: 362 -KESAVTKPRKEKHKKSNKLSTKSRFKPY 389
            KE+  +K +  K KKSN    K RFKPY
Sbjct: 352 PKETKHSKKKHSKSKKSN----KQRFKPY 376

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 280/349 (80%), Gaps = 3/349 (0%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKY-GLLTGLSNGEIRLLDWNSGQSLQKIKASETSI 59
           +S YSL+ S+SFGS NWC K QP  K  GLL  LSNGEI  LD+ + QS Q I+ S  SI
Sbjct: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62

Query: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTN-ACVAKIHNEANSPFISLDSRHGLLACG 118
           NDLK+++SDF  G L S+A+ ++VK+FDI +N   +A +HN+ N PF+SLDSRHGLLA G
Sbjct: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122

Query: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           TELQG+DA + IYDIR+WD PLRS+IDSHHDDVT +KFHPSD  VLLSGSTDGYTN+YDL
Sbjct: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182

Query: 179 KQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGD 238
            Q +E+DALHQV+NYASIHSCGWLS  RI+TLSHMETFAIHELNDKS+E KEP+P DFGD
Sbjct: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242

Query: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298
           +RE W CDYV+DVYPG IA GK+QEG G+L+L+P   E +  ++ +VIP AHGDEV+RDV
Sbjct: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302

Query: 299 FISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEK-LNVLDED 346
           FI    S+L+YSCGEDGFV +WKNN G LN PE FWDYS++ ++VLD D
Sbjct: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGD 351

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  491 bits (1264), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 282/346 (81%), Gaps = 2/346 (0%)

Query: 2   SSYSLVESNSFGSENWCLKLQPSY--KYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI 59
           SSYSLV S SFGS NW LKLQP      GLLT LSNGE+  LD ++  ++QK   SETSI
Sbjct: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGT 119
           NDL++I+ +  +  L ++A+ ++VK+FDI +   VA IH++ N PF SLDSRHGLLACGT
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122

Query: 120 ELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           EL+G+DAA+YIYDIR+WD P+RS++DSHHDDVTC+K+HP+D N+LLSGSTDGYTN+YDL 
Sbjct: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182

Query: 180 QDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDI 239
           + EEED+LHQVIN+ASIHSCGWLS +RI+TLSHMETFAIHELNDKSD  KEP+P D GD+
Sbjct: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242

Query: 240 REAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVF 299
           RE W CDYVVDVYPG IATGK+QE  GEL+L+P +DE +D  N IVIP AH DEV+RDV+
Sbjct: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302

Query: 300 ISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345
           I +  S ++Y+CGEDG VK+WKNN GPLN PE  WDYS+++N+L++
Sbjct: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  487 bits (1254), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/396 (59%), Positives = 298/396 (75%), Gaps = 15/396 (3%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           MSSYSL+ SNS G  +WCL+LQP Y++GLL+ LSNG++ LLDWN+G  ++ +KA  TSIN
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRT--NACVAKIHNEANSPFISLDSRHGLLACG 118
            ++V+DSD+  G + S A  DAVKV D+R   N+ VA+++NE  +PF+SLDSRHG+LACG
Sbjct: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120

Query: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           TEL G+DA ++IYDIR +D P+R ++DSHHDDVT IKFHPSD NVLLSGSTDGYTN+YDL
Sbjct: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180

Query: 179 KQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGD 238
            Q EEEDALHQVINY S+HSCGWLS KRIYTLSHMETFAIHELN+KSDE  EP+P DFGD
Sbjct: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240

Query: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298
           IR  W+CDYVVDVYPG IA GK++E  G L+++PF +E ++  + I IP AHGDEVVRDV
Sbjct: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300

Query: 299 FISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLD-----EDHKQSSIS 353
           FIS    +++YSCGEDG VK WK     L  P  FWDYS ++NVLD     ++ +QS+ +
Sbjct: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRN 360

Query: 354 LKEPIIIQKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           + EP I +++      + +  K+        R+KPY
Sbjct: 361 ISEPSIEKEKKKSKHKKSKHSKR--------RYKPY 388

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 222/367 (60%), Positives = 288/367 (78%), Gaps = 3/367 (0%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           MS  S + S  FGSENWC ++QP YK G+LT LSNGE+ L+DW S +S+ K K+ ET+IN
Sbjct: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
            L+++++D+       +AS+ AVK+FD+R+NAC+  IHNE  +PF+SLDSR+  +ACGTE
Sbjct: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           L+G+DA ++I+D+R+ D P +S++DSHHDD+T IKFHPSD NVLLSGSTDGYTNIYDL Q
Sbjct: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
           +EE+D+LHQVIN+ SIHSCGW++ KRIYTLSHMETFAIHELN+KSDE  EP+P DFGDIR
Sbjct: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240

Query: 241 EAWNCDYVVDVYPGLIATGKT-QEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVF 299
            AW CDYVVD+YPG +ATGK+ +EG GEL+L+P + E V  +N I IP AHGDEV+RDVF
Sbjct: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300

Query: 300 ISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPII 359
           I    S+++YSCGEDG++ IW+NN GPLN PE FW+Y   +NVLDE     S + + PI 
Sbjct: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE--SLDSFAGQPPIS 358

Query: 360 IQKESAV 366
           +Q E + 
Sbjct: 359 LQSEPSA 365

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  483 bits (1243), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/386 (58%), Positives = 291/386 (75%), Gaps = 12/386 (3%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SYS +ES  FG  NWCLKLQP Y  GLLT LSNG + L+DW + +S+ +I+   TS+ND+
Sbjct: 21  SYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDM 80

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
            +I++D   G L+++A+ DAVK++D+++N CVA + N  ++PF+SLDSRHGLL CGTEL 
Sbjct: 81  VIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTELS 140

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G+DA +++YDIR W  PLRS++DSHHDD+T IKFHPSD NVLLSGSTDGY NIYDL Q E
Sbjct: 141 GVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQE 200

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           E+DALHQVIN+ASIHSCGWLS KRIYTLSHMET+ IHELNDK DE  EP+P DFGD+R+ 
Sbjct: 201 EDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRKP 260

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W+C+YV+DVYPG IATGK++EG GEL+L+P   EK + ++ I IP AH DEVVRDV +  
Sbjct: 261 WDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVPF 320

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLD--------EDHKQSSISL 354
              DLLYSCGEDG +K+WK++ GPLN P+ FW YSEK++V           D +   I L
Sbjct: 321 QHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVFSGTVAEVEMMDSEVPDIEL 380

Query: 355 K-EPIIIQKESAVTKPRKEKHKKSNK 379
           + EP  +    AV+K + EK K+ ++
Sbjct: 381 RQEPSDVD---AVSKDQDEKRKRKHE 403

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  479 bits (1232), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/409 (56%), Positives = 294/409 (71%), Gaps = 23/409 (5%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SY+  ++ SFGS+NWCLKLQP Y  GLL+ LSNG + L+DWNS  S+Q I    TSI+ L
Sbjct: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           KV+D+D  +G+   +AS D+VK+FD+R N CVA + N  NSPFISLDSRHG+LACGTEL 
Sbjct: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G DA +++YD+++ DAP+RS  DSHHDD+T IKFH SD +VLLSGSTDGY N+YDLKQ E
Sbjct: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           EE+ALHQVIN+ASIHSCGWLS KRI+ LSHMETF+IHELNDKSDE  EP+P +FGDIR+ 
Sbjct: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           WNCDYVVD++PG I TG TQE +  L+LLPF +E+VD  N I+IPRAHGDEVVRD  I  
Sbjct: 242 WNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIIIQK 362
             S+L YS GEDG + +WK+N G LN P  FW+Y EKLNVL + + +  +++++ I  + 
Sbjct: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360

Query: 363 ESAV-------------------TKPRKEKHKKSNKLSTK---SRFKPY 389
           E  +                   +K R   H ++N+   K    RF PY
Sbjct: 361 EHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 271/343 (79%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SYSLV+  SFGS+NWCLK QP Y +GLLT LSNGE++LLDW +   ++  K  + SIN +
Sbjct: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           K+I++D+    L ++A++++VK++DI++N C+A I N+  SPF+SLDSRH +LACGTELQ
Sbjct: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G+DA +YIYD+R W +P++S +DSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q E
Sbjct: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           E+DAL+QVINYASIHSCGWLS +RIYTLSHMETF+I ELND++DE +EP+P DFGDIR+ 
Sbjct: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           WNCDYV+D+YPG IATG++QEG G L+++P   E V++   I I RAH DEV+RDVFI  
Sbjct: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345
              ++LYSCGEDG VK WK+        E FWDYS++ NV ++
Sbjct: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQ 344

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  468 bits (1205), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 205/343 (59%), Positives = 270/343 (78%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SYS + + SFG ENWCL+LQP Y  GLLT LSNG I L+DW +G+ + +  A   SI++L
Sbjct: 2   SYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNL 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           KV++++F    L +SAS D+VK+FD+RT++CVA +HN+ ++PF+SLDSRH +LACGTEL 
Sbjct: 62  KVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTELS 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G+DA ++IYDI++   PLRS +DSHHDD+T  KFHP D  VL+SGSTDGY NIYDL   +
Sbjct: 122 GVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSD 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           EEDALHQVIN+AS+HSCGWL+ +RIYTLSHMETFAIHELNDKSD+ +EP+P +FGD+R+ 
Sbjct: 182 EEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQP 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W CDY++++ PG IA G++QE  GEL+L+ F DEKVD  N + IP+AHGDE++RDV I  
Sbjct: 242 WGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIPD 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345
             +D+LYSCGEDG + IWK+  GPLN    FWDYS++ NV ++
Sbjct: 302 QTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFED 344

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  468 bits (1204), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 212/339 (62%), Positives = 269/339 (79%), Gaps = 4/339 (1%)

Query: 11  SFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70
           SFGS NWCLK +P Y YGLLT LSNGEI +LDW + Q   KIK  ETSIND +++++++ 
Sbjct: 10  SFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYN 69

Query: 71  AGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYI 130
            G L+ +A+ ++VK++D+++N C+  I NE NSPF+SLDS H ++ACGTEL G+DA +YI
Sbjct: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129

Query: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQV 190
           YDIR WD P+RS +DSHHDD+T IKFHP+D  VL+SGSTDGYTNIYDL + EEED+LHQV
Sbjct: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189

Query: 191 INYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREAWNCDYVVD 250
           INY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+  KEP+P +FGDIR  W C+YV+D
Sbjct: 190 INYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVID 249

Query: 251 VYPGLIATGKTQEGAGELRLLPFRDEKVD--AENEIVIPRAHGDEVVRDVFISALQSDLL 308
           VYPG IATGKT+E  G+L++ PF +EK+D   +N I+IP+AHGDEV+RDVFI+      +
Sbjct: 250 VYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309

Query: 309 YSCGEDGFVKIWK--NNLGPLNTPESFWDYSEKLNVLDE 345
           YSCGEDG VK+WK       L  PE F+DYS +LNVLDE
Sbjct: 310 YSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDE 348

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  468 bits (1203), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 208/341 (60%), Positives = 272/341 (79%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SYS V+S +FG++NWCLKLQP Y  GLL  LSNG ++L+DW   + + +I+A  T+I+D+
Sbjct: 2   SYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDM 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
            V+++D   G L+++A+ D+VK+FD+R++  VA + NE ++PF+SLDSRHG+LACGTEL 
Sbjct: 62  VVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTELS 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G+DA ++IYD++ W  PLRS++DSHHDD+T IKFHP+D NVLLSGSTDGY NIYDL Q E
Sbjct: 122 GVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPE 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           E+DALHQVIN+ASIHS GW + KRIYTLSHMETF IHELNDK +E  EP P DFGDIR++
Sbjct: 182 EDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQS 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W CDYVVDVYPG IATGK+QEG GE++L+PF  E +D ++ + IP AHGDEVVRDV +  
Sbjct: 242 WGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVPF 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVL 343
              D+LY+CGEDG V  WK+N GPLN P+ FW Y+++++V 
Sbjct: 302 QHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVF 342

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  464 bits (1195), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 288/402 (71%), Gaps = 15/402 (3%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           SY L +  SFG++NWCL+L+P Y+ G+L  LSNG + L+DW +G+S+  + A E+SIN L
Sbjct: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           +V+DS    G + ++A+ D VK+FDIRT  CVA + +   +P +SLDSRHG+LA GTEL 
Sbjct: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G+DA V ++ +  W  PLR+ +DSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ E
Sbjct: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           E++ALHQVIN+ASIHSCGWLS KRI++LSHMETFAIHELNDKS+   EP+P  FGD+RE 
Sbjct: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W CDYVVDVYPG IA G T+E AGELRLLP RDE VDA N IV+P+AHGDEVVRDV + A
Sbjct: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE------------DHKQS 350
              +LLYS GEDG + IWK+ LGPLN P  FWDYS+K  VL++             H   
Sbjct: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHSAQHNDQ 361

Query: 351 SISLK-EPIIIQKESAVTKPRKEKHKKSNKLSTK--SRFKPY 389
           + SL  +    Q+E    +    +  +S+K S K  +RF PY
Sbjct: 362 ASSLSGQSQPEQQEYRQVQSDGMRRNRSSKHSKKHSARFTPY 403

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  458 bits (1178), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 285/392 (72%), Gaps = 3/392 (0%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           M+SYS + +  FGS+NWCL LQP Y + LLT LSNGE+  +DW +G+S++  +A  +SIN
Sbjct: 1   MASYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSIN 60

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
            LK+IDS+F  G   + AS D+V + D+R+   +A + N+ N+PF+SLDSRHG+LACGTE
Sbjct: 61  KLKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTE 120

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           L G+DA ++IYD+R W  P+RS +DSHHDDVT I+FHPSD NVLLSGSTDGYTN+YDLKQ
Sbjct: 121 LSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ 180

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
            EE+DALHQVINYASIHSCGWLS KRI+TLSHMET A+HELNDKSDE +EP+P DFGDIR
Sbjct: 181 QEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIR 240

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           E W C YVVD+YPG +A G +QE +  L+L+   +E+++ E  +VIP AHG+EVVRDV I
Sbjct: 241 EKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLI 300

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSS---ISLKEP 357
                ++LYSCGEDG VKIWK      +    FWDYS+K++V  E+         +L   
Sbjct: 301 PPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSEEATTPEAIPAALGNG 360

Query: 358 IIIQKESAVTKPRKEKHKKSNKLSTKSRFKPY 389
           ++ ++E    K +++K  K    +   R+KPY
Sbjct: 361 VVYEQEVEPPKKKEKKKGKQKSHAKSRRYKPY 392

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  454 bits (1168), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 271/365 (74%), Gaps = 1/365 (0%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           S++  +   F   NWCLKLQP Y++GL+T +S+G + LLDW + +++  I+   TSIND+
Sbjct: 2   SFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDM 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122
           KVI+SDF  G + ++A+ D VKV+DIR    VA + N+  SPF SLDSRH +LACGTEL+
Sbjct: 62  KVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTELK 121

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
             DA ++IYDIR W  P+RS +DSHHDD+T IKFHP D N+L+SGSTDGY NIYDL QD+
Sbjct: 122 DYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDD 181

Query: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242
           EEDALHQVIN+ASIHSCGWL  KRI++LSHMETF IHELNDKSDE  EP+P +FGD+R+ 
Sbjct: 182 EEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDK 241

Query: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302
           W CDYV+D+YP  IATGKT E  GEL+++PF++E+VD  + +VIP AHG+EV+RDV I  
Sbjct: 242 WGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIPK 301

Query: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIIIQK 362
            Q+ LLYSCGEDG+V +WK+    LN P +FWDY+      +   ++  + + +   +Q 
Sbjct: 302 NQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSVREIEMDMGQE-TMQH 360

Query: 363 ESAVT 367
           ES+ T
Sbjct: 361 ESSST 365

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/357 (57%), Positives = 269/357 (75%), Gaps = 13/357 (3%)

Query: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62
           S  LV   +FG++NWCL+L+P Y  GLL   SNG + L+DWNS   ++K +  ET+IN L
Sbjct: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRT-NACVAKIHNEANSPFISLDSRHGLLACGTEL 121
           +VI++DF  G + ++ S+ +VK++D+R  ++ VA I N+ NS F+SL+SRH +L CGTEL
Sbjct: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121

Query: 122 QGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
            G+DA ++IYD+R +  P+R+ +DSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q+
Sbjct: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181

Query: 182 EEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIRE 241
           +E++ALHQVINYASIHSCGWLS KRIYTLSHMETFAIHELNDKSDE  EPRP DFGDIR 
Sbjct: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241

Query: 242 AWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFIS 301
            W+CDYVVD+YPG +A GK+ E AGEL++  F +E ++ EN I+IP AHGDEV+RDVFI 
Sbjct: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301

Query: 302 AL----QSDLLYSCGEDGFVKIWKNNLGP-----LNTPESFWDYSEKLNVLDEDHKQ 349
                  SD++YSCGEDG V IW     P     LN  + FW+ +E+L+VL +D+  
Sbjct: 302 PGNLNNHSDIIYSCGEDGNVNIWH---APRCSSILNVSKDFWNATEQLDVLSDDYNM 355

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  417 bits (1072), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/358 (56%), Positives = 268/358 (74%), Gaps = 13/358 (3%)

Query: 4   YSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQK---IKASETSIN 60
           YSL  S +FGS NWCLKLQP +  G+LT +S+GE+ LL    G  L K    K  ETSIN
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLL----GLDLSKQDSFKVGETSIN 56

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120
            L  +D      +L ++++ + VKVFD+R N  VA +  E  +  +SL S HG+LA G+E
Sbjct: 57  ALSRVD---GQENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSE 113

Query: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            QG+DA ++++DIR W  P+RS +DSH DD+T I FHP+D NVLLSGSTDGYTN+YDL +
Sbjct: 114 QQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLE 173

Query: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240
            EEEDALHQVINYASIHSCGWL+ +RI+TLSHMETFAIHELNDKS+E +EP+P DFGDIR
Sbjct: 174 PEEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIR 233

Query: 241 EAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFI 300
           + W+C+YVVD+YPG I+ G ++EG G LR++PFR+E V A++ I I +AHGDE+VRD +I
Sbjct: 234 QPWDCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYI 293

Query: 301 SALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPI 358
              QSD+LYSCGEDG VK W+N++  L+ PE+FWDYS K+++L ++  +  +  K+P+
Sbjct: 294 LPSQSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSDEVPEVQLE-KQPV 349

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 101/209 (48%), Gaps = 37/209 (17%)

Query: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS----- 58
           +L+ +  + +EN + L    + KY LL+G  +  I L  W+     + IK + T      
Sbjct: 170 ALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL--WDISNFEKNIKPTITFEDAHT 227

Query: 59  --INDLKVIDSDFAAGHLVSSASIDA-VKVFDIRTNACVAKIHNE------ANSPFISLD 109
             IND+K   S+    H+  S S D+ +K+FD R++  +  I+ +      A SPF S  
Sbjct: 228 DIINDVKWHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS-- 282

Query: 110 SRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGST 169
               L A      G D  VY+YDIR    PL ++   H D VT I+F P++  +L S  +
Sbjct: 283 ---NLFAAA----GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGS 334

Query: 170 DGYTNIYDLK-------QDEEEDALHQVI 191
           D  T ++DL+       QDE ED   +V+
Sbjct: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVL 363

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 21/185 (11%)

Query: 6   LVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS----IN 60
           L+ +  F +EN + L   P+ K  LL+G  +  I L D  +G+S + I          +N
Sbjct: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVN 204

Query: 61  DLKVIDSDFAAGHLVSSASIDA-VKVFDIRT-NACVAKIHNEANSPFISLDSRHGLLACG 118
           D K  + D    ++  S S D+ +++ D R  +A V K+  +A  P+ +L       A  
Sbjct: 205 DCKWHNFD---QNIFGSVSEDSTLQLHDQRIRDAAVEKV--QAKKPYNTL----AFSAHS 255

Query: 119 TEL---QGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175
           T L    G D+ VY+YD RR   PL  ++  H D VT ++FHP +  VL+S  +D  T +
Sbjct: 256 TNLFAAAGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314

Query: 176 YDLKQ 180
           +DL +
Sbjct: 315 WDLAE 319

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 95/206 (46%), Gaps = 23/206 (11%)

Query: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWN-SGQSLQKIKASETS---I 59
           +LV  ++F  +N + L   P  K  LL+   +G I L  WN  G +    KA  T    +
Sbjct: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTSPSKAVTTHEDIV 209

Query: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRH--GLLA 116
           ND      +F      S +    +++ D RTN+ V ++    +SPF +LD S+H   L A
Sbjct: 210 NDCTW--HEFNENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLFA 265

Query: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
                 G D+ VY+YD+R     L ++   H D VT ++F P    +L S  +D    ++
Sbjct: 266 AA----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320

Query: 177 DLKQ----DEEEDALHQVINYASIHS 198
           DL Q      +EDA   V     +H+
Sbjct: 321 DLMQIGSEQAQEDAADGVPELMMMHA 346

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 3   SYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-N 60
           S + V + +F  EN + L   P     LL+G  +  + L D  + +  + I  S   I N
Sbjct: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRHG--LLAC 117
           D+K    +F +    + +    ++V D R      K    A SPF +L  S+H   LLA 
Sbjct: 235 DVKW--HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA-SPFNTLSFSKHSRNLLAA 291

Query: 118 GTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD 177
                G+D+ +Y+YD+R   +PL  ++  H D VT ++F P    ++ S  +D    I+D
Sbjct: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346

Query: 178 LKQ 180
           L Q
Sbjct: 347 LTQ 349

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 96/204 (47%), Gaps = 25/204 (12%)

Query: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQK--IKASETSIND 61
           +L+ +  F  EN + L   P+ K  LL+G  +G I L D     +L K  +K  ++  ND
Sbjct: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246

Query: 62  LKVID---SDFAAGHLVSSASIDAVKVFDIR-TNACVAKIHNEANSPFISLD-SRHG--L 114
           + V D   ++F +    S +    +++ D R  N  +  I  +   PF +L  S+H   L
Sbjct: 247 I-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSI--KTTDPFNTLAFSKHSQYL 303

Query: 115 LACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174
           +A      G D+ VY+YD R    PL S ++ H D +T ++F P    VL+S   D    
Sbjct: 304 MAAA----GTDSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358

Query: 175 IYDLKQ-------DEEEDALHQVI 191
           ++D+         D+ ED   +VI
Sbjct: 359 MWDINDIGAEQIPDDAEDGAPEVI 382

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 49/106 (46%), Gaps = 15/106 (14%)

Query: 126 AAVYIYDIRR-WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
             V+IY+      + L S +  H ++   + F+P+D   LLSGS DG   ++D++++   
Sbjct: 173 GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL 232

Query: 185 --------DALHQVINYASIHSCGW--LSQKRIYTLSHMETFAIHE 220
                   D++H  I    ++ C W   +     ++S   T  +H+
Sbjct: 233 AKKPLKIWDSVHNDI----VNDCKWNEFNSNVFASVSEDSTLQLHD 274

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 2   SSYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS-- 58
           SS S V++ S+  +N + L   P  K  LL+   +G I + D N  +S   ++  +++  
Sbjct: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN-AESEDPVETWQSTDN 197

Query: 59  --INDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRH--G 113
             IND+K    D      VS    + + ++D+RT   V  I  E   PF SL  S+H   
Sbjct: 198 CIINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHSKN 254

Query: 114 LLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYT 173
           L +      G D  VY+YD+R     L S+   H   VT ++FH S   +L+S S D   
Sbjct: 255 LFSAA----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309

Query: 174 NIYDLKQ 180
            I+DL +
Sbjct: 310 IIWDLME 316

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 125 DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
           +  V I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 90/180 (50%), Gaps = 20/180 (11%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQ-KIKASETSI-NDLKVIDSDFAAGHLVSSASIDAVKVF 86
           LL+   +G I + D  SG++   K+  S  +I N+ K  +    +  L  S S D+  + 
Sbjct: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEK---SPFLFGSVSDDSTLII 233

Query: 87  -DIRTNACVAKIHNEANSPFISLD-SRHG--LLACGTELQGIDAAVYIYDIRRWDAPLRS 142
            D R +  V KI    + P+ +L  S+H   L A      G D+ V +YD+R+ +AP+ S
Sbjct: 234 HDKRIDKPVVKILQ--SEPYNTLAFSKHSSNLFAAA----GTDSQVQLYDLRKPEAPIHS 287

Query: 143 IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ----DEEEDALHQVINYASIHS 198
           +   HHD VT ++F P    +L SGS+D    I+DL Q     ++EDA   V     +H+
Sbjct: 288 M-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHA 346

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 85/170 (50%), Gaps = 14/170 (8%)

Query: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAA--GHL 74
           + L   P+    L++G  +  I L D +SG   +  K+   +I+   V D  +     +L
Sbjct: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGS--KSPKSVWDNIHSDIVNDCSWHHFDENL 214

Query: 75  VSSASIDA-VKVFDIRTNACVAKIHNEANSPFISLD-SRH--GLLACGTELQGIDAAVYI 130
             S S D+ +K+ D R+ + V     +A + F +L  S+H   L A      G+D  +Y+
Sbjct: 215 FGSVSEDSTLKLHDKRSTSKVINTI-QAKAAFNTLAFSKHSANLFAAA----GLDTNIYL 269

Query: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           YD R+   PL  ++  H D +TC++FHP +  +L+SG  D    ++DL +
Sbjct: 270 YDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 81/177 (45%), Gaps = 19/177 (10%)

Query: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-NDLKVIDSDFAAGHLV 75
           + L   P  K  LL+   +G +    WN  +S+  +   ETSI ND++    +      V
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230

Query: 76  SSASIDAVKVFDIRTNACVAKIHNEA--------NSPFISLDSRHGLLACGTELQGIDAA 127
           + +S   +K  D+R N    KI +          N+   S  S + + A G      D+ 
Sbjct: 231 TESSCLNLK--DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
           +Y+YD R  + PL   +  H D VT + FH  +  +++SG +D    ++DLKQ  +E
Sbjct: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 82/183 (44%), Gaps = 18/183 (9%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSL---QKIKASET 57
           ++S+S  + N +G     L   P+    LL+   +G + L D  S  +    Q       
Sbjct: 162 IASFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD 216

Query: 58  SINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAK--IHNEANSPFISLDSRHGLL 115
            +ND K    +F +    + +  + + + D  ++  + K  + +  N+   S  S + L 
Sbjct: 217 IVNDCKW--HEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLA 274

Query: 116 ACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175
           A GT     D+ VY+YD+RR   PL S+   H D VT ++F P    +L S  +D    +
Sbjct: 275 AAGT-----DSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIM 328

Query: 176 YDL 178
           +DL
Sbjct: 329 WDL 331

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 91/200 (45%), Gaps = 20/200 (10%)

Query: 12  FGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70
           F  EN + L   P  +  LL+G  +  + L D N      +   + + ++   V DS + 
Sbjct: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWH 217

Query: 71  AGH--LVSSASIDAV-KVFDIR---TNACVAKIHNEANSPFISLDSRHGLLACGTELQGI 124
             +  L  + S D++ K+ D+R   T    AK     N+   S  S + L A GT     
Sbjct: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT----- 272

Query: 125 DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ---- 180
           D+ VY+YD+R    PL  +   H D VT ++F P    V++S  +D    ++DLKQ    
Sbjct: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAE 331

Query: 181 ---DEEEDALHQVINYASIH 197
              D+ ED + ++I   + H
Sbjct: 332 QTPDDAEDGVPELIMVHAGH 351

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 22/188 (11%)

Query: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNS--GQSLQKIKASETSI-NDLKVIDSDFAAGH 73
           + L   P  K  LL+G  +  + L D  S   + +QK +   + I ND +    +F    
Sbjct: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNFQKSL 237

Query: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVYI 130
             + +   ++++ D R +  VA I+     PF +L   H    LLA G    G+++ VY+
Sbjct: 238 FGTVSEDSSLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNSEVYL 291

Query: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DEE 183
           YD R  + PL  ++  H D VT + F   D  ++LS   D    I+D+         ++ 
Sbjct: 292 YDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDA 350

Query: 184 EDALHQVI 191
           EDA  +V+
Sbjct: 351 EDATSEVM 358

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 92/231 (39%), Gaps = 27/231 (11%)

Query: 126 AAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEED 185
             VYIYD           +  H D+   + F+P     LLSGS D    ++D+  D  E 
Sbjct: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE- 212

Query: 186 ALHQVINYASIHS-----CGWLS-QKRIY-TLSHMETFAIHELNDKSDEFKEPRPADFGD 238
               V  + +IHS     C W + QK ++ T+S   +  IH+        +E +P    +
Sbjct: 213 ---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDT-------RESKPVATIN 262

Query: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298
             + +N          L+ATG       E+ L   R      E  + +   H D V    
Sbjct: 263 GTKPFNTLSFSHHSENLLATGGVN---SEVYLYDRR----YVEEPLHLMSGHTDAVTSLD 315

Query: 299 FISALQSDLLYSCGEDGFVKIWK-NNLGPLNTPESFWDYSEKLNVLDEDHK 348
           F S+    ++ S G D  V IW  N++G     E   D + ++ ++   H+
Sbjct: 316 F-SSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHR 365

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 87/190 (45%), Gaps = 15/190 (7%)

Query: 3   SYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-N 60
           S  L ++ S+  +N + L   P  +  LL+   +  + L D NS      I  + T I N
Sbjct: 149 SEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVN 208

Query: 61  DLKVIDSDFAAGHLVSSASID-AVKVFDIRT---NACVAKIHNEANSPFISLDSRHGLLA 116
           D K  + D    ++  + S D  ++V D R+   +A V  +    N+   S  S++ + A
Sbjct: 209 DSKWHEFD---ENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAA 265

Query: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
            GT     D  VY+YD+RR   PL ++   H D VT I+F      +L S  +D    I+
Sbjct: 266 AGT-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319

Query: 177 DLKQDEEEDA 186
           DL Q   E A
Sbjct: 320 DLTQIGAEQA 329

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 91/195 (46%), Gaps = 21/195 (10%)

Query: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQ-SLQKIKASETSINDLKVIDSDFAAGH-- 73
           + L   P  K  LL+G  +  + L D + G  S   I+  +   +D+ V DS +   +  
Sbjct: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWHNFNKD 222

Query: 74  LVSSASIDAV-KVFDIR---TNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVY 129
           L  + S D++ K+ DIR   T    AK     N+   S  S + L A G     +D+ VY
Sbjct: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG-----MDSHVY 277

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DE 182
           +YD+R    PL  +   H D VT ++F P    V++S  +D    ++DLKQ       D+
Sbjct: 278 LYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDD 336

Query: 183 EEDALHQVINYASIH 197
            ED + ++I   + H
Sbjct: 337 AEDGVPELIMVHAGH 351

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 75/164 (45%), Gaps = 15/164 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L LQ +Y+  L TG  +  I + D  SG+ ++++      I  L      F    L++ +
Sbjct: 244 LTLQFNYRL-LFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLY-----FDENKLITGS 297

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               ++V+D +   C++     ++S  +S+D    L+  G+     D +V ++ I R   
Sbjct: 298 LDKTIRVWDYKGGRCISTYKGHSDS-ILSVDCYKKLIVSGSA----DCSVKVWHIERRTC 352

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
                +  H + V C+K HP+  +   S S D    ++DL+ ++
Sbjct: 353 ---YTLKGHTEWVNCVKLHPTSFSC-FSASDDCTIRMWDLRSNK 392

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 7/102 (6%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           YK  L TG  +G +RL D   G+ ++ ++     I  LK     F +  LV+ +  ++V+
Sbjct: 517 YKSALATGTKDGIVRLWDLRVGKPVRLLRGHTDGITSLK-----FDSEKLVTGSMDNSVR 571

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDA 126
           ++D+RT++ V  I  +   P  SLD    L+A G   +G++ 
Sbjct: 572 IWDLRTSSVVDVIAYDL--PVTSLDFDDKLIAVGANERGVNV 611

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 89/208 (42%), Gaps = 47/208 (22%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSL--------QKIKASET------SINDLK 63
           C++L  +    L+TG  +  ++L D N  + L        Q ++ + T       I+D +
Sbjct: 386 CMQLDAANHNMLITGSKDATLKLWDLNLSKELYLDHTPLKQNMEQNPTPCIHNFEIHDDE 445

Query: 64  VIDSDFAAGHLVSSASIDAVKVFDIRTNACV-------AKIHNEA--------------- 101
           +    F +  L+S +    +  +D+ T  C+       A  HN++               
Sbjct: 446 ITALSFDSEALISGSKDKKILHWDMATGKCIQQLDLIFAPTHNDSRISAPSSNYSTRLLD 505

Query: 102 -NSPFI-SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPS 159
            ++P I +L      LA GT+    D  V ++D+ R   P+R ++  H D +T +KF   
Sbjct: 506 TDAPMIGALQCYKSALATGTK----DGIVRLWDL-RVGKPVR-LLRGHTDGITSLKF--- 556

Query: 160 DVNVLLSGSTDGYTNIYDLKQDEEEDAL 187
           D   L++GS D    I+DL+     D +
Sbjct: 557 DSEKLVTGSMDNSVRIWDLRTSSVVDVI 584

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 76/163 (46%), Gaps = 15/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L LQ +++Y L TG  +  + + D  SG+ ++++      +  +   D     G L  + 
Sbjct: 336 LSLQFNHRY-LFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYFDDQKLITGSLDKT- 393

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               ++V++ +T AC++     ++S  +S+DS   ++  G+     D  V ++ +   ++
Sbjct: 394 ----IRVWNYQTGACISTYRGHSDS-VLSVDSYKKIIVSGSA----DKTVKVWHV---ES 441

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
                +  H + V C+K HP       SGS D    ++D++ +
Sbjct: 442 RTCYTLRGHSEWVNCVKLHPKSFTC-FSGSDDTTIRMWDIRSN 483

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 89/196 (45%), Gaps = 18/196 (9%)

Query: 6   LVESNSFGSENWCLKL--QPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKAS----ETSI 59
           ++E  +   E  CL +   P  +  LL+  SNG I L D+    S +  + +    +T+ 
Sbjct: 186 VIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNF 245

Query: 60  NDLKVIDSDFAAGH---LVSSASIDAVKVFDIRTNACVAKIHNEANSPFIS---LDSRHG 113
           +DL   +  +  GH     +    + + VFD R    V  I    ++  I+    +  + 
Sbjct: 246 DDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENA 305

Query: 114 LLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGST-DGY 172
           +L    +  GI   + ++DIR+ + P+R++   H   ++ I++ P    ++ SG   DG 
Sbjct: 306 MLLASGDSNGI---INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGL 360

Query: 173 TNIYDLKQDEEEDALH 188
             ++D+  +EE   +H
Sbjct: 361 VKLWDISNEEEPIFIH 376

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 8/166 (4%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
           C +  P+    L+ GLSN E+R  D         ++  +  ++ +  +         +SS
Sbjct: 259 CAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFISS 318

Query: 78  ASIDAVKVFDIRTNACVAKIHNEA--NSPFISLDSRHGLLACGTELQGIDAAVYIYDIR- 134
           +   +++++D + N  + +I + A  + PFI +   H   A     Q +D A+Y + ++ 
Sbjct: 319 SEDKSMRIWDNQVNIPIKQISDTAQYSMPFIDIHPEHHYFAT----QSMDNAIYAFSMKP 374

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPS-DVNVLLSGSTDGYTNIYDLK 179
           ++    +   + H      I F  S D   L SG T G   I+D K
Sbjct: 375 KYRRNPKKRFEGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWDWK 420

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 14/153 (9%)

Query: 24  SYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV 83
           S+   L TG  +G +RL D  SG+ ++ +K    +I  LK     F +  LV+ +    V
Sbjct: 572 SFDAALATGTKDGIVRLWDLRSGKVIRTLKGHTDAITSLK-----FGSECLVTGSYDRTV 626

Query: 84  KVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI 143
           +V+D+RT   ++K H   + P +SLD      A    +   + AV IYD  + D     +
Sbjct: 627 RVWDLRT-GLLSKFH-AYSEPILSLDLCQENAAV---IVANETAVQIYDSNK-DESWSCV 680

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
              +  +VT IK+     N ++ G   G  +I+
Sbjct: 681 EQGNEVNVTAIKYKE---NYMVEGRESGDVHIW 710

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 26/137 (18%)

Query: 62  LKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNE-ANSPFISLDSRHGLLACGT 119
           +  +D D   G L ++  +D  VK++D+     + ++    A    + +D  +  L  G 
Sbjct: 399 ITCLDFDAPFGTLCTAGYLDHTVKIWDLSKQTQIGELAGHLATINCMQIDCDYETLVTG- 457

Query: 120 ELQGIDAAVYIYDIR-----------------RWDAPLRSIIDSHHDDVTCIKFHPSDVN 162
              G DAA+ ++++                    D+P     ++H D+VT +   PS   
Sbjct: 458 ---GRDAALKLWNLNLAQQLYQETQNPTSFTSHIDSPCVYTFEAHTDEVTALSLDPS--- 511

Query: 163 VLLSGSTDGYTNIYDLK 179
            L+SGS D     +DL+
Sbjct: 512 FLVSGSQDRTIRQWDLR 528

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 18/126 (14%)

Query: 83  VKVFDIRT-NACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVYIYDIRRWDA 138
           +K+ D+R  N  +  +  +   PF +L   H    LLA      G+D+ VY+YD+R    
Sbjct: 259 LKINDVRAHNITIDAV--KCPQPFNTLAFSHHSSNLLAAA----GMDSHVYLYDLRNMRE 312

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191
           PL  +   H D VT I+F      V++S  +D    ++DLKQ       D+ ED + ++I
Sbjct: 313 PLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELI 371

Query: 192 NYASIH 197
              + H
Sbjct: 372 MVHAGH 377

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 10/82 (12%)

Query: 102 NSPFI-SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSD 160
           N P I +L      LA GT+    D  + ++D+R  +   + I   H D +T +KF   D
Sbjct: 580 NKPIIGALQCFDSALATGTK----DGIIRLWDLRSGEIARKLI--GHQDAITSLKF---D 630

Query: 161 VNVLLSGSTDGYTNIYDLKQDE 182
            N ++SGS DG T I+DL+QD+
Sbjct: 631 TNNIISGSLDGSTRIWDLRQDQ 652

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 66/161 (40%), Gaps = 34/161 (21%)

Query: 60  NDLKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPF--ISLDSRHGLLA 116
           N +  +D D   G L S+  +D ++KV+D+     +   H    +    I L S   LL 
Sbjct: 414 NSISCLDFDIPFGKLYSTNKLDNSIKVWDLNRFKQIGIKHKAHLTTINCIQLYSTKDLLI 473

Query: 117 CGTELQGIDAAVYIYDIRRW-----------------DAPLRSIIDSHHDDVTCIKFHPS 159
            G    G DA V ++DI+                      L+S+ D H D++T +  H  
Sbjct: 474 TG----GKDALVKLWDIQSEKFCEDEEENSIEPLNEDSISLKSLFDLHSDEITSLFMHE- 528

Query: 160 DVNVLLSGSTDGYTNIYDLKQDEEEDAL-------HQVINY 193
             N L++GS D     +DL   +   +L       +Q +NY
Sbjct: 529 --NNLVTGSQDKTIIHWDLNSGKNIQSLLIGFPMENQTVNY 567

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 28  GLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFD 87
            L TG  +G IRL D  SG+  +K+   + +I  LK     F   +++S +   + +++D
Sbjct: 593 ALATGTKDGIIRLWDLRSGEIARKLIGHQDAITSLK-----FDTNNIISGSLDGSTRIWD 647

Query: 88  IRTNACV 94
           +R +  +
Sbjct: 648 LRQDQLI 654

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 17/135 (12%)

Query: 74  LVSSASIDAV-KVFDIRTNACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVY 129
           L  + S D++ K+ D+R N        +   PF +L   H    LLA      G+D+ VY
Sbjct: 223 LFGTVSEDSLLKINDVRANNTTIDT-VKCPQPFNTLAFSHHSSNLLAAA----GMDSYVY 277

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DE 182
           +YD+R    PL   +  H D V  ++F      V++S  +D    ++DLKQ       D+
Sbjct: 278 LYDLRNMKEPLHH-MSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDD 336

Query: 183 EEDALHQVINYASIH 197
            ED + ++I   + H
Sbjct: 337 AEDGVPELIMVHAGH 351

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 18/141 (12%)

Query: 72  GHLVSSASIDAVK-VFDIRTNACVAKIHNEANSPFISLD-SRHGL-LACGTELQGIDAAV 128
           G LVS+A +DA+  ++DIR+   +  +   +  P  S+D S++G  LA G+     D  +
Sbjct: 317 GSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK-PIYSVDWSQNGYQLASGSG----DGTI 371

Query: 129 YIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD----LKQDEEE 184
            ++DIR+    + +I+ +H+  V+ +KF+  +   L+S   D   NI++    +K+   E
Sbjct: 372 KVWDIRK-KGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKERSLE 429

Query: 185 DALHQVINY----ASIHSCGW 201
             L +V++       I+S GW
Sbjct: 430 GHLDKVMSIDIVGPDIYSAGW 450

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 88/204 (43%), Gaps = 46/204 (22%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQK-----IKASETS--------INDLKV 64
           C+++   Y   L+TG  +  +++ + N G  L +     I +SET+        ++++  
Sbjct: 445 CMQIDNRYNM-LITGGRDAVLKMWNLNLGAQLYQEESDAIPSSETACVYTFDSHVDEITA 503

Query: 65  IDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI---------HNEAN-----------SP 104
           +   F +GHLVS +    V+ +D+ +  C+  I            +N           SP
Sbjct: 504 LS--FDSGHLVSGSQDRTVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDTSP 561

Query: 105 FI-SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNV 163
            I +L      LA GT     D AV ++D+R     +   ++ H   VT +KF   D   
Sbjct: 562 IIGALQCFDAALATGTR----DGAVRLWDLR--SGKIIRTLEGHTGAVTSLKF---DSKN 612

Query: 164 LLSGSTDGYTNIYDLKQDEEEDAL 187
           L++GS D    I+DL+     DA 
Sbjct: 613 LITGSLDRSVRIWDLRTGTLADAF 636

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           +   L TG  +G +RL D  SG+ ++ ++    ++  LK     F + +L++ +   +V+
Sbjct: 569 FDAALATGTRDGAVRLWDLRSGKIIRTLEGHTGAVTSLK-----FDSKNLITGSLDRSVR 623

Query: 85  VFDIRTNACVAKIHNEANSPFISLD 109
           ++D+RT         E  SP +SLD
Sbjct: 624 IWDLRTGTLADAFAYE--SPVLSLD 646

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 85/196 (43%), Gaps = 36/196 (18%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
           L+T   +  IR  D  SG+ +Q             V D +F         S+ A K   +
Sbjct: 512 LMTASQDKTIRRWDLYSGKCIQ-------------VFDVNFP--------SLSAYKSSFM 550

Query: 89  RTNACVAKIHNEANSPFI-SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSH 147
           ++N   + I    N+P I S+ S    LA GT+    D  + ++D+R     +  +++ H
Sbjct: 551 KSNED-SMILKTVNTPIIGSIQSFDAALATGTK----DGLIRLWDMRT--GEVVRVLEGH 603

Query: 148 HDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRI 207
            D +T +KF   D   ++SGS DG   ++DL+ +     L  +I+Y    S      K I
Sbjct: 604 MDAITSLKF---DATTIISGSLDGTIRLWDLRSNN----LTDIISYEKPISSLDFDAKHI 656

Query: 208 YTLSHMETFAIHELND 223
              S+     I++ ND
Sbjct: 657 VVASNEHNTHIYDRND 672

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 14/173 (8%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           + L PS  + +LT L +G + + ++ + Q ++ I+ ++T +   K I        +V  +
Sbjct: 19  IDLHPSEPW-VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITR---KNWIVVGS 74

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRR 135
             + V+VF+  T   VA     A+  +I   + H     +  G++    D  V +++   
Sbjct: 75  DDNKVRVFNYNTGEKVADF--VAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWEN 128

Query: 136 WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
            D  L      H   V C+ F+P D NV  SG  D    ++ L Q      LH
Sbjct: 129 -DWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNACVAKIHNE-ANSPFISLDSRHGLLACGTELQGIDAAVYIY 131
           ++++S+    VK+FD +T +CVA +    +N  F        ++  G+E    D  V ++
Sbjct: 200 YMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSE----DGTVKLW 255

Query: 132 DIRRWDAPLRSIIDSHHDDVTCIKFHP-SDVNVLLSGSTDGYT 173
           +   +   L   ++   +   CI  HP    N + SG  +G+T
Sbjct: 256 NSSTY--KLEKTLNLGLERSWCIATHPVGRKNCIASGFDNGFT 296

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 20/142 (14%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G +VS +  + +K +D R+ +CV+ +          L  +H +++    
Sbjct: 209 DVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTM----------LGFKHTIISTKFQ 258

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D    +YDIR+    L S+ D    D   +++HP D  V   G  DG 
Sbjct: 259 PKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGS 316

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL Q+ + +     I YA
Sbjct: 317 IKHFDLSQENQPNKPTHNIPYA 338

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 74/153 (48%), Gaps = 14/153 (9%)

Query: 24  SYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV 83
           S+   L TG  +G +RL D  SG+ ++ ++    +I  LK     F +  LV+ +    V
Sbjct: 574 SFDAALATGTKDGVVRLWDLRSGKVIRTLEGHTDAITSLK-----FDSACLVTGSYDRTV 628

Query: 84  KVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI 143
           +V+D+RT   + K H   ++P +SLD      A    +   + +V +YD  + D     +
Sbjct: 629 RVWDLRT-GLLNKFH-AYSAPVLSLDFSQDNAAV---VVADETSVQVYDSNK-DESWPCV 682

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
            + +  +VT +K+     N ++ G  +G  +I+
Sbjct: 683 EEGNETNVTAVKYKE---NYMVEGRGNGSVHIW 712

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 28/134 (20%)

Query: 65  IDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI---HNEANSPFISLD-SRHGLLACGTE 120
           +DSDF    LVS +    ++ +D+R+  C+  I       +S   ++D S+  LL   +E
Sbjct: 510 LDSDF----LVSGSQDRTIRQWDLRSGKCMQAIDLSFANVSSTATNVDLSKSTLLTQRSE 565

Query: 121 ------LQGIDAAVYIYD----IRRWDAPLRS-----IIDSHHDDVTCIKFHPSDVNVLL 165
                 LQ  DAA+        +R WD  LRS      ++ H D +T +KF   D   L+
Sbjct: 566 RPSIGALQSFDAALATGTKDGVVRLWD--LRSGKVIRTLEGHTDAITSLKF---DSACLV 620

Query: 166 SGSTDGYTNIYDLK 179
           +GS D    ++DL+
Sbjct: 621 TGSYDRTVRVWDLR 634

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 78/175 (44%), Gaps = 18/175 (10%)

Query: 12  FGSENWCLKLQPSYKYGLLTGLSNGEIRLLDW----NSGQSLQKIKASETSINDLKVIDS 67
           F S   C+   P  K  L+ GLSN EIR  D     N G+ +QK    + SI  LK    
Sbjct: 219 FNSVPNCITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGE-VQKYDHHQGSILALKY--- 274

Query: 68  DFAAG-HLVSSASIDAVKVFDIRTNACVAKIHNEA--NSPFISLDSRHGLLACGTELQGI 124
            F  G  L+SS+    V++++ R N  + +I   A  + P+I ++ + G   C    Q +
Sbjct: 275 -FPDGKKLISSSEDKTVRIWENRINIPIKQISGTAQHSMPWIDINPQ-GQSFC---TQSM 329

Query: 125 DAAVYIYD-IRRWDAPLRSIIDSHHDDVTCIKFHPS-DVNVLLSGSTDGYTNIYD 177
           D  +Y Y  + ++          H+     I F  S D   + SG + G T I+D
Sbjct: 330 DNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPDGQYIASGDSKGQTFIWD 384

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 73/153 (47%), Gaps = 14/153 (9%)

Query: 24  SYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV 83
           S+   L TG  +G +RL D  SG+ ++ ++    +I  LK     F +  LV+ +    V
Sbjct: 568 SFDAALATGTKDGIVRLWDLRSGKVIRTLEGHTDAITSLK-----FDSACLVTGSYDRTV 622

Query: 84  KVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI 143
           +V+D+RT   ++K H   N+P +SLD      A    +     +++IYD  + D     +
Sbjct: 623 RVWDLRT-GLLSKFH-AYNAPVLSLDFFQDNAAV---VVSNATSIHIYDSNK-DESWPCV 676

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
                 +VT +K+     N +L G  +G  +I+
Sbjct: 677 EKGDEVNVTAVKYKD---NYMLEGRGNGDVHIW 706

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 68  DFAAGHLVSSASIDAVKVFDIRTNACVAK---IHNEANSPFI-SLDSRHGLLACGTELQG 123
           D  +G  + +  +    V    TN  ++K   +   +  P I +L S    LA GT+   
Sbjct: 522 DLCSGKCMQTIDLSFANVLTTATNVDLSKSTLLTQRSERPTIGALQSFDAALATGTK--- 578

Query: 124 IDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
            D  V ++D+R     +   ++ H D +T +KF   D   L++GS D    ++DL+
Sbjct: 579 -DGIVRLWDLR--SGKVIRTLEGHTDAITSLKF---DSACLVTGSYDRTVRVWDLR 628

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 27/148 (18%)

Query: 51  KIKASETSIND-LKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNE-ANSPFIS 107
           KI + E++ +D +  +D D   G L ++  +D  VK++D+     + ++    A    + 
Sbjct: 383 KIGSIESAHDDFITCLDFDGPFGTLCTAGYLDHTVKIWDLSKRKKIGELAGHLATINCMQ 442

Query: 108 LDSRHGLLACGTELQGIDAAVYIYDIR-----------------RWDAPLRSIIDSHHDD 150
           +D  +G L  G    G DAA+ ++++                  + D+P     ++H D+
Sbjct: 443 IDRDYGTLVTG----GRDAALKLWNLNLAEQLYQETQNLTCPASQIDSPCVFTFEAHIDE 498

Query: 151 VTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           VT +   P   N L+SGS D     +DL
Sbjct: 499 VTALSLDP---NFLVSGSQDRTIRQWDL 523

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 105/246 (42%), Gaps = 47/246 (19%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNG---EIRLLDWNSGQS--------- 48
           MS  +L  + S+  +   +K+  +    +++G+ NG   +I  L WNS  +         
Sbjct: 195 MSDNALCATGSWAGD---IKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDC 251

Query: 49  LQKIKASETSINDLK-----------VIDSDF-AAGHLVSSASIDAV-KVFDIRTNACVA 95
           L KI + +  +  +K           V++ DF  +G  V+SAS D   +++DI +   + 
Sbjct: 252 LVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ 311

Query: 96  KIHNEANSPF-ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
                    + +S  +   LL  G    G+D A  ++D+R   + +   +  H   +  +
Sbjct: 312 FQEGHGKEVYSLSFQNDGALLCSG----GLDNAAIVWDVRTGKSIMN--LQGHAKPIYSV 365

Query: 155 KFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYAS-----------IHSCGWLS 203
            + P   ++  +G  DG  NI+D+++  E   L    N  +           + SCG+  
Sbjct: 366 DWSPDGYHIA-TGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDK 424

Query: 204 QKRIYT 209
           Q RIY+
Sbjct: 425 QIRIYS 430

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 29/180 (16%)

Query: 26  KYGLL-TGLSNGEIRLLDWNSGQSLQKI-KASETSINDLKVIDSDFAAGHLVS------- 76
           + GLL T  S+G++ + D      L+K  K S T IN L +   D    + VS       
Sbjct: 205 RQGLLATSYSHGQVCVWD------LEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDS 258

Query: 77  ----SASIDAVKVFDIRT----NACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAV 128
                +  + V + DIR      +  +  H+         +    +L C  +  G    +
Sbjct: 259 LLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAG---RI 315

Query: 129 YIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTD-GYTNIYDLKQDEEEDAL 187
            ++DIR +  PL++++  H+D ++ ++++P +  VL +G  D G   I+DL Q E ++ +
Sbjct: 316 NLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELI 373

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 14/153 (9%)

Query: 24  SYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV 83
           S+   L TG  +G +RL D  SG+ ++ +K    +I  LK     F +  LV+ +    V
Sbjct: 574 SFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLK-----FDSACLVTGSYDRTV 628

Query: 84  KVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI 143
           +++D+RT   + K H   ++P +SLD      A    +   + +V IYD  + D     +
Sbjct: 629 RIWDLRT-GLLNKFH-AYSAPVLSLDLFQENAAV---VVADEPSVQIYDSEK-DESWSCV 682

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
              +   V+ +K+     N ++ G  +G  NI+
Sbjct: 683 EQGNETSVSTVKYKE---NYMVEGRENGDVNIW 712

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 36/163 (22%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
            L L PS+   L++G  +  IR  D  SG+ LQ I  S  ++              L +S
Sbjct: 507 ALSLDPSF---LVSGSQDRTIRQWDLRSGKCLQTIDLSFANV--------------LTTS 549

Query: 78  ASIDAVKVFDIRTNACVAKIHNEANSPFI-SLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
            ++D  K       + +    NE   P I +L S    LA GT+    D  V ++D+R  
Sbjct: 550 TNVDLSK-------STLLTQRNE--RPSIGALQSFDAALATGTK----DGVVRLWDLR-- 594

Query: 137 DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
              +   +  H D +T +KF   D   L++GS D    I+DL+
Sbjct: 595 SGKVIRTLKGHTDAITSLKF---DSACLVTGSYDRTVRIWDLR 634

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 126/319 (39%), Gaps = 69/319 (21%)

Query: 62  LKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNE-ANSPFISLDSRHGLLACGT 119
           L  +D D   G L ++  +D  VK++D+     + ++    A    + ++  +G L  G 
Sbjct: 401 LTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTG- 459

Query: 120 ELQGIDAAVYIYDIR-----------------RWDAPLRSIIDSHHDDVTCIKFHPSDVN 162
              G DAA+ ++++                    D+P     ++H D+VT +   PS   
Sbjct: 460 ---GRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPS--- 513

Query: 163 VLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELN 222
            L+SGS D     +DL+  +      Q I+         LS   + T S     +   L 
Sbjct: 514 FLVSGSQDRTIRQWDLRSGK----CLQTID---------LSFANVLTTSTNVDLSKSTLL 560

Query: 223 DKSDEFKEPRPADFGDIREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAEN 282
            + +E    RP+  G ++           +   +ATG T++G   +RL   R  KV    
Sbjct: 561 TQRNE----RPS-IGALQS----------FDAALATG-TKDGV--VRLWDLRSGKV---- 598

Query: 283 EIVIPRAHGDEVVRDVFISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNV 342
            I   + H D +    F SA     L +   D  V+IW    G LN    F  YS  +  
Sbjct: 599 -IRTLKGHTDAITSLKFDSA----CLVTGSYDRTVRIWDLRTGLLN---KFHAYSAPVLS 650

Query: 343 LDEDHKQSSISLKEPIIIQ 361
           LD   + +++ + +   +Q
Sbjct: 651 LDLFQENAAVVVADEPSVQ 669

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 79/175 (45%), Gaps = 24/175 (13%)

Query: 12  FGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAA 71
            GSE   +     Y   L +G  +G +RL D   G+ ++ ++     I  LK     F +
Sbjct: 487 LGSEAPMIGALQCYNSALASGTKDGVVRLWDLRIGKPVRALEGHTDGITSLK-----FDS 541

Query: 72  GHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIY 131
             LV+ +  ++V+++D+RT++ +  I  +   P  SLD    L+  G    G++    ++
Sbjct: 542 EKLVTGSMDNSVRIWDLRTSSIIDVIAYDL--PITSLDFDDKLITVGANETGVN----VF 595

Query: 132 DIRR---WDAP-----LRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           ++ R   W  P     L+   D   + +  +K+       L++G  +G  N++ +
Sbjct: 596 NMERDEHWMTPEPPNSLKG--DEASERIAIVKYKDG---FLINGHNNGDINVWSI 645

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 72/158 (45%), Gaps = 12/158 (7%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASI 80
             PS KY + +   +   RL D  + Q LQ  +     +  L    S    G L+ S  +
Sbjct: 274 FHPSDKY-VASASFDTTWRLWDVETAQELQLQEGHSKEVYSL----SFQPDGALICSGGL 328

Query: 81  DAVK-VFDIRTNACVAKIHNEANSPF-ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
           D++  V+D+R+   +  +   A   + +   S    LA G    G D  V ++D+R+ + 
Sbjct: 329 DSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQLATG----GGDGVVNVWDLRKLEQ 384

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
           P   ++ +H   V+ ++F  +  +VL+SG  D   N+Y
Sbjct: 385 PATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 79/158 (50%), Gaps = 11/158 (6%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDF-AAGHLVSSASIDAV-KVF 86
           L+TG  +  +RL  +N G+S   +  +    ++ +V+++ F  +   V+SAS D   +++
Sbjct: 235 LVTGADDNYVRLTRYN-GESNGLVNVATLGGHENRVVNTVFHPSDKYVASASFDTTWRLW 293

Query: 87  DIRTNACVAKIHNEANSPFISLDSR-HGLLACGTELQGIDAAVYIYDIRRWDAPLRSIID 145
           D+ T A   ++    +    SL  +  G L C     G+D+   ++D+R     +   + 
Sbjct: 294 DVET-AQELQLQEGHSKEVYSLSFQPDGALICSG---GLDSLAMVWDLRSGKNIV--TLQ 347

Query: 146 SHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
            H   V C+ +  S+ + L +G  DG  N++DL++ E+
Sbjct: 348 GHAKPVYCVDW-SSNSHQLATGGGDGVVNVWDLRKLEQ 384

>KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.247
           YKR036C
          Length = 674

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 81/194 (41%), Gaps = 35/194 (18%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL----------KVIDS 67
           C+++  +Y   L TG  +  +++  WN  Q++Q       ++ D           +V   
Sbjct: 422 CMEMDNNYNM-LATGSRDATLKI--WNVSQAVQSYGIDPDTVADSCIFSFQEHSDEVTAL 478

Query: 68  DFAAGHLVSSASIDAVKVFDIRTNACVAKIH------------NEANSPFI-SLDSRHGL 114
                HL+S +    V+ +D+ T  CV  +                + P + +L S    
Sbjct: 479 SINFNHLLSGSQDRTVRQWDMNTGKCVQTLDVSFVNALSHSLVTTLDPPVVGALKSYDVA 538

Query: 115 LACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174
           LA GT+    D  V ++D+R     +   +  H   ++C+KF   D++ L++GS D    
Sbjct: 539 LATGTK----DGMVRLWDLRT--GEIVRTLKGHTGAISCLKF---DLHNLITGSLDNSVR 589

Query: 175 IYDLKQDEEEDALH 188
           ++DL+     DA  
Sbjct: 590 VWDLRSGSTLDAFR 603

>KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1541

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 17/194 (8%)

Query: 38   IRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKVF-DIRTNAC 93
            I L DW+  + L +   S    T I DLK I+ D  +  L++ +S   +K+F DI +N+ 
Sbjct: 1215 ITLFDWDENKMLSRFSNSNPFGTKITDLKFINED-DSTLLMTGSSDGIIKIFKDINSNSS 1273

Query: 94   VAKIHNEANSPFISLDSR-HGLLACGTELQG-IDAAVYIYDIRRWDAPLRSI-IDSHHDD 150
            V  I        + L  R +GLL    +++G + A   +  IR WDA   ++ +D     
Sbjct: 1274 VELIAAWRGLTEMLLTPRSNGLLTEWHQMRGALLATGDVKIIRIWDAHTETVEVDIPAKT 1333

Query: 151  VTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRI 207
             + +    SD    N+ ++G  DG   +YD + D  +  + +  + ++  +  W++    
Sbjct: 1334 SSLVTSLTSDQLAGNIFVAGFADGTLRVYDRRIDARDSMVRRWRSASTGRANCWINN--- 1390

Query: 208  YTLSHMETFAIHEL 221
                HM+     EL
Sbjct: 1391 ---VHMQRGGYREL 1401

>KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.231
           YIL046W
          Length = 654

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 77/165 (46%), Gaps = 19/165 (11%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L ++ ++++ L TG  +G + + D  +G+ ++++   +  +  L      F  G  + + 
Sbjct: 282 LSMKFNFRF-LFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTL------FFDGQKLITG 334

Query: 79  SID-AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIR-RW 136
           S+D  ++V++  T  C++      NS  +S+DS   ++  G+     D  V ++ +  R 
Sbjct: 335 SLDKTIRVWNYMTGECISTYRGHTNS-VMSVDSFKKIIVSGSA----DKTVKVWHVESRT 389

Query: 137 DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
              LR     H + V C+K HP       S S D    ++D++ +
Sbjct: 390 CYTLRG----HSEWVNCVKLHPKSF-CCFSCSDDTTIRMWDIRTN 429

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 25/204 (12%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60
           +S+    + N++G     L   P+ +  L++G  +  I L D  + +  Q I+   TS +
Sbjct: 144 LSTLKYHKDNAYG-----LAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHS 198

Query: 61  DLKVIDSD---FAAGHLVSSASIDAVKVFDIRTNA-CVAKIHNEA--NSPFISLDSRHGL 114
           D+ V D     F      S +    +++FD R       KI ++   NS   S  S +  
Sbjct: 199 DI-VNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLF 257

Query: 115 LACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174
            A GT        +Y+YDIR     L S+   H + VT ++F      +L+SGS+D    
Sbjct: 258 AAAGTT-----NNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVI 311

Query: 175 IYDL-------KQDEEEDALHQVI 191
           ++DL       + DE +D L +V+
Sbjct: 312 MWDLFEIGAEQQPDEADDGLPEVM 335

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 125 DAAVYIYDIRR-WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           +  ++IYD  R   + L S +  H D+   + F+P+    L+SGS D    ++D   D+ 
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKL 186

Query: 184 EDALHQVINYAS--IHSCGW 201
           +  + +     S  ++ C W
Sbjct: 187 KQPIQEWTTSHSDIVNDCQW 206

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 77/166 (46%), Gaps = 13/166 (7%)

Query: 29  LLTGLSNGEIRLLD---WNSGQSLQKIKASETSINDLKVIDSDFAAGH---LVSSASIDA 82
           L T  SNG++++ D   ++  +   +I   E+ ++   V D  +   H   L S    + 
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGESNV 260

Query: 83  VKVFDIRTNACVAKIHNEANSPFIS---LDSRHGLLACGTELQGIDAAVYIYDIRRWDAP 139
           + + DIR +  +  +H   ++  I+    + ++ ++ C  + QG    + I+DIR +  P
Sbjct: 261 IGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDFKEP 317

Query: 140 LRSIIDSHHDDVTCIKFHPSDVNVLLSG-STDGYTNIYDLKQDEEE 184
           ++       D ++ I+++P    +L +     G   I+D   ++E+
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDASGEQED 363

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 94/227 (41%), Gaps = 29/227 (12%)

Query: 115 LACGTELQGI------DAAVYIYDIRRWDA-------PLR-SIIDSHH-DDVTCIKFHPS 159
           LA   +L+G       +  V ++D+ ++D        P R S++D++  +DV+ +  H S
Sbjct: 191 LAWNYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTS 250

Query: 160 DVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSC--GWLSQKRIYTLSHMETFA 217
              +L S        + D++QD + D LH+  +   I++    + +   + T        
Sbjct: 251 ---ILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLK 307

Query: 218 IHELNDKSDEFKEPRPADFGDIRE-AWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDE 276
           I ++ D  +  KE    D   I    WN        P ++AT   Q G  ++       E
Sbjct: 308 IWDIRDFKEPIKEWEHGDQDPISAIQWNPQ-----IPQILATADQQSGLVKIWDASGEQE 362

Query: 277 KVDAENEIVIPRAHGDEVVRDVFISALQSDLLYSC--GEDGFVKIWK 321
             +AEN +++   HG  ++    IS  Q D    C    D  + IWK
Sbjct: 363 DSNAENNMLL-FVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWK 408

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 24/135 (17%)

Query: 45  SGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSP 104
           S QS+      E S+  LK++D+  + G+L+ + SI  V V          K H+  N+ 
Sbjct: 198 SQQSMATGPGEEHSL--LKIVDNSQSPGNLIRTISIPGVSVTQ------SIKFHD--NNM 247

Query: 105 FISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVL 164
           F +                 D  +  YDIR    PL ++ + H   +TC    P+   + 
Sbjct: 248 FSTCSD--------------DNGIRFYDIRGDGKPLWTVFEPHDGKLTCYDVSPTLETLF 293

Query: 165 LSGSTDGYTNIYDLK 179
           ++GS  G   ++DL+
Sbjct: 294 ITGSDTGVLKLWDLR 308

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 123 GIDAAVYIYDIRR---WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   +V IYDI +    + PL +I+  H   +  + F+ +  ++L+SGS DG   ++DL+
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDLR 244

Query: 180 QDE 182
             +
Sbjct: 245 SSQ 247

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 123 GIDAAVYIYDIRRW---DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   +V IYDI R    D P   ++  H   +  + F+ +  ++L+SGS DG   ++DL+
Sbjct: 185 GTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDLR 244

Query: 180 QDE 182
             +
Sbjct: 245 SSQ 247

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +G+I L   ++ + +   K   T+ N+  V D  ++   
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITD-KQPFTAANNQSVEDIQWSPTE 338

Query: 74  ---LVSSASIDAVKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGIDA 126
                +S +   V+++D R+      I   A++     IS + + G LLA G +    + 
Sbjct: 339 STVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD----NG 394

Query: 127 AVYIYDIRRWDAPLRS-------IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           +  ++D+R++ +P  S         D H   +T I F+P D +V+   S D    ++DL 
Sbjct: 395 SWGVWDLRQF-SPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

Query: 180 QDEEEDALHQ 189
            + ++D + Q
Sbjct: 454 VEADDDEIQQ 463

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 93  CVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRR----WDAPLRSIIDSHH 148
            +  I N  N     LD    L+  G  L G D +  I+  +R    W    +    +++
Sbjct: 269 AIHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGQIFLTQRHTSKWITDKQPFTAANN 326

Query: 149 DDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIY 208
             V  I++ P++  V  +  TDGY  I+D +  + + A+    +   ++   W ++K  Y
Sbjct: 327 QSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW-NEKLGY 385

Query: 209 TLS 211
            L+
Sbjct: 386 LLA 388

>KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {ON}
           Anc_1.247 YKR036C
          Length = 700

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 20/157 (12%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           Y   L TG  +G +RL D  SG+ ++ +     +I  LK     F   ++++ +    V+
Sbjct: 561 YDVALATGTRDGIVRLWDLRSGEVIRSLDGHTDAITSLK-----FDKYNIITGSIDKTVR 615

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIR---RWDAPLR 141
           ++D+RT   V  +  E+    +  D    ++A G        AV IYD R   +W     
Sbjct: 616 IWDLRTGLSVDTLVFESPVSGLDFDVEKVVIANGGN------AVKIYDRRERKQWTYETS 669

Query: 142 SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           S   S    V  +K+  S    ++ G  DG  NI+ +
Sbjct: 670 SETVSQ---VNTVKYKDS---YMIDGRNDGSVNIWAM 700

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 82/206 (39%), Gaps = 43/206 (20%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSL-------QKIKAS------ETSINDLKV 64
           CL++   +   +++G  +  +RL D N    L       +KIK S      E  I+++  
Sbjct: 430 CLQMDARFNM-VISGSKDNTLRLWDLNLALDLFHCEDAEEKIKQSPCVFVFEAHIDEVTA 488

Query: 65  IDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI---------HNEANSPFISLDSRHGLL 115
           +     + HLVS +    ++ +D+    C              N A S   S D +  +L
Sbjct: 489 LS--INSSHLVSGSQDRTIRNWDLHQGRCTQTFDLNFPSLLKSNVAPSSRRSRD-KQNML 545

Query: 116 ACGTELQGIDAAVYIYDI-----------RRWDAPLRSII---DSHHDDVTCIKFHPSDV 161
           +       +  A+ IYD+           R WD     +I   D H D +T +KF   ++
Sbjct: 546 SFPNYSPPVVGALQIYDVALATGTRDGIVRLWDLRSGEVIRSLDGHTDAITSLKFDKYNI 605

Query: 162 NVLLSGSTDGYTNIYDLKQDEEEDAL 187
              ++GS D    I+DL+     D L
Sbjct: 606 ---ITGSIDKTVRIWDLRTGLSVDTL 628

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 19/130 (14%)

Query: 61  DLKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGT 119
           D+  +D D   G + S+ S+D +VKV+D+     +A +H    S       ++  L  G 
Sbjct: 399 DITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITG- 457

Query: 120 ELQGIDAAVYIYDIRRWDAPLRS-----------IIDSHHDDVTCIKFHPSDVNVLLSGS 168
              G DA + ++DI +  A   S             DSH D++T I F   D + L+SGS
Sbjct: 458 ---GRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISF---DGDNLVSGS 511

Query: 169 TDGYTNIYDL 178
            D     +DL
Sbjct: 512 QDRTVRQWDL 521

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           +   L TG  +G +RL D  SG+ ++ ++    +I  L+     F + +LV+ A   +++
Sbjct: 566 FDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQ-----FDSVNLVTGAMDRSIR 620

Query: 85  VFDIRT 90
           ++D+RT
Sbjct: 621 IWDLRT 626

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 61/138 (44%), Gaps = 12/138 (8%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI----HNEANSPFISLDSRHGLLA 116
           D+K  D     G +VS +  + +K++D R+  C++ I    H    + F    ++  LLA
Sbjct: 209 DVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKF--QPTKGNLLA 266

Query: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
              +    D +  I+DIR+    L+S  D    D   + +HP + ++   G  DG    +
Sbjct: 267 VVAK----DKSCKIFDIRQNMKELKSFRDE--SDYMSLTWHPINESIFTVGCYDGSLKHF 320

Query: 177 DLKQDEEEDALHQVINYA 194
           DL QD         I YA
Sbjct: 321 DLLQDTGSSNSFHDIPYA 338

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 123 GIDAAVYIYDIRRW---DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   +V +YDI +    D PL + +  H   +  + F+ S  N+L+SG  DG   ++DL+
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLR 260

Query: 180 QDEE 183
             + 
Sbjct: 261 SSQR 264

>Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W
           (REAL)
          Length = 548

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 86/196 (43%), Gaps = 22/196 (11%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
           ++TG+ NGE+RL  WN   +LQ +     S   +  I  +    H +S    +   +++I
Sbjct: 235 IVTGVENGELRL--WNKAGALQNVLNFHRS--PIVSIKWNKDGTHFISMDVENVTILWNI 290

Query: 89  RTNACVAKI---HNEANSPFISLDSRHGLLACGTELQGID----------AAVYIYDIRR 135
            +   +       N  +S      +  G  + G +++ +D           A+++Y I  
Sbjct: 291 LSGTVMQHFELKENRGSSTTAESSNNSGEDSLGVDVEWVDDDKFVIPGPKGAIFVYQITE 350

Query: 136 WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYAS 195
             AP+  +I  HH  ++ ++F+ ++  +LLS S DG   I+       ++  +   +  S
Sbjct: 351 -KAPIGKLI-GHHGSISVLEFNNTN-KLLLSASDDGTLRIWHGGNGNSQNCFYG--HSQS 405

Query: 196 IHSCGWLSQKRIYTLS 211
           I S  W+   ++ + S
Sbjct: 406 IVSASWVGDDKVISCS 421

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 74/167 (44%), Gaps = 19/167 (11%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAG-HLVSSAS 79
             P  KY L TG  +  IR+ D +S + L  ++  E  I  L      F AG  LVS + 
Sbjct: 377 FSPDGKY-LATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDY----FPAGDKLVSGSG 431

Query: 80  IDAVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------ 132
              V+++D+RT  C   +  E     +++    G  +A G+    +D  V ++D      
Sbjct: 432 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRTVRVWDSETGFL 487

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           + R D+    +   H D V  + F   D   ++SGS D    ++DL+
Sbjct: 488 VERLDSE-NELSTGHKDSVYSVVF-TRDGRSVVSGSLDRSVKLWDLR 532

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 67/136 (49%), Gaps = 10/136 (7%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFIS--LDSRHGLLACG 118
           D+K  D     G +VS++  + +K++D R+  CV+ + N  ++   +    ++  LLA  
Sbjct: 214 DVKSCDWHPEMGLIVSASKDNLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAI 273

Query: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           ++    D +  ++DIR     L  I D    D   + +HP++ ++    S DG    +D+
Sbjct: 274 SK----DKSCRVFDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDI 327

Query: 179 KQDEEEDALHQVINYA 194
            Q+ EE    QVI YA
Sbjct: 328 LQNLEEP--QQVIPYA 341

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 74/155 (47%), Gaps = 11/155 (7%)

Query: 28  GLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDF-AAGHLVSSASIDAV-KV 85
            L+TG +NGEIR+  WN     +    + T  ++ +V    F  +G  V+SAS D   ++
Sbjct: 239 ALVTGAANGEIRI--WNLNNDSESPAGTLTG-HENRVARVRFHPSGKYVASASFDMTWRL 295

Query: 86  FDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIID 145
           +D+     +      A   +     + G L C T   G+D+   ++D+R   + +   ++
Sbjct: 296 WDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCST---GLDSVGLVWDLRSGKSIM--ALE 350

Query: 146 SHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            H   +  + + P+  ++  +GS DG   ++D+++
Sbjct: 351 GHIKPIYGLDWSPNGYDI-ATGSADGTIRLWDVRK 384

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 72  GHLVSSASIDAVK-VFDIRTNACVAKIHNEANSPFISLD-SRHGL-LACGTELQGIDAAV 128
           G L+ S  +D+V  V+D+R+   +  +      P   LD S +G  +A G+     D  +
Sbjct: 323 GSLLCSTGLDSVGLVWDLRSGKSIMALEGHIK-PIYGLDWSPNGYDIATGSA----DGTI 377

Query: 129 YIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
            ++D+R+    +   + +H+  V+ +KF  ++ + L+S S D   NIY
Sbjct: 378 RLWDVRK--VGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} similar
           to uniprot|Q03177 Saccharomyces cerevisiae YMR102C
           Protein of unknown function transcription is activated
           by paralogous transcription factors Yrm1p and Yrr1p
           along with genes involved in multidrug resistance
          Length = 880

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 96  KIHNEANSPFISLD-SRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
           +I+ E  S  + LD S++G L   +    +D AV ++ + R +  L++ +  H D VTCI
Sbjct: 283 RIYREHGSSVLDLDWSQNGFLVSAS----MDKAVKLWHVER-EQSLKTFL--HPDFVTCI 335

Query: 155 KFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           KF+P D    +SG  D    ++ +  DE
Sbjct: 336 KFYPLDDRFFVSGCLDHKCRMWSILDDE 363

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 87/187 (46%), Gaps = 16/187 (8%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSIN-DLKVIDSDFAAG 72
           E + L   P  + G LLTG  +G++     ++ + +   +    S N  ++ I       
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 73  HLVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGIDAA 127
            + ++A  D  ++V+D R+      I  +A++     IS + + G LLA G +    +  
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDD----NGT 395

Query: 128 VYIYDIRRW-----DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
             ++D+R++     +A   +  D H   +T I FHP+D +++   S D    ++DL  + 
Sbjct: 396 WGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEA 455

Query: 183 EEDALHQ 189
           +++ + Q
Sbjct: 456 DDEEIKQ 462

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 73/164 (44%), Gaps = 19/164 (11%)

Query: 23  PSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH-LVSSASID 81
           P  K+ L TG  +  IR+ D   G+ +  +K  E  +  L      F  G  LVS +   
Sbjct: 505 PDGKF-LATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDY----FPDGQKLVSGSGDR 559

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------IR 134
            V+++D+RT  C   +  E     +++    G  +A G+    +D AV ++D      + 
Sbjct: 560 TVRIWDLRTGQCSLTLSIEDGVTTVAVSPHDGRFIAAGS----LDRAVRVWDSTTGFLVE 615

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           R D+    +   H D V  + F   D N ++SGS D    +++L
Sbjct: 616 RLDSE-NELGTGHQDSVYSVVFT-RDGNEVVSGSLDKSVKLWNL 657

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 114 LLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLS-GSTDGY 172
           LL C  +  G    + ++DIR + +P+RS+   HH  V+ ++++P    +L + G  DG 
Sbjct: 304 LLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGL 358

Query: 173 TNIYDLKQDEEED 185
             I+DL Q  +++
Sbjct: 359 VKIWDLSQPVDQE 371

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 73  HLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYD 132
           +L  ++    +K+FD+R    V  +   + S  +  DS   LLA G    G D ++ + D
Sbjct: 74  YLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIG----GTDGSITVVD 129

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHP---SDVNVLLSGSTDGYTNIYDL 178
           +   +  +   +  H   ++ +KF+     +V +L SG T+G   I+DL
Sbjct: 130 VE--NGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDL 176

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 123 GIDAAVYIYDIRRW---DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   +V IYDI R    D+PL + +  H   +  + F+    ++L+SG  DG   ++DL+
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDLR 262

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 77/184 (41%), Gaps = 24/184 (13%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-----NDLKVIDSDFAAG 72
            L+  P  +  L +  +NGEI + D N   S      S   I     +++K +  + +  
Sbjct: 118 TLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLA 177

Query: 73  HLVSSA--SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLL------------ACG 118
           H+ +SA  +     ++D++    V  IH    SP   L     ++            A G
Sbjct: 178 HVFASAGDTTTYASIWDLKAKKEV--IHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASG 235

Query: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           ++    D  + I+D+R  + P+ ++   H   +  + +   D ++LLS   DG   ++D 
Sbjct: 236 SD---SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDT 292

Query: 179 KQDE 182
           K +E
Sbjct: 293 KANE 296

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 123 GIDAAVYIYDIRRWD---APLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   ++ IYDI R     +PL +    H   +  + F+    N+++SG  DGY  ++DL+
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDLR 272

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
           VY++D+R+  +PL S+++ H   V  I F+P +   ++S   DG    +D  + E+E
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 73/165 (44%), Gaps = 19/165 (11%)

Query: 23  PSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAG-HLVSSASID 81
           P  KY L TG  +  IR+ D  + + L  ++  E  I  L      F AG  LVS +   
Sbjct: 362 PDGKY-LATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDY----FPAGDKLVSGSGDR 416

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------IR 134
            V+++D+RT  C   +  E     +++    G  +A G+    +D  V ++D      + 
Sbjct: 417 TVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRTVRVWDSETGFLVE 472

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           R D+    +   H D V  + F   D   ++SGS D    ++DL+
Sbjct: 473 RLDSE-NELSTGHKDSVYSVVFT-RDGQGVISGSLDRSVKLWDLR 515

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 13/98 (13%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G D  +YI+D +R    ++S   S   DV+ +KF   + N + +GS DG TN+YDL+ D 
Sbjct: 281 GSDGYLYIWD-KRVPTSVQSFFVSD-SDVSKVKFF-RNGNTIATGSDDGCTNLYDLRSD- 336

Query: 183 EEDALHQVINYA---SIHSCGWLSQKRIYTLSHMETFA 217
                 ++ NY+   SIH    + Q++ Y +S+M+  A
Sbjct: 337 -----CRIANYSLSRSIHGATPV-QQQTYIMSNMDYTA 368

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI----HNEANSPFISLDSRHGLLA 116
           D+K  D     G +VS++  + VK++D R+  C++ I    H    + F    +R  LLA
Sbjct: 218 DIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRF--QPTRGNLLA 275

Query: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
             ++    D +  ++DIR     L  + D    D   + ++P + ++   G+ DG    +
Sbjct: 276 AISK----DKSCRVFDIRHSMKELMCVRDE--VDYMTLTWNPINESMFTVGNYDGAMKYF 329

Query: 177 DLKQDEEEDALHQVINYA 194
           DL QD E  +   VI YA
Sbjct: 330 DLLQDLEGPS--HVIPYA 345

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 82/168 (48%), Gaps = 20/168 (11%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETS--INDLKVIDSDFAAGHLVSSASIDA-VKV 85
           L++   +G I + D  SG+++     S  S  +N+ K  +SD    ++  S S D+ + +
Sbjct: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESD---PNIYGSVSEDSFLMI 231

Query: 86  FDIRTNACVAKIHNEANSPFISLD-SRH--GLLACGTELQGIDAAVYIYDIRRWDAPLRS 142
            D R+   + K+  +   PF ++  S+H   L A      G DA VY++D R+    L S
Sbjct: 232 HDKRSEKPLQKLLQK--EPFNTIAFSKHSSNLFAAA----GTDAMVYLFDSRKPTEALHS 285

Query: 143 IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ----DEEEDA 186
            +  H + VT ++F      +L SG +D    ++DL Q     +EEDA
Sbjct: 286 -MSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDA 332

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLL 165
            S+ S   L++C       D ++ I+DI+       S+   H D V   K+H SD N+  
Sbjct: 167 FSVASPGELISCSD-----DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221

Query: 166 SGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
           S S D +  I+D + ++    L Q   + +I
Sbjct: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEPFNTI 252

>Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364C
           (CDC40) - Member of the beta transducin family [contig
           130] FULL
          Length = 503

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 71/166 (42%), Gaps = 8/166 (4%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
           C + +PS     + GLSN EIR  D  +      ++  +  ++ +  +         VSS
Sbjct: 300 CAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSS 359

Query: 78  ASIDAVKVFDIRTNACVAKIHN--EANSPFISLDSRHGLLACGTELQGIDAAVYIYDIR- 134
           +   ++++++ + N  + +I +  + + P+I +       A     Q +D A+Y + ++ 
Sbjct: 360 SEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHPEQNYFAA----QSMDNAIYAFSMKP 415

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPS-DVNVLLSGSTDGYTNIYDLK 179
           ++    +     H      I F  S D   + SG T G   I+D K
Sbjct: 416 KYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWDWK 461

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 17/169 (10%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASI 80
             P  K+ L TG  +  IR+ D    Q +  ++  E  I  L    S      LVS +  
Sbjct: 383 FSPDGKF-LATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPS---GDKLVSGSGD 438

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------I 133
             V+++D+RT  C   +  E     +++    G  +A G+    +D AV ++D      +
Sbjct: 439 RTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGS----LDRAVRVWDSETGFLV 494

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
            R D+    +   H D V  + F   D N ++SGS D    +++L+ D+
Sbjct: 495 ERLDSE-NELGTGHKDSVYSVVFT-RDGNGVVSGSLDRSVKLWNLRGDK 541

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 11/107 (10%)

Query: 75  VSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIR 134
           VS A +  +K+F ++T   V  +   + S  +  DS   LLA G    G D ++ + DI 
Sbjct: 79  VSQAQL--LKIFQLKTGKVVRSMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDIE 132

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHP---SDVNVLLSGSTDGYTNIYDL 178
             +  +   +  H   ++ +KF+    S V +L SG T+G   ++DL
Sbjct: 133 --NGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDL 177

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 62/303 (20%), Positives = 120/303 (39%), Gaps = 52/303 (17%)

Query: 9   SNSFGSENWCLKLQPSYKYGLLTGLSNGEI-RLLDWNSGQSLQKIKASETSINDLKVIDS 67
           SN    E   L+L P  +Y  LT +S  ++ ++    +G+ ++ +K S  S     ++D+
Sbjct: 57  SNEDEQEITALQLTPDGQY--LTYVSQAQLLKIFQLKTGKVVRSMKISSPSY----ILDT 110

Query: 68  DFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSP-----FISLDSRHGLLACGTELQ 122
           D  +  L    +  ++ V DI        +     +      +  LDS+  LLA G +  
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASG-DTN 169

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKF----------HPSDVNVLLSGSTDGY 172
           G+        ++ WD   R  + +  +  + ++            PS +  L+SG  D  
Sbjct: 170 GM--------VKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLK-LISGGRDDI 220

Query: 173 TNIYDLKQDEEEDALHQVINYASIHSCGWLSQKR----IYTLSHMETFAIHELNDKSDEF 228
            N +D    ++   +  +     + SCG+L+ +     IYT      F + +L   S   
Sbjct: 221 VNFWDFDMKKKCKLIKTLPVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLK 280

Query: 229 KEPRPADFGDIREAWNCDYVVDVYP-------GLIATGKTQEGAGELRLLPFRDEKVDAE 281
           +  +P     I E     Y++ V P        L+ + +T +       L  ++E + AE
Sbjct: 281 RTNKP-----IEEL----YIIGVLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAE 331

Query: 282 NEI 284
           + I
Sbjct: 332 SSI 334

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 13/132 (9%)

Query: 61  DLKVIDSDF--AAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC 117
           D +V D  F   +  L +S   D +V+VFD+R+ A    I+    S      S+  LL  
Sbjct: 276 DSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRL 335

Query: 118 -----GTELQGIDAA----VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGS 168
                   +    AA    + I D+R  ++PL  I++ H   V  IK+HP   NVLLSG 
Sbjct: 336 EPSPHDPNVMATFAADSNKILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGG 394

Query: 169 TDGYTNIYDLKQ 180
            D     +DL +
Sbjct: 395 DDCQVLYWDLNK 406

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 61/140 (43%), Gaps = 30/140 (21%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACVAKI---------------HNEANSPFI------S 107
           F +GHLVS +    ++ +D+ T  CV  I                +   SP +      +
Sbjct: 523 FDSGHLVSGSQDRTLRQWDLSTGKCVQTIDISFASRGQSTSSLASSSLLSPVVEAPVVGA 582

Query: 108 LDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSG 167
           L      LA GT+    D  V ++D+R     +RS ++ H D +T +KF   D   L++G
Sbjct: 583 LQCFDAALATGTK----DGIVRLWDMRSGKT-IRS-LEGHTDAITTLKF---DSRNLVTG 633

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 634 SLDRSIRIWDLRTGTLADAF 653

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           +   L TG  +G +RL D  SG++++ ++    +I  LK     F + +LV+ +   +++
Sbjct: 586 FDAALATGTKDGIVRLWDMRSGKTIRSLEGHTDAITTLK-----FDSRNLVTGSLDRSIR 640

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRS-- 142
           ++D+RT         E  SP + LD          +LQ I AAV    ++ +D       
Sbjct: 641 IWDLRTGTLADAFAYE--SPVLELD---------FDLQDIVAAVGENGVKVFDRENDKHW 689

Query: 143 -IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
               S  +D +  +F       L+ G ++G  N +
Sbjct: 690 VCAQSEEEDASISQFVKYKNGYLIEGRSNGDVNAW 724

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 70  AAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVY 129
           +  HL    S   V++FD+    C+  +   ++     L     +L  G+     D  + 
Sbjct: 314 SGSHLAVGQSNGIVEIFDVNKKKCIRTMLGHSDR-VACLSWNSYILTSGSR----DHNIL 368

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
             D+R  D P    I+SH  +V  +K++  D N L+SG  D   N+YD  +   +  +  
Sbjct: 369 HRDVRSPD-PFFEKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYD--RTSTKPFMTM 424

Query: 190 VINYASIHSCGWLSQKR 206
             + A++ +  W S KR
Sbjct: 425 TEHKAAVKALDWSSHKR 441

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 17/188 (9%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSIN-DLKVIDSDFAAG 72
           E + L   PS + G LLTG  +G+I     ++ + +   +    S N  ++ I      G
Sbjct: 276 EGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEG 335

Query: 73  HLVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHGLLACGTELQGIDAAV 128
            + +SA  D  ++++D R+      I  +A++     IS   + G L       G D  V
Sbjct: 336 TVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLAS----GDDNGV 391

Query: 129 Y-IYDIRRWDAPLRSII------DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           + ++D+R++     + +      D H   +T I F+P D +++   S D    ++DL  +
Sbjct: 392 WGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVE 451

Query: 182 EEEDALHQ 189
            +++ + Q
Sbjct: 452 ADDEEIKQ 459

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 5/115 (4%)

Query: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDI 133
           L S+ S +++ ++D+RTN+   KI     S  I  +    + A    +   D   Y YD+
Sbjct: 229 LASTGSDNSIVLYDLRTNSPTQKIVQSMRSNAICWNP---MEAFNFVIANEDHNAYYYDM 285

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
           R     L ++   H   V  + F P+    L++GS D    IYD+      +  H
Sbjct: 286 RNMSRAL-NVFKDHVSAVMDVDFSPTGTE-LVTGSYDKTIRIYDIGHGHSREIYH 338

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 30/160 (18%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G +VS +  + VK +D R+  CV+ I          L+ +H +L     
Sbjct: 211 DVKSCDWHPEMGLIVSGSKDNLVKFWDPRSGQCVSTI----------LNFKHTVLRTRFQ 260

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L GI  D +  ++DIR     L ++ D    D   + +HP + +V    + DG 
Sbjct: 261 PTRGNYLLGISKDKSCRVFDIRNHTKELLTVRD--EVDFMTLSWHPINESVFTLANYDGS 318

Query: 173 TNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSH 212
              +D+ +D E+           IH+  +  +K I  +S+
Sbjct: 319 IKHFDILEDLEK----------PIHTIPFAHEKCITAMSY 348

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 68/163 (41%), Gaps = 9/163 (5%)

Query: 26  KYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKV 85
           K   +TG    +I L D N  + +  +     +IN ++   ++     L S+ S ++V +
Sbjct: 184 KSNFVTG--GAQIELWDTNRSKPISNLSWGADNINHVRFNQNEVDI--LASTGSDNSVVL 239

Query: 86  FDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIID 145
           +D+RTN+   KI     +  I  +    + A    +   D   Y YD+R     L  +  
Sbjct: 240 YDLRTNSPTQKIVQTMRTNSICWNP---VEAFNFVIANEDHNAYYYDMRNMSKALH-VFK 295

Query: 146 SHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
            H   V  + F P+   V ++GS D    IY +K     +  H
Sbjct: 296 DHVSAVMDVDFSPTGDEV-VTGSYDKTIRIYQVKHGHSREIYH 337

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 50/135 (37%), Gaps = 24/135 (17%)

Query: 45  SGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSP 104
           S QS+      E S+  LK++D+  + G L+ S  I    V            H      
Sbjct: 130 SQQSMATGTGEEHSL--LKIVDNSQSPGRLIRSICIPGTTV-----------THT----- 171

Query: 105 FISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVL 164
            I     H    C       D  +  YD R    PL  + D H   +TC    P+   + 
Sbjct: 172 -IKFHDNHMFSTCSD-----DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLF 225

Query: 165 LSGSTDGYTNIYDLK 179
           ++GS  G   ++DL+
Sbjct: 226 VTGSDTGVLKLWDLR 240

>KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672)
           [2658 bp, 885 aa] {ON} Anc_6.239 YGL137W
          Length = 885

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASID-AVKVFD 87
           +LT L +G I + ++ +   ++ I+ +ET +   K I    A  + +   S D  ++VF+
Sbjct: 28  VLTTLYSGRIEIWNYETQHEVRSIQVTETPVRAGKFI----ARKNWIIVGSDDFRIRVFN 83

Query: 88  IRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRR-WDAPLRSI 143
             T   V     EA+  +I   + H     +  G++    D  + +++  + W+  L   
Sbjct: 84  YNTGEKVVDF--EAHPDYIRSIAVHPTKPYVLSGSD----DLTIKLWNWEKNWN--LEQT 135

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            + H   V C+ F+P D N   SG  D    ++ L Q
Sbjct: 136 FEGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSLGQ 172

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           G D   YI+D R   A  +  +     DVT IKF   D N +++GS DG  N++DL+ D
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVSD--SDVTSIKFF-KDGNSIITGSDDGIINMFDLRSD 306

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 11/157 (7%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDF-AAGHLVSSASIDAV-KVF 86
           +  G   G ++L  + S  +L+++       N  +V DS F  +G  ++SAS D   +++
Sbjct: 238 ITAGGEEGSVKLFGYKS-NTLEEMATLNGHEN--RVTDSKFHPSGRFIASASFDMTWRLW 294

Query: 87  DIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDS 146
           D+ T   +          +       G L C     GID    ++DIR     +   +  
Sbjct: 295 DVETQEELLLQEGHGKELYSLGFQCDGSLVCSG---GIDCKGLVWDIRSGKRAMS--LSG 349

Query: 147 HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           H   +  + + P+   V  +GS DG   I+DL++ EE
Sbjct: 350 HTKPIYSLDWSPNGYQVA-TGSGDGTIRIWDLRKPEE 385

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH--LVS 76
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  L     DF       VS
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVS 70

Query: 77  SASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +     +KV+ + TN C+  +    +        R        EL  I +A     IR W
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHR--------ELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 123 NWQNRKEIACLTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH--LVS 76
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  L     DF       VS
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVS 70

Query: 77  SASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +     +KV+ + TN C+  +    +        R        EL  I +A     IR W
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHR--------ELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 123 NWQNRKEIACLTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 63/128 (49%), Gaps = 12/128 (9%)

Query: 60  NDLKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIH-NEANSPFISLDSRHGLLAC 117
           +++  +D DF  G L ++  +D  +K++D+  +  + ++  ++A    + +D  + ++  
Sbjct: 366 DNITTLDFDFPNGTLSTAGHLDHTIKLWDLTKSTQIGELKGHKATVNSLQMDLTYNMVIS 425

Query: 118 G-----TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI-KFHPSDVNVLLSGSTDG 171
                  +L  +D  +  ++  R+  P     DSH D++T I  +H +    L+SGS D 
Sbjct: 426 AGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAISSYHEN----LVSGSRDK 481

Query: 172 YTNIYDLK 179
               +DLK
Sbjct: 482 TIRQWDLK 489

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH--LVS 76
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  L     DF       VS
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVS 70

Query: 77  SASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +     +KV+ + TN C+  +    +        R        EL  I +A     IR W
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHR--------ELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 123 NWQNRKEIACLTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 29/185 (15%)

Query: 40  LLDWNSGQSL-----QKIKASETSIND---LKVIDSDF-------AAGHLVSSASIDAVK 84
           L+DW+S   L     + I  S+ + ND   L   +SDF       +  HL    S   V+
Sbjct: 284 LIDWSSTDVLAVALGKSIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLAVGLSSGIVE 343

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSII 144
           ++D+  N C+  +    +     L   + +L+ G+     D  +   D+R  + P    I
Sbjct: 344 IYDVLKNKCIRTLSGHVDR-VACLSWNNHVLSSGSR----DRKILHRDVRAPE-PFFEQI 397

Query: 145 DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD--LKQD----EEEDALHQVINYASIHS 198
           D+H  +V  +K++ ++ N L SG  D    +YD  L+Q     EE  A  + + + S H+
Sbjct: 398 DTHSQEVCGLKWNVNE-NKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAW-SPHT 455

Query: 199 CGWLS 203
            G L+
Sbjct: 456 RGVLA 460

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 20/162 (12%)

Query: 36  GEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV-KVFDIRTNACV 94
           G++RLL          +   E  ++DLK       +G  + SAS D   +++D  T   +
Sbjct: 253 GDLRLLG--------SLVGHERRVSDLKY----HPSGKFIGSASHDMTWRLWDASTYQEL 300

Query: 95  AKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
                 A   F       G L C     G+D+   I+DIR  +  +   +  H   V  +
Sbjct: 301 LLQEGHAKGVFCLSFQCDGSLVCSG---GMDSLAMIWDIRSGNKVMS--LTGHSKPVYTV 355

Query: 155 KFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
            + P+   V  +G  DG  N++D++Q  +   +HQ++ + +I
Sbjct: 356 DWSPNGYQVA-TGGGDGLINVWDIRQ-RDGGQVHQILAHRNI 395

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH--LVS 76
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  L     DF       VS
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVS 70

Query: 77  SASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +     +KV+ + TN C+  +    +        R        EL  I +A     IR W
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHR--------ELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + +  H+  V C +FHP+D ++++S S D    I+D+
Sbjct: 123 NWQNRKEIACLTGHNHFVMCAQFHPTD-DLIVSASLDETIRIWDI 166

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 65/148 (43%), Gaps = 15/148 (10%)

Query: 37  EIRLLDWNSG--QSLQKI-KASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNAC 93
           EI ++D   G  + L KI    E  I  LK+        +L   +    +K+F ++T   
Sbjct: 39  EINIIDLTPGSRKILHKISNEDEQEITALKLTPD---GQYLTYVSQAQLLKIFHLKTGKV 95

Query: 94  VAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTC 153
           V  +   + S  +  DS   LLA G    G D ++ + DI   +  +      H   ++ 
Sbjct: 96  VRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIE--NGYITHSFKGHGGTISS 149

Query: 154 IKFHP---SDVNVLLSGSTDGYTNIYDL 178
           +KF+    S + +L SG T+G   ++DL
Sbjct: 150 LKFYGQLNSKIWLLASGDTNGMVKVWDL 177

>KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {ON}
           similar to uniprot|P48234 Saccharomyces cerevisiae
           YGR145W ENP2 Essential nucleolar protein of unknown
           function contains WD repeats interacts with Mpp10p and
           Bfr2p and has homology to Spb1p
          Length = 700

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 66/174 (37%), Gaps = 46/174 (26%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
           L  G S+ E+  L+   G+ L   K     +N + + + +   G L +S   + V+ +D 
Sbjct: 153 LYVGASSNELYRLNLEQGRFLNPFKLDTEGVNHVSINEVN---GLLAASMETNVVEFWDP 209

Query: 89  RTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHH 148
           R+ + VAK+H E N                                         +DS  
Sbjct: 210 RSRSRVAKLHLENN-----------------------------------------LDSAD 228

Query: 149 DDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWL 202
             VTC  F    +N    G+++GY+ IYDL+  E      Q   +A ++   WL
Sbjct: 229 FQVTCSSFKNDGLN-FACGTSNGYSYIYDLRTSEPSIVKDQGYGFA-VNKIIWL 280

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFIS---LDSRHGLLACGTELQGIDAAVYIYDIRRWD 137
           D++ +FD R    VAKI N+  S  I+    +  + LL   T+  G      ++D+R+  
Sbjct: 272 DSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKLS 328

Query: 138 APLRSIIDSHHDDVTCIKFHPSDVNVL-LSGSTDGYTNIYDLKQDEEEDAL 187
           A      D H   V+ ++++P D +VL  +G +DG   I+D   + E+  +
Sbjct: 329 AEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTI 378

>TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {ON}
           Anc_1.107 YNL253W
          Length = 507

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 67/160 (41%), Gaps = 12/160 (7%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQ---KIKASETSINDLKVIDSDFAAGHLVSSASIDAVKV 85
           ++ G S GEI LL  N+ + L+   K+ A    I  LKV         LVS     A  +
Sbjct: 247 IIVGTSIGEISLLRVNNNKELKNIIKVPAHRGKITGLKVTP---LGDKLVSVGEDGACLI 303

Query: 86  FDIRTNACVAKI-HNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSII 144
           +D+ +  C++ I   E+N     L     LL   +E    +     YD+   +  +    
Sbjct: 304 WDLESLTCISTIVECESNIRTFDLSPSGKLLVVVSE----EGKFRFYDMITTEK-INDYD 358

Query: 145 DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
             H D    +KF+P+   +++SG  D    +Y  K   +E
Sbjct: 359 QKHLDSDFIVKFYPNKSWLMISGENDTLCRLYSEKGHSDE 398

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 85/200 (42%), Gaps = 46/200 (23%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQ------KIKASETSI----------ND 61
           C+++  +    L+TG  +  +++ D N  + L       +    ET I          ND
Sbjct: 369 CMQMDKTNYNILITGSKDATLKMWDLNLSKELYLDHSPLRQNMEETIITPCIHNFELHND 428

Query: 62  LKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKI-------HNEANSPFISLDSRHGL 114
            ++    F +  L+S +    +  +D+ T  CV ++       HN+  +   S   ++G 
Sbjct: 429 -EITALSFDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTSTRS--GKNGT 485

Query: 115 LACGTELQGIDAAVYIYD-----------IRRWD----APLRSIIDSHHDDVTCIKFHPS 159
              GTE   I  A+  Y+           +R WD     P+RS+ + H D +T +KF   
Sbjct: 486 YLLGTEAPMI-GALQCYNSALATGTKDGVVRLWDLRIGKPVRSL-EGHTDGITSLKF--- 540

Query: 160 DVNVLLSGSTDGYTNIYDLK 179
           D   L++GS D    I+DL+
Sbjct: 541 DSEKLVTGSMDNSVRIWDLR 560

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 68/160 (42%), Gaps = 9/160 (5%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
            +TG    +I+L D N  + +  +     ++  +K   ++     L S+ S +++ ++D+
Sbjct: 188 FVTG--GAQIQLWDANRSKPISNLTWGADNVTSVKFNQTE--TDILASTGSDNSIVLYDL 243

Query: 89  RTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHH 148
           RTN+   KI     +  I  +    + A    +   D   Y YD+R     L ++   H 
Sbjct: 244 RTNSPTQKIRQSMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSRAL-NVFKDHV 299

Query: 149 DDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
             V  + F P+  + +++GS D    IY   Q    +  H
Sbjct: 300 SAVMDVDFSPTG-DEIVTGSYDKTIRIYKTNQGHSREVYH 338

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 133 IRRWDAPLRSIIDS---HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
           I+ WDA     I +     D+VT +KF+ ++ ++L S  +D    +YDL+ +     + Q
Sbjct: 195 IQLWDANRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQ 254

Query: 190 VINYASI 196
            +   +I
Sbjct: 255 SMRTNAI 261

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +L  L +  I+L D+  G  L + +  E  +   + +D        VS  
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPV---RSVDFHPTQPIFVSGG 72

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               +KV+ + TN C+  ++   +  +I     H       EL  I +A     IR W+ 
Sbjct: 73  DDYTIKVWSLETNKCLYTLNGHLD--YIRTVFFH------KELPWIISASDDQTIRIWNW 124

Query: 139 PLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
             R   + +  H+  V C +FHP+D ++++S S D    ++D+
Sbjct: 125 QNRKEIACLTGHNHFVMCAQFHPTD-DLVVSASLDETIRVWDI 166

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 82/188 (43%), Gaps = 23/188 (12%)

Query: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASET--- 57
           +SS    E N +G     L   P  K  LL+G  + +I L D  +  S + +   E+   
Sbjct: 146 LSSLGFHEDNGYG-----LSFNPVDKGKLLSGSDDSKIALWDITT-NSTKPVSTWESCHQ 199

Query: 58  -SINDLKVIDSDFAAGHLVSSASID-AVKVFDIRTNACVA---KIHNEANSPFISLDSRH 112
             +ND K  + +   G+   S S D  +++ D R    V    K     N+   S  S +
Sbjct: 200 DGVNDCKWHELN---GNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTN 256

Query: 113 GLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              A GT     D+ +Y+YD RR    L + +  H  +VT ++F+ +   +++S   D  
Sbjct: 257 LFAAAGT-----DSLIYLYDSRRTGNVLHT-MSGHESNVTNLEFYAAKDGIVMSSGEDRR 310

Query: 173 TNIYDLKQ 180
             ++DL +
Sbjct: 311 VIMWDLME 318

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 12/103 (11%)

Query: 126 AAVYIYDIRR-WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
             V++YD  +  D  L S +  H D+   + F+P D   LLSGS D    ++D+  +  +
Sbjct: 130 GTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK 189

Query: 185 -----DALHQVINYASIHSCGW--LSQKRIYTLSHMETFAIHE 220
                ++ HQ      ++ C W  L+     ++S   T  +H+
Sbjct: 190 PVSTWESCHQ----DGVNDCKWHELNGNTFGSVSEDCTLQLHD 228

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 29/133 (21%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACVAKI-------HNEANSPFISLDSRHGLLACGTEL 121
           F +  LVS +    +  +D+ T  C+ ++       H++   P  SL+  +G    GTE 
Sbjct: 432 FDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLN--NGACLLGTEA 489

Query: 122 QGIDAAVYIYD-----------IRRWD----APLRSIIDSHHDDVTCIKFHPSDVNVLLS 166
             I  A+  Y+           +R WD     P+R +++ H D +T +KF   D   L++
Sbjct: 490 PMI-GALQCYNSALATGTKDGIVRLWDLRVGKPVR-LLEGHTDGITSLKF---DSEKLVT 544

Query: 167 GSTDGYTNIYDLK 179
           GS D    I+DL+
Sbjct: 545 GSMDNSVRIWDLR 557

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 76/169 (44%), Gaps = 16/169 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +L  L +  I+L D+  G  L + +  +  +   + ID        VS+ 
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHDGPV---RGIDFHPTQPLFVSAG 72

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               +KV+ + TN C+  +  E +  ++     H       EL  I +A     IR W+ 
Sbjct: 73  DDYTIKVWSLETNKCLYTL--EGHLDYVRTVFFH------RELPWIISASDDQTIRIWNW 124

Query: 139 PLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
             R   + I  H+  V C +FHP++ ++++S S D    ++D+ +  E+
Sbjct: 125 QNRKEIACITGHNHFVMCAQFHPTE-DLIVSASLDETVRVWDISKLREK 172

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 18/159 (11%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH-LVSSASIDAVKVFD 87
           L TG  +  IR+ D    + +  +K  E  +  L      F  G  LVS +    V+++D
Sbjct: 402 LATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDY----FPNGEKLVSGSGDRTVRIWD 457

Query: 88  IRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------IRRWDAPL 140
           +RT  C   +  E     +++    G  +A G+    +D AV ++D      + R D+  
Sbjct: 458 LRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGS----LDRAVRVWDSTTGFLVERLDSE- 512

Query: 141 RSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
             +   H D V  + F   D N ++SGS D    +++++
Sbjct: 513 NELGTGHRDSVYSVVFT-RDGNEVVSGSLDKTVKLWNMR 550

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 16/169 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +L  L +  I+L D+  G  L + +  E  +   + ID        VS+ 
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRYEDHEGPV---RGIDFHPTQPLFVSAG 72

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               +KV+ + TN C+  +    +  ++     H       EL  I +A     IR W+ 
Sbjct: 73  DDYTIKVWSLETNKCLYTLDGHLD--YVRTVFFH------KELPWIISASDDQTIRIWNW 124

Query: 139 PLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
             R   + I  H+  V C +FHP++ ++++S S D    ++D+ +  E+
Sbjct: 125 QNRKEIACITGHNHFVMCAQFHPTE-DLIVSASLDETVRVWDISKLREK 172

>Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 51  KIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDS 110
           KIKA  +SI  +K+   D    + V+ +S     ++ +++  C  KI  + +S  ++LD 
Sbjct: 248 KIKAHTSSITGIKI---DPWGRYFVTGSSDGNCYIWSLKS-LCCEKIIQDLDSAVVALDV 303

Query: 111 RH--GLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGS 168
            H   +L   TE    D  VY YD+          + +H  D+  +KF+P     +LSG 
Sbjct: 304 CHLGKILGVCTE----DEMVYFYDLNEAKLLESKSLANHKSDLV-LKFYPDKSWYILSGK 358

Query: 169 TDGYTN 174
            D  +N
Sbjct: 359 NDTLSN 364

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 72/167 (43%), Gaps = 19/167 (11%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASI 80
             P  K+ L TG  +  IR+ D    + +  +   E  I  L      F +G  + S S 
Sbjct: 374 FSPDGKF-LATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDY----FPSGDKIVSGSG 428

Query: 81  D-AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYD------I 133
           D  V+++D+ T  C+  +  E     +++      +A G+    +D AV ++D      +
Sbjct: 429 DRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGS----LDRAVRVWDAETGFLV 484

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            R D+    +   H D V  + F     NV+ SGS D    +++LKQ
Sbjct: 485 ERLDS--NELGTGHEDSVYSVVFTKDGKNVV-SGSLDKTVKLWNLKQ 528

>NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa]
           {ON} Anc_1.247
          Length = 695

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 67/161 (41%), Gaps = 37/161 (22%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSIND--LKVIDSDFAAGHLVSSASIDAVKVF 86
           L++G  +  IR  D  SG+ LQ I  S  +I    ++V DS F      ++A I A++ F
Sbjct: 490 LISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLT-TTKATAIIGALQCF 548

Query: 87  DIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDS 146
           D                           LA GT     D  V ++D+R     +   ++ 
Sbjct: 549 D-------------------------AALATGTR----DGIVRLWDLRA--GKVVRALEG 577

Query: 147 HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDAL 187
           H   +TC+KF   D   +++GS D    I+DL+     D L
Sbjct: 578 HSGSITCLKF---DNKNIVTGSIDKTVRIWDLRSGILSDML 615

>CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa]
           {ON} similar to uniprot|P18851 Saccharomyces cerevisiae
           YOR212w STE4
          Length = 419

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 104 PFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNV 163
           P  +L   +   +CG+     D   +I+D+R   A  +  I S   D  C+KF P D N 
Sbjct: 224 PVTNLSKNNMFASCGS-----DGYTFIWDVRSPSAVQQFSIGSC--DSNCLKFFP-DGNS 275

Query: 164 LLSGSTDGYTNIYDLKQD 181
           +  G+ DG  +++DL+ D
Sbjct: 276 VAVGNDDGTISLFDLRAD 293

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 82/193 (42%), Gaps = 45/193 (23%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDW---------------NSGQSLQKIKASETSINDL 62
           C++  P Y   L+TG  +  I+L +                NS QS   I    + +++L
Sbjct: 451 CMQSSPHYSM-LITGSKDATIKLWNLKLASQLYLEENADIGNSNQSC--IHTFSSHLDEL 507

Query: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIH----NEANSPFIS----------- 107
             I  D    +LVS +    ++ +D+ +  CV  I        N+ F S           
Sbjct: 508 TAISYDTI--NLVSGSQDKTIRQWDLLSGKCVQTIDLSFIKSRNNDFYSNQLLGEKPLVG 565

Query: 108 -LDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLS 166
            +      LA GT+    D  V ++D+R    P+R++ + H D VT +KF  S +   ++
Sbjct: 566 AIQCFDAALATGTK----DGIVRLWDLRSG-VPVRTL-EGHTDAVTALKFDSSSI---VT 616

Query: 167 GSTDGYTNIYDLK 179
            S+D    I+DL+
Sbjct: 617 ASSDKQVRIWDLR 629

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 19/164 (11%)

Query: 23  PSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH-LVSSASID 81
           P  K+ L  G  +  IR+ D  + Q +  +K  E  I  L      F +G  LVS +   
Sbjct: 467 PDGKF-LAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDY----FPSGEKLVSGSGDK 521

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------IR 134
            V+++D+RT  C   +  E     +S    +G  +A G+    +D +  I+D      ++
Sbjct: 522 TVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGS----LDRSARIWDTETGFLLK 577

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           R D+    + + H D +  + F   D   L+SGS D    +++L
Sbjct: 578 RLDS-QTDLQNGHKDSIYSVSFT-KDGKKLVSGSLDRSVKLWNL 619

>Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AEL314W
          Length = 716

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           Y   L TG  +G +RL D  SG+ ++ +     +I  L     +F + HLV+ +   +++
Sbjct: 577 YDAALATGTKDGVVRLWDLRSGRVVRTLDGHSDAITSL-----EFDSLHLVTGSLDKSIR 631

Query: 85  VFDIRTNA 92
           ++D+RT A
Sbjct: 632 IWDLRTGA 639

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 56/139 (40%), Gaps = 29/139 (20%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACV-------------------AKIHNEANSPFI-SL 108
           F   HLVS +    ++ +D+    CV                   + I N    P I +L
Sbjct: 515 FDDDHLVSGSQDRTIRQWDLNNGKCVQTLDISFASGGNLSRSIYSSTILNPDEPPIIGAL 574

Query: 109 DSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGS 168
                 LA GT+    D  V ++D+R     +   +D H D +T ++F   D   L++GS
Sbjct: 575 QCYDAALATGTK----DGVVRLWDLR--SGRVVRTLDGHSDAITSLEF---DSLHLVTGS 625

Query: 169 TDGYTNIYDLKQDEEEDAL 187
            D    I+DL+     DA 
Sbjct: 626 LDKSIRIWDLRTGALADAF 644

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 39/174 (22%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETS---------------------INDLKVIDS 67
           L++G  +  IR  D N+G+ +Q +  S  S                     I  L+  D+
Sbjct: 520 LVSGSQDRTIRQWDLNNGKCVQTLDISFASGGNLSRSIYSSTILNPDEPPIIGALQCYDA 579

Query: 68  DFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANS-PFISLDSRHGLLACGTELQGIDA 126
             A G          V+++D+R+   V  +   +++   +  DS H  L  G+    +D 
Sbjct: 580 ALATG-----TKDGVVRLWDLRSGRVVRTLDGHSDAITSLEFDSLH--LVTGS----LDK 628

Query: 127 AVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           ++ I+D+R     L       H  VT ++F   D+N +++ + +G   IYD K+
Sbjct: 629 SIRIWDLRT--GALADAFAYDHS-VTSLQF---DLNKIVAANREGTVKIYDRKE 676

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 143 IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           I ++H D++TC+KF PS   VLLSGSTD    I+ L
Sbjct: 119 IREAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSL 153

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 24/143 (16%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G +VS++  + ++++D R+  C++ +          L+ +H +L     
Sbjct: 210 DVKSCDWHPEMGLIVSASKDNLIRLWDPRSGQCISSL----------LNFKHTVLKTRFQ 259

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHD-DVTCIKFHPSDVNVLLSGSTDG 171
              G  L  I  D +  ++DIR     +R ++    + D   +++HP++  +    S DG
Sbjct: 260 PTKGNLLTAISKDKSCRVFDIRH---SMRELMVYRDEVDYMTLEWHPTNETMFTVASYDG 316

Query: 172 YTNIYDLKQDEEEDALHQVINYA 194
               +D+ QD E+     V+ YA
Sbjct: 317 SLKHFDILQDLEKPT--HVVPYA 337

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 16/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +L  L +  I+L D+  G  L + +  E  +   + ID        VS+ 
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPV---RGIDFHPTQPIFVSAG 72

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
              ++KV+ + TN C+  ++   +        R        EL  I +A     IR W+ 
Sbjct: 73  DDYSIKVWSLETNKCLYTLNGHLDYVRTVFFHR--------ELPWIISASDDQTIRIWNW 124

Query: 139 PLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
             R   + +  H+  V C +FHP++ ++++S S D    ++D+
Sbjct: 125 QNRKELACLTGHNHFVMCAQFHPTE-DLVVSASLDETIRVWDI 166

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 19/186 (10%)

Query: 23  PSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAG-HLVSSASID 81
           P  K+ L TG  +  IR+ D    + +  ++  E  I  L      F +G  LVS +   
Sbjct: 472 PDGKF-LATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDY----FPSGDKLVSGSGDR 526

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------IR 134
            V+++D+R   C   +  E     +++    G  +A G+    +D AV ++D      + 
Sbjct: 527 TVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS----LDRAVRVWDSETGFLVE 582

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYA 194
           R D+    +   H D V  + F   D N ++SGS D    +++L+ D  +D    V    
Sbjct: 583 RLDSE-NELGTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTC 640

Query: 195 SIHSCG 200
            +   G
Sbjct: 641 EVTYTG 646

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 75/164 (45%), Gaps = 16/164 (9%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
            +   PS  + +L  L +  I+L D+  G  L + +  E  +   + +D        VS+
Sbjct: 16  AIAFHPSRPW-VLVALFSSTIQLWDYRMGVLLHRFEEHEGPV---RGVDFHPTQPLFVSA 71

Query: 78  ASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWD 137
               ++KV+ + T+ C+  ++   +  ++     H      TEL  I +A     IR W+
Sbjct: 72  GDDYSIKVWSLSTHKCLFTLNGHLD--YVRTVFFH------TELPWIISASDDQTIRIWN 123

Query: 138 APLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
              R   + +  H+  V C +FHP++ ++++S S D    I+D+
Sbjct: 124 WQNRREIACLTGHNHFVMCAQFHPTE-DLVVSASLDETVRIWDI 166

>YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON}
            KOG1Subunit of TORC1, a rapamycin-sensitive complex
            involved in growth control that contains Tor1p or Tor2p,
            Lst8p and Tco89p; contains four HEAT repeats and seven
            WD-40 repeats; may act as a scaffold protein to couple
            TOR and its effectors
          Length = 1557

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 15/173 (8%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKV 85
            L+T      I + DW  G++L K        T + DLK+I+ D +A  L++ +S   +K+
Sbjct: 1224 LITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDLKLINEDDSA-LLLTGSSDGVIKI 1282

Query: 86   F----DIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQG-IDAAVYIYDIRRWDAPL 140
            +    D+ T   V+      +   +      GLL    +++G +     +  IR WDA  
Sbjct: 1283 YRDYQDVDTFKIVSAWRGLTD--MLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAHT 1340

Query: 141  RSI-IDSHHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
             ++ +D      + I    +D    N+ ++G  DG   +YD + D  +  + +
Sbjct: 1341 ETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRR 1393

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 32/210 (15%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAA--------GHLVSSASI 80
            LLTG S+G I++          KI ++   + D+ +               G L+++  +
Sbjct: 1271 LLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDV 1330

Query: 81   DAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGI-DAAVYIYD------- 132
              ++V+D  T      I  + +S   SL +    LA    + G  D ++ +YD       
Sbjct: 1331 KVIRVWDAHTETVEVDIPAKTSSLITSLTADQ--LAGNIFVAGFADGSLRVYDRRLDPRD 1388

Query: 133  --IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQV 190
              IRRW    R+  D     +  +         L+SG+T+G   ++D++    ED +   
Sbjct: 1389 SMIRRW----RAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIR---SEDPVESF 1441

Query: 191  INYASIHSCGWLSQKRIYTLSHMETFAIHE 220
            ++       G  SQ++  T++ M+   +HE
Sbjct: 1442 VDQNVTSQYG--SQQKPTTMTCMQ---VHE 1466

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFIS---LDSRHGLLACGTELQGIDAAVYIYDIRRWD 137
           + + + D RT    +   +  ++  I+    +  +  L C  + +G    + I DIR+ +
Sbjct: 263 NGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEG---TLNICDIRQLE 319

Query: 138 APLRSIIDSHHDDVTCIKFHPSDVNVLLS-GSTDGYTNIYDLKQDEE 183
            P+++   SH D V+ I+++P    V+ S G  DG   I+DL Q+++
Sbjct: 320 HPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQEDD 364

>TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908
           bp, 635 aa] {ON} Anc_5.104 YGR225W
          Length = 635

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 121 LQGIDAAVYIYDIRRWDAPLRS--IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD- 177
           + G+  +VY++  +    P+ S   ++  HD VTC+ F P ++ + + G+  G   ++D 
Sbjct: 267 MVGLGCSVYMWSDKHGAIPVLSHDYLNRKHDVVTCVSFCPQNL-LFVIGTKQGRVLLFDQ 325

Query: 178 ---LKQDEEEDALHQVINYAS 195
              L++  EED+L  +  Y S
Sbjct: 326 EVCLERHREEDSLTPLYEYQS 346

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 91  NACVAKIHNEANSPFISLD-SRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHD 149
           N    KI  E  +  + LD S++  L   +    +D  V ++ + R  + L++    H D
Sbjct: 317 NPSCFKIFKEHTADVLDLDWSKNNFLITSS----MDRTVKLWHLERQTS-LKTF--QHQD 369

Query: 150 DVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
            VTC++FHP+D    +SG  D    ++ + ++E
Sbjct: 370 FVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 57/140 (40%), Gaps = 24/140 (17%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACVAKIHNE--------------ANSPFISLDSRHGL 114
           F    LVS +    ++ +D+RT  C+  I                 +N+P  S+   H  
Sbjct: 512 FEGNSLVSGSQDRTIRQWDLRTGKCLQTIDINFTNRGTSDGFSTISSNNPRSSVLLTHND 571

Query: 115 LACGTELQGIDAAVYIYD----IRRWDAPLRSII---DSHHDDVTCIKFHPSDVNVLLSG 167
                 LQ  DAA+        +R WD  +  ++   + H D VT ++F   D   L++G
Sbjct: 572 PPVIGALQCYDAAMATGTKDGIVRLWDLRMGQVVRTLEGHTDAVTGLQF---DAVNLVTG 628

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 629 SLDRSIRIWDLRTGTLADAF 648

>CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar to
           uniprot|P39014 Saccharomyces cerevisiae YIL046w MET30
          Length = 673

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 72/163 (44%), Gaps = 15/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L LQ +Y+  L TG  +  + + D  +G+ ++++      +  L   D     G L  + 
Sbjct: 338 LTLQFNYRL-LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKT- 395

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               ++V++  T  C++      +S  +S+DS   ++  G+     D  V ++ +   ++
Sbjct: 396 ----IRVWNYITGECISTYRGHTDS-VMSVDSHKKIIVSGSA----DKTVKVWHV---ES 443

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
                +  H + V C+K HP   +   S S D    ++D++ +
Sbjct: 444 RTCYTLKGHTEWVNCVKLHPKSFSC-YSCSDDTTIRMWDIRTN 485

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 7/108 (6%)

Query: 72  GHLVSSASIDAVKV-FDIRTNACVAKIHNEANSPFISLDSRHGL-LACGTELQGIDAAVY 129
           G LV S  +D++ + +DIR+ + V  +   +   +    S +G  +A G    G D  + 
Sbjct: 324 GSLVCSGGMDSLTMLWDIRSGSKVMTLAGHSKPVYTVAWSPNGYQVATG----GGDGLIN 379

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVN-VLLSGSTDGYTNIY 176
           ++DIR+ D    + I +H + VT +KF   D    L+S   D   NIY
Sbjct: 380 VWDIRQRDEGQLNQILAHRNIVTQVKFSNDDGGKKLVSCGYDNLINIY 427

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 20/162 (12%)

Query: 36  GEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV-KVFDIRTNACV 94
           GE+RLL              E  ++D+K       +G  + SAS D   +++D  T+  +
Sbjct: 258 GELRLLG--------DFVGHERRVSDVKY----HPSGKFIGSASHDMTWRLWDASTHQEL 305

Query: 95  AKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
                 +   F       G L C     G+D+   ++DIR     +   +  H   V  +
Sbjct: 306 LLQEGHSKGVFSLSFQCDGSLVCSG---GMDSLTMLWDIRSGSKVM--TLAGHSKPVYTV 360

Query: 155 KFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
            + P+   V  +G  DG  N++D++Q  +E  L+Q++ + +I
Sbjct: 361 AWSPNGYQVA-TGGGDGLINVWDIRQ-RDEGQLNQILAHRNI 400

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 88/191 (46%), Gaps = 23/191 (12%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIK----ASETSINDLKVIDSDF 69
           E + L   P  K G LLTG  +G+I     ++ + +   +    A+  SI D++   ++ 
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTE- 333

Query: 70  AAGHLVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGI 124
               + +SA  D  ++++D R+      I  +A++     IS   + G LLA G +    
Sbjct: 334 --STVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDD---- 387

Query: 125 DAAVYIYDIRRWDAPLRSII------DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +    ++D+R++       +      D H   +T I F+P D +++  GS D    ++DL
Sbjct: 388 NGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDL 447

Query: 179 KQDEEEDALHQ 189
             + +++ + Q
Sbjct: 448 SVEADDEEIKQ 458

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLL 165
           ISL+   GLLA G    G D +  ++DI   D P++  +  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 166 SG 167
           +G
Sbjct: 452 TG 453

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAP----LRSIIDSHHDDVTCIKFHPSDV 161
           +S++  +GLLA G E    D+ V  +D R         L + IDS    VT   F    +
Sbjct: 189 VSINQVNGLLAVGLE----DSVVEFWDPRARSRVSKLYLENQIDSSSFQVTATSFRNDGL 244

Query: 162 NVLLSGSTDGYTNIYDLKQDE 182
           N    G+++GYT +YDL+  E
Sbjct: 245 N-FACGTSNGYTYLYDLRTSE 264

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           G D+ V+I+D R   +  +  I   + DV  +KF+ +D N ++SGS DG   +YDL+ D
Sbjct: 254 GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDDGIIRLYDLRAD 309

>ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1525

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 17/164 (10%)

Query: 37   EIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKVF-DIRTNA 92
            E+ + DW+S ++L +        T + DLK ++ D AA  L++ +S   VK++ +I +N 
Sbjct: 1203 EVTVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNEDDAA-LLLAGSSDGIVKIYKNIHSND 1261

Query: 93   CVAKIHNEANSPFISLDSRH-GLLACGTELQGIDAAVY----IYDIRRWDAPLRSI-IDS 146
             +  I        + L  R  GLL   TE Q I  ++     +  IR WDA   ++ +D 
Sbjct: 1262 DLELISAWRGLTDMLLTPRSSGLL---TEWQQIRGSLLTTGDVKIIRAWDAHTETVEVDI 1318

Query: 147  HHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDAL 187
                 + I    SD    N++++G  DG   +YD + D  +  +
Sbjct: 1319 PAKTSSLITSITSDQLAGNLVVAGFADGSLRVYDRRVDPRDSMV 1362

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (44%), Gaps = 21/157 (13%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           Y   + TG  +G +RL D  SGQ ++ ++    ++  L+     F + +LV+ +   +++
Sbjct: 579 YDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQ-----FDSVNLVTGSLDRSIR 633

Query: 85  VFDIRTNACVAKIHNEANSPFISL--DSRHGLLACGTELQGIDAAVYIYDIRR---WDAP 139
           ++D+RT           NSP  SL  D  H L++        ++ V +Y+ +    W   
Sbjct: 634 IWDLRTGLLADAF--AYNSPISSLQFDLEHILVSNN------ESVVQVYNRKEDQHWTCG 685

Query: 140 LRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
             S   S +D V  I++       L+ G T G  N +
Sbjct: 686 DASSASSENDLVEFIRYKN---GYLVEGRTTGDVNAW 719

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 73/165 (44%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  +     DF     + ++
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEGHEGPVRGI-----DFHPTQPIFAS 70

Query: 79  SID--AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           S D   +K++ + TN C+       +  +I     H       EL  I +A     IR W
Sbjct: 71  SGDDSTIKLWSLDTNKCLYTFTGHLD--YIRTVFFH------KELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + I  H+  V C +FHP++ ++++S S D    ++D+
Sbjct: 123 NWQNRKELACITGHNHFVMCAQFHPTE-DLVVSASLDETVRVWDI 166

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 85/211 (40%), Gaps = 47/211 (22%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSD----FAA-- 71
           C+   P     L+ G SNGE RL D  S   +Q++   + ++N + + ++     F +  
Sbjct: 258 CVTFHPGSNL-LVVGFSNGEFRLYDLPSFTLVQQLSMGQNAVNTVSINNTGEWLAFGSSA 316

Query: 72  -------------------GH---------------LVSSASIDAVKVFDIRTNACVAKI 97
                              GH               +V++A+   +KV+D+ +  C+A  
Sbjct: 317 LGQLLVYEWQSESYILKQQGHFDSLNGLTYSPDGARVVTAANDGKIKVWDVVSGFCLATF 376

Query: 98  HNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFH 157
               +S      ++ G +   + L   D  V  +D+ R+    R+   +      C+   
Sbjct: 377 SEHTSSVTAVQFAKRGQVLFSSSL---DGTVRAWDLIRF-RNFRTFTSTQRIPFNCLAVD 432

Query: 158 PSDVNVLLSGSTDGY-TNIYDLKQDEEEDAL 187
           PS   V+ +GS+D +  +++ ++  +  D+L
Sbjct: 433 PSG-EVVCAGSSDSFEIHVWSVQTGQLLDSL 462

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+  C++ I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PVKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 329 LKHFDLLQDLNEPVL--TIPYA 348

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 124 IDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           +D  V ++ I R  + L++ +  H D VTC++FHP D     SG  D     + + + E 
Sbjct: 233 MDKTVKLWHINRTTS-LKTFV--HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEV 289

Query: 184 EDAL 187
            +A 
Sbjct: 290 AEAF 293

>KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.231
           YIL046W
          Length = 591

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 70/163 (42%), Gaps = 15/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L LQ +YKY L TG  +  + + D  +   ++++      +  L   D     G L  + 
Sbjct: 256 LSLQFNYKY-LFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFDDKKLITGSLDKT- 313

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               +K+++  T  C++      +S  +S+D+   ++  G+     D  V ++ I   ++
Sbjct: 314 ----IKIWNYVTGQCISTYRGHTDS-VMSVDAFKKIIVSGSA----DKTVKVWHI---ES 361

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
                +  H + V C+K HP       S S D    ++D++ +
Sbjct: 362 RTCYTLKGHTEWVNCVKLHPKSF-TCFSCSDDTTIRMWDIRTN 403

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 18/146 (12%)

Query: 43  WNSGQSLQKIKA--SETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNE 100
           W S  S Q +K   S TSI+      +DFA    ++S++   V++F  RT   +      
Sbjct: 27  WRSYGSTQLVKEHNSVTSISFNPTHPNDFA----ITSST--RVQLFSSRTRQVIKTFSRF 80

Query: 101 ANSPFISLDSRHG-LLACGTELQGIDAA--VYIYDIRRWDAPLRSIIDSHHDDVTCIKFH 157
            +  + +   + G LLA G      DA   V IYD       L SI  S H      KFH
Sbjct: 81  KDVVYSASFRQDGKLLAMG------DATGRVSIYDSYNPRTQLVSIAASSHP-THVAKFH 133

Query: 158 PSDVNVLLSGSTDGYTNIYDLKQDEE 183
           P+D   L++ S D    ++D+ Q +E
Sbjct: 134 PADSRTLVTASDDRVVRVWDITQAQE 159

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 20/129 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLL----- 115
           D+K  D     G + S++  + VK++D RT  CV+ I          L  +H +L     
Sbjct: 210 DVKSCDWHPTMGLIASASKDNLVKLWDPRTGNCVSTI----------LKFKHTVLKTRFQ 259

Query: 116 -ACGTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L GI  D +  ++DIR+    L    D    D   + +HP + +    G+ DG 
Sbjct: 260 PGGGNLLLGISKDKSCRVFDIRQNMTELMVFRDD--VDYMTLLWHPINHSTFTVGNYDGS 317

Query: 173 TNIYDLKQD 181
              +D+ QD
Sbjct: 318 IKHFDVLQD 326

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 123 GIDAAVYIYDIRRW---DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           G   +V IYDI +    D P+ + +  H   +  + F+    ++L+SG  DG   I+DL+
Sbjct: 197 GTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWDLR 256

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 281 ENEIVIPRAHGDEVVRDVFISALQSDLLYSCGEDGFVKIW 320
           +N +V   +     +  V  + +Q+ LL S G+DG +KIW
Sbjct: 214 DNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIW 253

>CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa]
           {ON} similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102c
          Length = 978

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 140 LRSIIDSHHDD-VTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           +RS+    H D VTC+KFHP+D    +SG  D    ++ +  DE
Sbjct: 443 MRSLKSFQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDE 486

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 19/173 (10%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH-LVSSAS 79
             P  K+ L TG  +  IR+ D    + +  ++  E  I  L      F +G  LVS + 
Sbjct: 435 FSPDGKF-LATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDY----FPSGEKLVSGSG 489

Query: 80  IDAVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------ 132
              V+++D+RT  C   +  E     +++    G  +A G+    +D AV ++D      
Sbjct: 490 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGS----LDRAVRVWDSETGFL 545

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEED 185
           + R D+    +   H D V  + F   D N ++SGS D    +++L     +D
Sbjct: 546 VERLDSE-NELGTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLNDANNKD 596

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 67/155 (43%), Gaps = 13/155 (8%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
           +LT L +G + + ++ +   ++ I+A+++ I   K I        ++       ++VF+ 
Sbjct: 28  VLTTLYSGRVEIWNYETQTEVRSIQATDSPIRSGKFIAR---KNWIIVGCDDYRIRVFNY 84

Query: 89  RTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRRWDAPLRSIID 145
            T   V     EA+  +I   + H     L  G++    D  V +++  + +  L    +
Sbjct: 85  NTGEKVVDF--EAHPDYIRSIAVHPTKPYLLSGSD----DLTVKLWNWEK-NWALEQTFE 137

Query: 146 SHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            H   V C+ F+P D +   SG  D    ++ L Q
Sbjct: 138 GHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQ 172

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 12/94 (12%)

Query: 2   SSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIND 61
           +SYS++     G+      LQ SY+  L TG  +G IRL D   G+ ++ I A  +++  
Sbjct: 499 ASYSMLNPPVVGT------LQ-SYENALATGSRDGLIRLWDLRIGKVVRTIPAHNSAVTA 551

Query: 62  LKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVA 95
           LK     F   HL++ +      ++D+RT   V+
Sbjct: 552 LK-----FDTTHLITGSFDRTAFIWDLRTGDSVS 580

>TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa]
           {ON} Anc_1.34 YCL039W
          Length = 765

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 24/136 (17%)

Query: 58  SINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFI---SLDSRHGL 114
           S+  +K  +S  A+  LVS  S + ++++D      V K   +    FI        + L
Sbjct: 632 SLPQIKDANSPLASLMLVSLKS-NELQLWDFHEQILVQKYFGQKQEQFIIRSCFGYNNKL 690

Query: 115 LACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDV------------TC--IKFHPSD 160
           +A G+E    D  +YI+D  R++  + S++ +H  D             TC  + + P+D
Sbjct: 691 VASGSE----DGKIYIWD--RFNGNIISVLTAHISDRPTTNGSSKKSTKTCNAVVWSPTD 744

Query: 161 VNVLLSGSTDGYTNIY 176
             +  SG  DGY  I+
Sbjct: 745 KTLFASGGDDGYIKIW 760

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           V+I+D+R    PL  +   H+  V  I F   + N ++S S DG    +DL ++E+
Sbjct: 183 VFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 7/108 (6%)

Query: 72  GHLVSSASIDAVKV-FDIRTNACVAKIHNEANSPFISLDSRHGL-LACGTELQGIDAAVY 129
           G LV S  +D++ + +DIR+ + V  +   +   +    S +G  +A G    G D  + 
Sbjct: 319 GSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATG----GGDGIIN 374

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVN-VLLSGSTDGYTNIY 176
           ++DIR+ D    + I +H + VT ++F   D    L+S   D   N+Y
Sbjct: 375 VWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 65/149 (43%), Gaps = 12/149 (8%)

Query: 49  LQKIKASETSINDLKVIDSDFAAGHLVSSASIDAV-KVFDIRTNACVAKIHNEANSPFIS 107
           L  +   E  I+D+K       +G  + SAS D   +++D  T+  +          F  
Sbjct: 258 LGDLVGHERRISDVKY----HPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL 313

Query: 108 LDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSG 167
                G L C     G+D+   ++DIR     +   +  H   +  + + P+   V  +G
Sbjct: 314 SFQCDGSLVCSG---GMDSLSMLWDIRSGSKVM--TLAGHSKPIYTVAWSPNGYQVA-TG 367

Query: 168 STDGYTNIYDLKQDEEEDALHQVINYASI 196
             DG  N++D+++  +E  L+Q++ + +I
Sbjct: 368 GGDGIINVWDIRK-RDEGQLNQILAHRNI 395

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 72/165 (43%), Gaps = 20/165 (12%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH--LVS 76
           +   PS  + +L  L +  I+L D+  G  L + +  E  +  L     DF       VS
Sbjct: 17  IAFHPSRPW-VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-----DFHPTQPIFVS 70

Query: 77  SASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +     +KV+ + TN C+  +    +  ++     H       EL  I +A     IR W
Sbjct: 71  AGDDYTIKVWSLETNKCLYTLQGHLD--YVRTVFFHH------ELPWIISASDDQTIRIW 122

Query: 137 DAPLR---SIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   R   + +  H+  V C +FHP++ ++++S S D    ++D+
Sbjct: 123 NWQNRKEIACLTGHNHFVMCAQFHPNE-DLVVSASLDESVRVWDI 166

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 14/156 (8%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETS---INDLKVIDSDFAAGHLVSSASIDAVKV 85
           LL+G  +G I L + N+  S      S      +ND K  + D      VS  S   +++
Sbjct: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDS--TLQL 245

Query: 86  FDIR---TNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRS 142
            D R   T     K+    N+   S  S++   A GT     D+ VY++D R    PL S
Sbjct: 246 HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT-----DSHVYLFDRRDISRPLHS 300

Query: 143 IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +   H   VT ++F P    +L++   D    I+D+
Sbjct: 301 MA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 71/159 (44%), Gaps = 17/159 (10%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASID-AVKVFD 87
           +LT L +G + + ++ + Q ++ I+ +ET +   + I    A  + +   S D  ++VF+
Sbjct: 28  VLTTLYSGRVEIWNYETKQEVRSIQVTETPVRTGRFI----ARKNWIIVGSDDFKIRVFN 83

Query: 88  IRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRR-WDAPLRSI 143
             T   V     EA+  +I   + H     +  G++    D  V +++  + W+  L   
Sbjct: 84  YNTGEKVVDF--EAHPDYIRSIAVHPTKPYVLSGSD----DLTVKLWNWEKSWE--LEQQ 135

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
            D H   V C+ F+P D +   S   D    ++ L Q +
Sbjct: 136 FDGHTHFVMCVTFNPKDPSTFASACLDRTVKVWSLGQQD 174

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+  C++ I          L  +H +L     
Sbjct: 223 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 272

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 273 PTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGS 330

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 331 LKHFDLLQDLNEPIL--TIPYA 350

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 62/143 (43%), Gaps = 30/143 (20%)

Query: 61  DLKVIDSDF--AAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC 117
           D +V D  F   +  L +S   D +V+VFD+R+ A    I+   +SP     S     A 
Sbjct: 287 DSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPA----SGPNAGAT 342

Query: 118 GTELQGIDA----------------------AVYIYDIRRWDAPLRSIIDSHHDDVTCIK 155
              L+G DA                       + I D+R  ++P+ ++ + H   V  IK
Sbjct: 343 TPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNL-EGHTCSVNEIK 401

Query: 156 FHPSDVNVLLSGSTDGYTNIYDL 178
           +HP+  NVLLS S D     +DL
Sbjct: 402 WHPTKRNVLLSCSDDCQALYWDL 424

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           G D   YI+DIR     +++   S+ D V  ++F   D N + +GS DG  N+YDL+ D
Sbjct: 247 GSDGYTYIWDIRT-PGSVQNFFVSNRD-VNTLQFF-KDGNSIATGSDDGMVNLYDLRSD 302

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 75/183 (40%), Gaps = 30/183 (16%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
           CL+ + +Y   ++TG  +  IR+ D  + + L ++   +  +  LK +      G LVS 
Sbjct: 371 CLQFEDNY---VITGADDKMIRIYDSINKKFLLQLSGHDGGVWALKYVH----GGILVSG 423

Query: 78  ASIDAVKVFDIRTNAC--VAKIHNEA----------NSPFISLDSRHGLL--------AC 117
           ++   V+V+DI+   C  V K HN            N+ +I   SR   L          
Sbjct: 424 STDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNTKYIVTGSRDNTLHIWKLPEETS 483

Query: 118 GTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD 177
            TE Q       ++     +     ++  H   V  +  H    N+++SGS D    ++D
Sbjct: 484 TTEHQAEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHG---NIVVSGSYDNTLIVWD 540

Query: 178 LKQ 180
           + Q
Sbjct: 541 VAQ 543

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           + +YD   W + L S++ +H  DVT +K  PS+  VLLSGSTD    ++ L+
Sbjct: 123 INVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSLE 171

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAP----LRSIIDSHHDDVTCIKFHPSDV 161
           +S++S +GL+A G E    D+ V  +D R         L + ID+    VT   F    +
Sbjct: 196 VSINSANGLVAVGLE----DSVVEFWDPRARSRVSKLYLENTIDNSDFTVTTTSFRNDGI 251

Query: 162 NVLLSGSTDGYTNIYDLKQDE 182
           N    G+++GY+ +YDL+  E
Sbjct: 252 N-FACGTSNGYSYLYDLRASE 271

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 73  HLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYD 132
           H  +  S   V+VF  RT   +       +  + +   + G L C  +  G+   V +YD
Sbjct: 53  HDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYD 109

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
                  L S+  S H      KFH  D+  L+S S D  T ++D+    E
Sbjct: 110 SYNPRTLLVSVAASQHP-THVTKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+  C++ I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PTKGNLLMAISKDKSCRVFDIRYSMRELMCVRDE--TDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL QD  E  L   I YA
Sbjct: 329 LKHFDLLQDLNEPIL--TIPYA 348

>Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {ON}
            YHR186C (REAL)
          Length = 1556

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKV 85
            L+T      I + DW  G+ L K        T + DLK+I+ D +A  L++ +S   +K+
Sbjct: 1223 LITADDRSTITVFDWERGKVLSKFSNGTPFGTKVTDLKLINEDDSA-LLLTGSSDGIIKI 1281

Query: 86   F----DIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQG-IDAAVYIYDIRRWDAPL 140
            +    DI T   V+      +   +      GLL    +++G +     +  IR WDA  
Sbjct: 1282 YRNYQDIDTFEIVSAWRGLTD--MLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAHT 1339

Query: 141  RSI-IDSHHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
             ++ +D      + I    +D    N+ ++G  DG   +YD + D  +  + +
Sbjct: 1340 ETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRR 1392

>KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 421

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           G D  VYI+D R   A     +     DV+ +KF  ++ N +L+G+ DG   ++DL+ D
Sbjct: 239 GSDGYVYIWDTRMRTAGQSFFVS--ESDVSTLKFF-NNGNAILTGTDDGIARMFDLRSD 294

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 88/188 (46%), Gaps = 17/188 (9%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSIND-LKVIDSDFAAG 72
           E + L   P  K G LL+G  +G+I L   ++ + +   ++   S N+ ++ I       
Sbjct: 274 EGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTES 333

Query: 73  HLVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGIDAA 127
            + ++A+ D  ++++D R+      I  +A++     IS   + G LLA G +    +  
Sbjct: 334 TVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGT 389

Query: 128 VYIYDIRRWDAPLRSII------DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
             ++D+R++       +      D H   +T I F+P D +++  GS D    ++DL  +
Sbjct: 390 WGVWDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 449

Query: 182 EEEDALHQ 189
            +++ + Q
Sbjct: 450 ADDEEIKQ 457

>YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40
           repeat-containing subunit of the Set3C histone
           deacetylase complex, which represses early/middle
           sporulation genes; antagonizes telomeric silencing;
           binds specifically to the Sir4p N-terminus
          Length = 535

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 86/195 (44%), Gaps = 22/195 (11%)

Query: 29  LLTGLSNGEIRLLDWN-SGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFD 87
           ++TG+ NGE+RL  WN +G  L  +      I  +K    +    H++S    +   +++
Sbjct: 235 IVTGVENGELRL--WNKTGALLNVLNFHRAPIVSVKW---NKDGTHIISMDVENVTILWN 289

Query: 88  IRTNACVAKIH-NEANSPFISLDSRHGLLACGTELQGID----------AAVYIYDIRRW 136
           + +   +      E     I+ ++  G  + G +++ +D           A+++Y I   
Sbjct: 290 VISGTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITE- 348

Query: 137 DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASI 196
             P   +I  HH  ++ ++F+ ++  +LLS S DG   I+       ++  +   +  SI
Sbjct: 349 KTPTGKLI-GHHGPISVLEFNDTN-KLLLSASDDGTLRIWHGGNGNSQNCFYG--HSQSI 404

Query: 197 HSCGWLSQKRIYTLS 211
            S  W+   ++ + S
Sbjct: 405 VSASWVGDDKVISCS 419

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 70/169 (41%), Gaps = 13/169 (7%)

Query: 13  GSENW--CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70
           G   W  CLK+ P       TG ++  +++ D  SG+    +     ++ D+ +      
Sbjct: 113 GHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLAGHVMTVRDVAISQRH-- 170

Query: 71  AGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPF-ISLDSRHGLLACGTELQGIDAAVY 129
             +L S++    VK +D+  N  +   H   +    + +     L+A      G D  V 
Sbjct: 171 -PYLFSASEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDIHPTLDLIASA----GRDGVVK 225

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           ++DIR   A +  I   H   +T +   P +  V +S STD    ++D+
Sbjct: 226 LWDIRSRTAVMTLI--GHKSPITKVHCLPVNPQV-VSSSTDATVRLWDV 271

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 40/190 (21%)

Query: 40  LLDWNS--------GQSLQKIKASETSINDLKVIDSDFAA-------GHLVSSASIDAVK 84
           L+DW+S        GQS+     + + I  L    ++F +        H+    S   ++
Sbjct: 434 LIDWSSTDMLAVALGQSIFLTDNNTSEIIHLCDTKNEFTSLSWINTGSHIAIGQSNGIIE 493

Query: 85  VFDIRTNACVAKIHNEAN-SPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI 143
           ++D+    C+  +    + +  +S +S   +L  G+     D  +   D+R  D P    
Sbjct: 494 IYDVTKRKCIRTLSGHTDRTACLSWNSH--ILTSGSR----DRTILHRDVRMKD-PFFER 546

Query: 144 IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD-------LKQDEEEDALHQVINYASI 196
           I SH  +V  +K++ SD N L+SG  D   NIYD       L  DE           A++
Sbjct: 547 IKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYDGCMPTPLLTLDEHT---------AAV 596

Query: 197 HSCGWLSQKR 206
            +  W   KR
Sbjct: 597 KALAWSPHKR 606

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 76/172 (44%), Gaps = 12/172 (6%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKV 85
            L+T      I + DW S Q   K        T I  L++I+ D  A  L++ +S   VKV
Sbjct: 1199 LITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINEDDNA-LLLTGSSNGIVKV 1257

Query: 86   FDIRTNACVAKIHN--EANSPFISLDSRHGLLACGTELQG-IDAAVYIYDIRRWDAPLRS 142
            F    ++   ++ N   A +  +      GLL    +++G + A   +  IR WDA   S
Sbjct: 1258 FKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDVKVIRIWDAHTES 1317

Query: 143  I-IDSHHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQV 190
            + +D      + I    SD    N+ + G TDG   +YD + D   DA+ +V
Sbjct: 1318 MEVDIPAKTSSLITSITSDQLSGNIFVCGFTDGSLRVYDRRVD-VRDAMVRV 1368

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 17/166 (10%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASI 80
             P  K+ L TG  +  IR+ D  + + +  ++  E  I  L    S      LVS +  
Sbjct: 478 FSPDGKF-LATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPS---GDKLVSGSGD 533

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------I 133
             V+++D+RT  C   +  E     +++    G L+A G+    +D  V I+D      +
Sbjct: 534 RTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGS----LDRTVRIWDSETGFLV 589

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
            R D+    +   H D V  + F   D + ++SGS D    +++L+
Sbjct: 590 ERLDSE-NELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSVKLWNLR 633

>SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {ON}
           similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102C Protein of unknown function transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 966

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 147 HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           H D VTC+KFHP+D    +SG  D    ++ +  DE
Sbjct: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDAL 187
           + I D+R  ++P+ ++ + H   V  IK+HP+  NVLLS S D     +DL     E   
Sbjct: 377 IIILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME--- 432

Query: 188 HQVINYASIHSCG 200
              IN  S+ S G
Sbjct: 433 ---INGGSVKSPG 442

>Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]
           {ON} complement(268887..269966) [1080 nt, 360 aa]
          Length = 359

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 77/181 (42%), Gaps = 18/181 (9%)

Query: 54  ASETSINDLKV-IDSDFAAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPFISLDSR 111
           A+E SI+D+     SDF    L S +S D  V+++DI+      +   E   P   L +R
Sbjct: 32  AAEDSISDIAFSPQSDF----LFSVSSWDNKVRIWDIQGGVAQGRAQFEHAKPV--LCTR 85

Query: 112 HGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKF---HPSDVNVLLSGS 168
             L        G D  V +YD+   ++     I +H   +  ++F    PS+   L++GS
Sbjct: 86  WSLDGSKVASGGCDNIVNMYDV---NSGQSQQIGTHSSAIKSLRFVQCGPSNQECLVTGS 142

Query: 169 TDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEF 228
            D     +DL+Q +    L       S+ S G    K +   +      I +LN+  + F
Sbjct: 143 WDKTIKYWDLRQPQPITTLALPDRVYSMDSKG----KLLVVGTADRNICIIDLNNPGNIF 198

Query: 229 K 229
           K
Sbjct: 199 K 199

>TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657)
           [2646 bp, 881 aa] {ON} Anc_6.239 YGL137W
          Length = 881

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 71/166 (42%), Gaps = 16/166 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +LT L +G + + ++ S   ++ I  +E  +   + I    A  + +   
Sbjct: 19  IDFHPSEPW-VLTTLYSGRVEIWNYESQTEVRSITVAEAPVRAGRFI----ARRNWIVVG 73

Query: 79  SID-AVKVFDIRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIR 134
           S D  ++VF+  T   V     EA+  +I   + H     L  G++    D  V +++  
Sbjct: 74  SDDFRIRVFNYNTGEKVVDF--EAHPDYIRSIAVHPTKPYLLSGSD----DLTVKLWNWE 127

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           + +  L    + H   V C+ F+P D +   SG  D    ++ L Q
Sbjct: 128 K-NWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQ 172

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           G D   YI+D+R   A ++S   S+ D V  +KF   D N +++GS DG   ++DL+ D
Sbjct: 245 GSDGYTYIWDVRS-AASVQSFFVSNSD-VNTVKFFK-DGNSIVTGSDDGTLRMFDLRAD 300

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 123 GIDAA-VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
            ID++ V I D+R   +PL ++ ++H   +  IK+HP+  NVLLS S D     +DL
Sbjct: 331 AIDSSKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 86/190 (45%), Gaps = 17/190 (8%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +G+I     ++ + +   K   T+ N+  V D  ++   
Sbjct: 281 EGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITD-KQPFTAENNKSVEDIQWSRTE 339

Query: 74  --LVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHGLLACGTELQGIDAA 127
             + +SA  D  ++++D R+      +  +A++     IS   + G L    +  G+   
Sbjct: 340 STVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWG- 398

Query: 128 VYIYDIRRW------DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
             ++D+R++      D    +  D H   +T I F+P D +++   S D    ++DL  +
Sbjct: 399 --VWDLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVE 456

Query: 182 EEEDALHQVI 191
            +++ + Q I
Sbjct: 457 ADDEEIKQQI 466

>Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {ON}
           complement(87105..89225) [2121 nt, 707 aa]
          Length = 706

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 86/193 (44%), Gaps = 41/193 (21%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWN-SGQSLQKIKAS-ETSIND-LKVIDS------- 67
           C++L   Y   L+TG  +  +++ D N + Q  Q+ ++S E+  N  +   DS       
Sbjct: 444 CMQLGSHYNM-LITGGKDAMLKIWDINLATQLYQEDQSSIESDYNSCIHTFDSHSGGITA 502

Query: 68  -DFAAGHLVSSASIDAVKVFDIRTNACVAKI-------HNE-----------ANSPFI-- 106
             F + HLVS++    ++ +D+    C+  I        N+           ++ PF+  
Sbjct: 503 LSFDSVHLVSASQDKTIRQWDLVNGKCIQTIDLSSVVKQNQTDIVNIPDFYSSSEPFVTG 562

Query: 107 SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLS 166
           SL      LA GT     D  V ++D+R     +R+ +  H + VT +KF   D   L+S
Sbjct: 563 SLQCFDAALATGTR----DGLVRLWDMRSGKV-VRTFM-GHTNAVTSLKF---DSYNLIS 613

Query: 167 GSTDGYTNIYDLK 179
           GS D     +DL+
Sbjct: 614 GSLDKSIRTWDLR 626

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 65/150 (43%), Gaps = 20/150 (13%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           +   L TG  +G +RL D  SG+ ++       ++  LK     F + +L+S +   +++
Sbjct: 567 FDAALATGTRDGLVRLWDMRSGKVVRTFMGHTNAVTSLK-----FDSYNLISGSLDKSIR 621

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIY---DIRRWDAPLR 141
            +D+RT +       ++    I  DS + + A G      + +  +Y   D ++W+    
Sbjct: 622 TWDLRTGSLSDLFAYDSPVYSIDFDSSNLVSAIG------ETSFKVYNRKDDKQWECV-- 673

Query: 142 SIIDSHHDDVTCIKFHPSDVNVLLSGSTDG 171
               +  +D + I       N  ++GS DG
Sbjct: 674 ----NSAEDTSSIYHVKYKNNYAVTGSNDG 699

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 5/115 (4%)

Query: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDI 133
           L S+ S ++V ++D+RTN+   KI     +  I  +    + A    +   D   Y YD+
Sbjct: 229 LASTGSDNSVVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDM 285

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
           R     L ++   H   V  + F P+  + +++GS D    IY +      +  H
Sbjct: 286 RNMSRAL-NVFKDHVSAVMDVDFSPTG-DEIVTGSYDKTVRIYQVNHGHSREIYH 338

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           V +YD     A L SI  S H      KFHP+D   L++ S D    ++D+ Q +E
Sbjct: 105 VSVYDSYNPRAQLVSIAASSHP-THVAKFHPADSRTLVTASDDRVVRVWDITQAQE 159

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 80/174 (45%), Gaps = 24/174 (13%)

Query: 29  LLTGLSNGEIRLLDWN----SGQSLQKIKA--SETSINDLKVIDSDFAAGHLVSSA-SID 81
           L +G +NGEI + D N    S  S   +    S +S++++  +  + +  H+ +SA S +
Sbjct: 124 LASGGNNGEIFIWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSN 183

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLL------------ACGTELQGIDAAVY 129
              ++D++    V  IH    SP   +  +  ++            A G++    D ++ 
Sbjct: 184 FASIWDLKAKKEV--IHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSD---NDPSIL 238

Query: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEE 183
           ++D+R  + PL+++   H   +  + +   D N+LLS   D    +++ +  EE
Sbjct: 239 VWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 28/131 (21%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACVAKI-----------HNEANSPFISLDSRHGLLAC 117
           F A +LVS +    ++ +D+    CV  +            +   S F++ ++ H ++  
Sbjct: 513 FEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGA 572

Query: 118 GTELQGIDAAVYIYD----IRRWDAPLRS-----IIDSHHDDVTCIKFHPSDVNVLLSGS 168
              +Q  DAA+        +R WD  LRS      ++ H D VT ++F   D   L++GS
Sbjct: 573 ---IQCYDAALATGTKDGIVRLWD--LRSGRVVRTLEGHSDAVTSLQF---DSLNLVTGS 624

Query: 169 TDGYTNIYDLK 179
            D    I+DL+
Sbjct: 625 LDNSIRIWDLR 635

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           Y   L TG  +G +RL D  SG+ ++ ++    ++  L+     F + +LV+ +  ++++
Sbjct: 576 YDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQ-----FDSLNLVTGSLDNSIR 630

Query: 85  VFDIRT 90
           ++D+RT
Sbjct: 631 IWDLRT 636

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 21/122 (17%)

Query: 70  AAGHLVSSASIDAVKVFDIRTNACV-------------AKIHNEANSPFISLDSRHGLLA 116
           + G +++S S++ +  +DI+T   +             AK    A   ++       LLA
Sbjct: 34  SPGQIITS-SLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLA 92

Query: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176
            G      D  + I+D++     +  I +SH   +T +KF PS    L+SGS D    I+
Sbjct: 93  AGYA----DGVIKIWDMQTQTVLI--IFNSHTAAITFLKFDPSGTR-LISGSRDSNIIIW 145

Query: 177 DL 178
           DL
Sbjct: 146 DL 147

>KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} similar
           to uniprot|P53196 Saccharomyces cerevisiae YGL004C RPN14
           Putative non-ATPase subunit of the 19S regulatory
           particle of the 26S proteasome localized to the
           cytoplasm
          Length = 423

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 27  YGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVF 86
           +G L+   +  +++ D ++G  L+       S+ND  ++D      + VS++S  ++K++
Sbjct: 171 HGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDR---GRNFVSASSDGSLKLW 227

Query: 87  DIRTNACVAKIHNEANSPFISLDSRHG 113
           +  T+ACV  +++      ISL +  G
Sbjct: 228 ECSTSACVFTLNSNDGINCISLANYQG 254

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 19/84 (22%)

Query: 105 FISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI---------IDSHHDDVTCIK 155
           ++S++  +GLLA GTE   ++          WD   RS          ID+    VT   
Sbjct: 185 YVSINDVNGLLAAGTETNAVEF---------WDPRSRSRVSKLYLENNIDNRPFQVTTCS 235

Query: 156 FHPSDVNVLLSGSTDGYTNIYDLK 179
           F    +N    G+++GY+ +YDL+
Sbjct: 236 FRNDGLN-FACGTSNGYSYLYDLR 258

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 71/182 (39%), Gaps = 24/182 (13%)

Query: 40  LLDWNS--------GQSLQKIKASETSINDLKVIDSDF-------AAGHLVSSASIDAVK 84
           L+DW+S        G+S+     +   +  L   D D+       A  HL    +   VK
Sbjct: 258 LVDWSSADMLAVALGKSIFLTNNNTNEVAQLAKTDDDYTSLSWVGAGSHLAVGQANGLVK 317

Query: 85  VFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSII 144
           +FD+    C+  I    +     L   + +L  G+     D  +   D+R  + P    I
Sbjct: 318 IFDVEKKRCIRTIPGHIDR-VACLSWNNHILTSGSR----DRRILHRDVRTPE-PCFEEI 371

Query: 145 DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQ 204
            +H  +V  +K++  D N L SG  D    +YD      +  L    + A++ +  W   
Sbjct: 372 RTHKQEVCGLKWN-VDENQLASGGNDNVVFVYD--GTSRKPILTLAEHTAAVKAMAWSPH 428

Query: 205 KR 206
           +R
Sbjct: 429 RR 430

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 73/168 (43%), Gaps = 11/168 (6%)

Query: 13  GSENW--CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70
           G   W  C+ +         TG ++  I++ +  SG+    +KA + ++ DL + +    
Sbjct: 113 GHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRH-- 170

Query: 71  AGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYI 130
             ++ S +    VK +D+  N  +   H    S   ++D    +    T   G D+ V +
Sbjct: 171 -PYMFSVSEDKTVKCWDLEKNTAIRNYHGHL-SGVHTVDIHPTVDVVVTA--GRDSVVKV 226

Query: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +DIR    P+ + +  H   +T ++  P D  V +S S D    ++DL
Sbjct: 227 WDIRT-RLPVMT-LPGHKGPITKVRCLPVDPQV-ISSSVDASIRLWDL 271

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 128 VYIYDIRRW---DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           + +YD+ R    + P+  I+  H   +    F+ S  N+++SG  DG   ++D++ D
Sbjct: 261 ISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGCVKVWDIRSD 317

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 7/116 (6%)

Query: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGL-LACGTELQGIDAAVYIYD 132
           L S+ S +++ ++D+RTN+   KI     +  +  +           E    D   Y YD
Sbjct: 228 LASTGSDNSIVLYDLRTNSPTQKIVQTMRTNSLCWNPMEAFNFVTANE----DQNSYYYD 283

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
           +R     L ++   H   V  + F P+   + ++GS D    IY++K     +  H
Sbjct: 284 MRYMSRAL-NVFKDHVSAVMDVDFSPTGQEI-VTGSYDKTIRIYNIKHGHSREIYH 337

>TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1508

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 26/161 (16%)

Query: 70   AAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGI-DAAV 128
            + G L+ +  +  ++V+D  + +    I  + +S   S+ S    LA  T + G  D ++
Sbjct: 1274 SKGSLLVTGDVKVIRVWDAHSESIEVDIPVKTSSLVTSITSDQ--LAGDTVVCGFSDGSI 1331

Query: 129  YIYD---------IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
             +YD         +R W    RS     H  +  +         L SG+TDG   ++D++
Sbjct: 1332 RVYDRRLNSRDAMVRLW----RSNEGKKHYPINYVHLQRGGFRELASGTTDGTVELWDIR 1387

Query: 180  QDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHE 220
              +        I   +I S    S+ RI T++ M+   +HE
Sbjct: 1388 NQDP-------ITSFNIGSSNQSSESRISTMTKMQ---LHE 1418

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 20/136 (14%)

Query: 61  DLKVIDSDF--AAGHLVSSASID-AVKVFDIRTNACVAKIHNEANSPFISLD---SRHGL 114
           D +V D  F   +  L +S   D +V+VFD+R+ A    I+    +P  + D    ++ L
Sbjct: 324 DSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNAL 383

Query: 115 LACGTELQGIDAAV-----------YIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNV 163
           L    E    DA V            I D+R  ++P+  +++ H   +  IK+HP+   +
Sbjct: 384 LRL--EPSPTDANVIATFVSESNKILILDMRNSESPVL-VLEGHKSAINQIKWHPTKRYI 440

Query: 164 LLSGSTDGYTNIYDLK 179
           LLS S D     +DL 
Sbjct: 441 LLSCSDDCQVLYWDLN 456

>YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {ON}
            SEC27Essential beta'-coat protein of the COPI coatomer,
           involved in ER-to-Golgi and Golgi-to-ER transport;
           contains WD40 domains that mediate cargo selective
           interactions; 45% sequence identity to mammalian
           beta'-COP
          Length = 889

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 15/156 (9%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASID-AVKVFD 87
           +LT L +G + L ++ +   ++ I+ +ET +   K I    A  + +   S D  ++VF+
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFI----ARKNWIIVGSDDFRIRVFN 83

Query: 88  IRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRRWDAPLRSII 144
             T   V     EA+  +I   + H     +  G++    D  V +++    +  L    
Sbjct: 84  YNTGEKVVDF--EAHPDYIRSIAVHPTKPYVLSGSD----DLTVKLWNWEN-NWALEQTF 136

Query: 145 DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           + H   V C+ F+P D +   SG  D    ++ L Q
Sbjct: 137 EGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQ 172

>TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {ON}
           Anc_8.631 YOR212W
          Length = 417

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G D   YI+DIR   A +++   S   DV  IK+  +D N +++GS DG  +++DL+ D 
Sbjct: 243 GSDGYAYIWDIRS-PAAVQNFFVSD-SDVNAIKYF-NDGNSIVTGSDDGIIHMFDLRADC 299

Query: 183 E 183
           E
Sbjct: 300 E 300

>Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {ON}
            YHR186C (REAL)
          Length = 1556

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKV 85
            L+T      I + DW  G++L K        T + DLK+I+ D +A  L++ +S   +K+
Sbjct: 1223 LVTADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDLKLINEDDSA-LLLTGSSDGVIKI 1281

Query: 86   F----DIRTNACVAKIHNEANSPFISLDSRH-GLLACGTELQG-IDAAVYIYDIRRWDAP 139
            +    D+     V+      +   + L  R  GLL    +++G +     +  IR WDA 
Sbjct: 1282 YRNFQDVDAFEIVSAWRGLTD---MLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAH 1338

Query: 140  LRSI-IDSHHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
              ++ +D      + I    +D    N+ ++G  DG   +YD + D  +  + +
Sbjct: 1339 TETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRR 1392

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 68/159 (42%), Gaps = 24/159 (15%)

Query: 72   GHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGI-DAAVYI 130
            G L+++  +  ++V+D  T      I  + +S   SL +    LA    + G  D ++ +
Sbjct: 1321 GSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQ--LAGNIFVAGFADGSLRV 1378

Query: 131  YD---------IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
            YD         IRRW    R+  +     +  +         L+SG+T+G   ++D++  
Sbjct: 1379 YDRRLDPRDSMIRRW----RAGNEKQGVWINNVHLQRGGYRELISGATNGVVELWDIR-- 1432

Query: 182  EEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHE 220
              ED +   ++       G  SQ +  T++ M+   +HE
Sbjct: 1433 -SEDPVQSFVDQNVTPQYG--SQLKPTTMTCMQ---VHE 1465

>NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {ON}
           Anc_4.77 YGR145W
          Length = 701

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDD----VTCIKFHPSDV 161
           +S++S +GL+A G E    +  V  +D R      +  +++  D+    VT   F    +
Sbjct: 186 VSVNSTNGLVATGME----ENVVEFWDPRSRSRVAKLFLENQFDNNAFQVTTTSFRNDGL 241

Query: 162 NVLLSGSTDGYTNIYDLKQDE 182
           N    G+++GYT +YDL+  E
Sbjct: 242 N-FACGTSNGYTYLYDLRSSE 261

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 7/116 (6%)

Query: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGL-LACGTELQGIDAAVYIYD 132
           L S+ S +++ ++D+RTN+   K+     +  +  +       A   E    D   Y YD
Sbjct: 232 LASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANE----DHNAYYYD 287

Query: 133 IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
           +R     L  +   H   V  + F P+   + ++GS D    I++LK     +  H
Sbjct: 288 MRNMSRALH-VFKDHVSAVMDVDFSPTGEEI-VTGSYDKTIRIFNLKHGHSREVYH 341

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 20/129 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G + S++  + +K++D R+  CV+ I          L  +H +L     
Sbjct: 209 DVKSCDWHPTMGLIASASKDNLIKLWDPRSGNCVSTI----------LKFKHTVLKTRFQ 258

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   + +HP + +V   G+ DG 
Sbjct: 259 PTKGNLLVAISKDKSCRVFDIRHSMKELMVVRD--EVDYMTLLWHPINESVFTVGNYDGS 316

Query: 173 TNIYDLKQD 181
              +D+ QD
Sbjct: 317 LKHFDILQD 325

>NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {ON}
           Anc_2.450 YKL121W
          Length = 993

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 91  NACVAKIHNEANSPFISLD-SRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHD 149
           N    K+  E  S  + LD S++  L   +    +D  V ++ I R  + LR+    H D
Sbjct: 387 NPICYKMFKEHKSDVLDLDWSKNNFLVTAS----MDKTVKLWHIDRATS-LRTF--RHQD 439

Query: 150 DVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
            VTC+ FHP D   ++SG  D    ++ +  +E
Sbjct: 440 FVTCVAFHPIDDRFIISGCLDHKCRLWSILDNE 472

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 74/159 (46%), Gaps = 25/159 (15%)

Query: 102 NSPFIS-LDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSD 160
           N+P I   D     L  GT+    D  VY++D+R     +   ++ H   +T +K+  S+
Sbjct: 434 NTPLIGGADCIDNALVTGTK----DGIVYLWDLRI--GRVVGSLEGHRGPITSLKYMGSE 487

Query: 161 VNVLLSGSTDGYTNIYDLKQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHE 220
              L++GS D  T I+DL+      ++ +++++          +K + ++   +T  I+ 
Sbjct: 488 ---LITGSMDKSTRIWDLRM----GSVAELLSF----------EKEVVSVEESQTQLINA 530

Query: 221 LNDKSDEFKEPRPADFGDIREAWNCDYVVDVYPGLIATG 259
           L  +  +  +     +  + +++N   +V VY  L+A G
Sbjct: 531 LEGEPVKIYDRGERQYNSLPDSFNTTTLV-VYESLLALG 568

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 80/195 (41%), Gaps = 53/195 (27%)

Query: 21  LQPSYKYGLLTGLSN--GEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           L  + + G+L+  +N   EI+L D ++ Q L  +     ++N  + ID       L++SA
Sbjct: 286 LAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDT----RLLASA 341

Query: 79  SIDA-VKVFDI----------RTNACVAKI--HNEANSPFISLDS-----------RHGL 114
             DA VKV+D+            N C+A    H ++ +   +  +           RH  
Sbjct: 342 GKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWD 401

Query: 115 LACGTELQGIDAAVYIYDIRR----------WDAPLRSIIDSHHDDVTCIKFHPSDVNVL 164
           L  G  +Q ID  + +  + +          ++ PL    D       CI       N L
Sbjct: 402 LGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGAD-------CID------NAL 448

Query: 165 LSGSTDGYTNIYDLK 179
           ++G+ DG   ++DL+
Sbjct: 449 VTGTKDGIVYLWDLR 463

>YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON}
           Protein of unknown function; transcription is activated
           by paralogous transcription factors Yrm1p and Yrr1p
           along with genes involved in multidrug resistance;
           mutant shows increased resistance to azoles; YMR102C is
           not an essential gene
          Length = 834

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 124 IDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           +D  V ++   R ++ L++ I  H D VTC++FHP+D    +SG  D    ++ +  DE
Sbjct: 297 MDKTVKLWHPDRKNS-LKTFI--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 17/166 (10%)

Query: 21  LQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASI 80
             P  K+ L TG  +  IR+ D  + + +  ++  E  I  L    S      LVS +  
Sbjct: 456 FSPDGKF-LATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPS---GDKLVSGSGD 511

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFISLDSRHG-LLACGTELQGIDAAVYIYD------I 133
             V+++D+R   C   +  E     +++    G L+A G+    +D  V I+D      +
Sbjct: 512 RTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGS----LDRTVRIWDSETGFLV 567

Query: 134 RRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
            R D+    +   H D V  + F   D + ++SGS D    +++L+
Sbjct: 568 ERLDSE-NELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSVKLWNLR 611

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 60/140 (42%), Gaps = 27/140 (19%)

Query: 69  FAAGHLVSSASIDAVKVFDIRTNACVAKIH----NEANSPFI-SLDSRHGLLACGTELQG 123
           F+  +L+S +    ++ +D+ +  CV  I     +  NS    +L SR   L    E Q 
Sbjct: 560 FSGDNLISGSQDRTIRQWDLNSGKCVQTIDINFASRVNSSTSGTLSSRSSTLLVPNE-QP 618

Query: 124 IDAAVYIYD-----------IRRWDAPLRS-----IIDSHHDDVTCIKFHPSDVNVLLSG 167
           +  A+  YD           +R WD  LRS      +  H D +T ++F   D   L++G
Sbjct: 619 VIGALQCYDAALATGTKDGLVRLWD--LRSGQVVRTLQGHTDAITSLQF---DSINLITG 673

Query: 168 STDGYTNIYDLKQDEEEDAL 187
           S D    I+DL+     DA 
Sbjct: 674 SIDRSIRIWDLRTGTLADAF 693

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 25  YKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVK 84
           Y   L TG  +G +RL D  SGQ ++ ++    +I  L+     F + +L++ +   +++
Sbjct: 626 YDAALATGTKDGLVRLWDLRSGQVVRTLQGHTDAITSLQ-----FDSINLITGSIDRSIR 680

Query: 85  VFDIRT 90
           ++D+RT
Sbjct: 681 IWDLRT 686

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           PLR I   H +DV C+ FHP+   V L+GS+D    ++D++
Sbjct: 618 PLR-IFAGHLNDVDCVTFHPNGTYV-LTGSSDKTCRMWDIQ 656

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 89/189 (47%), Gaps = 20/189 (10%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +GEI L   ++ + + + K S +  N+  + D  ++   
Sbjct: 291 EGFGLDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITE-KQSFSVGNNKSIEDIQWSKTE 349

Query: 74  --LVSSASIDA-VKVFDIRTNACVAKIHNEANSPFISL----DSRHGLLACGTELQGIDA 126
             + ++A  D  ++++D R+      I   A++  +++    +    LLA G      D 
Sbjct: 350 QTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGD-----DK 404

Query: 127 AVY-IYDIRRW-----DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
            V+ ++D+R++     +A   +  D H   +T I F+P D + +   S D    ++DL  
Sbjct: 405 GVWGVWDLRQFSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSV 464

Query: 181 DEEEDALHQ 189
           + +++ + Q
Sbjct: 465 EADDEEIKQ 473

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 8/79 (10%)

Query: 103 SPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVN 162
           SP  + +  +   +CG+     D  +Y++D+R         +     D+  ++F   D N
Sbjct: 241 SPSSAENGTNTFASCGS-----DGYIYLWDVRTGSVAQTFFV--SDSDINAVQFFK-DGN 292

Query: 163 VLLSGSTDGYTNIYDLKQD 181
            L SGS DG   ++DL+ D
Sbjct: 293 ALASGSDDGIIRLFDLRSD 311

>Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {ON}
           YMR102C (REAL)
          Length = 834

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 124 IDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           +D +V ++   R ++ L++ +  H D VTC++FHP+D    +SG  D    ++ +  DE
Sbjct: 296 MDKSVKLWHPDRKNS-LKTFV--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 351

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 72/162 (44%), Gaps = 11/162 (6%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSS 77
           C+++ P       TG ++  I++ D  SG+    +     ++ DL + +      ++ S+
Sbjct: 127 CVEVDPVDNAWYATGSNDTSIKVWDLASGKLKLTLSGHIMTVRDLAISERH---PYMFSA 183

Query: 78  ASIDAVKVFDIRTNACVAKIHNEANSPF-ISLDSRHGLLACGTELQGIDAAVYIYDIRRW 136
           +    +K +D+  N  +   H   +    +SL     L+       G D+ V ++D+R  
Sbjct: 184 SEDKTIKCWDLEKNMVIRNYHGHLSGVHTVSLHPTLDLVVSA----GRDSVVKLWDMRT- 238

Query: 137 DAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
             P+ ++I  H   +  ++  P D  + +S STD    ++D+
Sbjct: 239 RVPVMNLI-GHKSPINKVRCLPVDPQI-ISCSTDANIRLWDI 278

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 12/83 (14%)

Query: 98  HNEANSPFI-SLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKF 156
           H+EA  P I SL      LA GT+    D  + ++D+R     +  I++ H D +T +KF
Sbjct: 517 HSEA--PTIGSLQCFESALASGTK----DGLIRLWDLR--SGKVIRILEGHTDAITSLKF 568

Query: 157 HPSDVNVLLSGSTDGYTNIYDLK 179
              D+  L++GS D    I+D++
Sbjct: 569 ---DMTNLITGSLDKNIRIWDMR 588

>NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106
          Length = 817

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 136 WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184
           W  PL S+ + H   VTC+KF P D   L SGS D    I+ L +D ++
Sbjct: 67  WKTPLCSM-NRHAGSVTCVKFSP-DGKYLASGSDDRILLIWTLDEDHQQ 113

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 75/168 (44%), Gaps = 16/168 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + +LT L +G+I + ++ + Q ++ I  +ET +   + I    A  + +   
Sbjct: 19  IDFHPSEPW-VLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFI----ARKNWIVVG 73

Query: 79  SID-AVKVFDIRTNACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVYIYDIR 134
           S D  +++F+  T   ++    EA+  +I   + H     +  G++    D  V +++  
Sbjct: 74  SDDFRLRIFNYNTGEKISDF--EAHPDYIRSIAVHPTKPYVITGSD----DLTVKLWNWE 127

Query: 135 RWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           + +  L    + H   V  + F+P D N   SG  D    ++ L Q +
Sbjct: 128 K-NWALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQ 174

>Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] {ON}
            YHR186C (REAL)
          Length = 1555

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 29   LLTGLSNGEIRLLDWNSGQSLQKIKASE---TSINDLKVIDSDFAAGHLVSSASIDAVKV 85
            L+T      I + DW  G++L K        T + DLK I+ D +A  L++ +S   +K+
Sbjct: 1222 LVTADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDLKFINEDDSA-LLLAGSSDGVIKI 1280

Query: 86   F----DIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQG-IDAAVYIYDIRRWDAPL 140
            +    DI     V+      +   +      GLL    +++G +     +  IR WDA  
Sbjct: 1281 YRNYHDIDNFEIVSAWRGLTD--MLLTPRSTGLLTEWLQIRGSLLTTGDVKIIRVWDAHT 1338

Query: 141  RSI-IDSHHDDVTCIKFHPSDV---NVLLSGSTDGYTNIYDLKQDEEEDALHQ 189
             ++ +D      + I    +D    N+ ++G  DG   +YD + D  +  + +
Sbjct: 1339 ETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRR 1391

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 70/159 (44%), Gaps = 24/159 (15%)

Query: 72   GHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGI-DAAVYI 130
            G L+++  +  ++V+D  T      I  + +S   SL +    LA    + G  D ++ +
Sbjct: 1320 GSLLTTGDVKIIRVWDAHTETVEVDIPAKTSSLITSLTADQ--LAGNIFVAGFADGSLRV 1377

Query: 131  YD---------IRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
            YD         IRRW    R+  +     +  +         L+SG+T+G   ++D++  
Sbjct: 1378 YDRRLDPRDSMIRRW----RAGNEKQGVWINNVHLQRGGYRELVSGATNGVVELWDIR-- 1431

Query: 182  EEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHE 220
              ED +   ++   +   G  SQ++  T++ M+   +HE
Sbjct: 1432 -SEDPVESFVDQNVVSQYG--SQQKPTTMTCMQ---VHE 1464

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 126 AAVYIYDIRRWDAPLRSIIDS---HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
             + IYDI + +   +++I S   H   V    F+  D N+L+SG  DG   I+DL+   
Sbjct: 203 TVISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGS 262

Query: 183 EEDALHQVINYA----SIHSCGWL 202
              +    IN      SI    W+
Sbjct: 263 LNGSTRSDININTASDSIRDVKWM 286

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 126 AAVYIYDIRR---WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
             + IYDI R    + PL S    H   +    F+    N+++SG  DG   I+DL+ +
Sbjct: 202 TVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCIKIWDLRSN 260

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 11/154 (7%)

Query: 36  GEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDA-VKVFDIRTNACV 94
           G++ + +W S   + K +    S N L         G  V +AS D  +KV+DI +  C+
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPD----GSRVVTASEDGKIKVWDITSGFCL 380

Query: 95  AKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
           A      +S      ++ G +   + L   D  V  +D+ R+    R+   +      C+
Sbjct: 381 ATFEEHTSSVTAVQFAKRGQVMFSSSL---DGTVRAWDLIRY-RNFRTFTGTERIQFNCL 436

Query: 155 KFHPSDVNVLLSGSTDGY-TNIYDLKQDEEEDAL 187
              PS   V+ +GS D +  +++ ++  +  DAL
Sbjct: 437 AVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 469

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC--- 117
           D+K  D     G + S++  + VK++D R+  C++ I          L  +H +L     
Sbjct: 221 DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI----------LKFKHTVLKTRFQ 270

Query: 118 ---GTELQGI--DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGY 172
              G  L  I  D +  ++DIR     L  + D    D   +++HP + ++      DG 
Sbjct: 271 PTKGNLLMAISKDKSCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGS 328

Query: 173 TNIYDLKQDEEEDALHQVINYA 194
              +DL Q+  E  L   I YA
Sbjct: 329 LKHFDLLQNLNEPIL--TIPYA 348

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           G D  VY++D R   +     +     D++ ++F  SD N +++GS DG   ++DL+ D 
Sbjct: 242 GSDGYVYLWDTRSPSSVQNFFVS--DSDISTVRFF-SDGNSIITGSDDGIARLFDLRSDC 298

Query: 183 E 183
           E
Sbjct: 299 E 299

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 9/120 (7%)

Query: 73  HLVSSASIDAVKVFDIRTNACVAKIHNE-ANSPFISLDSRHGLLACGTELQGIDAAVYIY 131
           +L++S+   +VK++D +T +CVA +    AN  +        ++  G+E    D  V I+
Sbjct: 200 YLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSE----DGTVKIW 255

Query: 132 DIRRWDAPLRSIIDSHHDDVTCIKFHPS-DVNVLLSGSTDGYTNIYDLKQDEEEDALHQV 190
           +   +   L   ++   +   C+  HP+   N + SG  +G+ N+  +  DE   +L  V
Sbjct: 256 NANTYK--LEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGF-NVLSMGNDEPRLSLDPV 312

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           PLR I   H +DV C+ FHP+   V L+GS+D    ++D++
Sbjct: 603 PLR-IFAGHLNDVDCVAFHPNGTYV-LTGSSDKTCRMWDIQ 641

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 228 FKEPRPADFGDIREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIP 287
           FKE     FGD  + +NC   V VY G+ +TGKT    G+ +L  + DE  D+    +IP
Sbjct: 85  FKEIAEPLFGDFLKGYNC--TVLVY-GMTSTGKTYTMTGDEKL--YNDELSDSAG--IIP 137

Query: 288 R 288
           R
Sbjct: 138 R 138

>Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {ON}
           YMR102C (REAL)
          Length = 837

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 147 HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           H D VTC++FHP+D    +SG  D    ++ +  DE
Sbjct: 319 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 354

>Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {ON}
           YMR102C (REAL)
          Length = 843

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 147 HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182
           H D VTC++FHP+D    +SG  D    ++ +  DE
Sbjct: 320 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 355

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 87/190 (45%), Gaps = 21/190 (11%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +G++ L   ++ + +   K   T  N+  V D  ++   
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISD-KEPFTVANNQSVEDIQWSRTE 342

Query: 74  --LVSSASIDA-VKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGIDA 126
             + +S   D  ++V+D R+      I  +A++     IS   + G LLA G +    + 
Sbjct: 343 STVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----NG 398

Query: 127 AVYIYDIRRWD-------APLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
              ++D+R++        +P+    D H   +T I F+P D +++   S D    ++DL 
Sbjct: 399 TWGVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 457

Query: 180 QDEEEDALHQ 189
            + +++ + Q
Sbjct: 458 VEADDEEIKQ 467

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 247 YVVDVYPGLIATGKTQEG--AGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISALQ 304
           Y +D  P LI TG    G  +G++ L      K  ++ E        ++ V D+  S  +
Sbjct: 286 YALDWSP-LIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFT--VANNQSVEDIQWSRTE 342

Query: 305 SDLLYSCGEDGFVKIW 320
           S +  SCG DG++++W
Sbjct: 343 STVFASCGCDGYIRVW 358

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 128 VYIYDIRR---WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
           + IYDI +    D PL +    H   V    F+ +  ++L+SG  DG   I+DL+ +
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLRSN 264

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 84/188 (44%), Gaps = 18/188 (9%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +G + L   ++ + +   K   T  N+  + D  ++   
Sbjct: 281 EGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTD-KTPFTVGNNKSIEDIQWSRTE 339

Query: 74  --LVSSASIDA-VKVFDIRTN---ACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAA 127
             + ++A  D  ++++D R+      ++ + +  +   IS + + G L       G D  
Sbjct: 340 STVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLAS----GDDKG 395

Query: 128 VY-IYDIRRWDAPLRSII-----DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
            + I+D+R++       +     D H   +T I F+P D +++   S D    ++DL  +
Sbjct: 396 TWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVE 455

Query: 182 EEEDALHQ 189
            +++ + Q
Sbjct: 456 ADDEEIKQ 463

>KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.717
           YOR269W
          Length = 471

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 18  CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVI----DSDFAAGH 73
           CL ++  Y   LLTG  +  +RL  W SG ++      E  I  +K +    D+     H
Sbjct: 284 CLDVRGEY---LLTGSQDTSLRLTHWPSGNAISMGLGHEFPIETVKFLPPLCDTTMPVTH 340

Query: 74  LVSSASIDAVKVFDI 88
            VS+   D +K++++
Sbjct: 341 CVSAGRDDVIKLWEL 355

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 16/163 (9%)

Query: 19  LKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSA 78
           +   PS  + L+  L +  I+L D+  G  L + +  E  +   + +D        VS+ 
Sbjct: 17  IAFHPSRPWALV-ALFSSTIQLWDYRMGTLLHRFEDHEGPV---RSVDFHPTQPLFVSAG 72

Query: 79  SIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDA 138
               +KV+ + TN C+  +          LD    +     EL  I +A     IR W+ 
Sbjct: 73  DDCTIKVWSLETNKCLYTLTGH-------LDYVRTVF-FHHELPWIISASDDQTIRIWNW 124

Query: 139 PLRSIIDS---HHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
             R  I +   H+  V C +FHP++ ++++S S D    ++D+
Sbjct: 125 QNRKEIANLIGHNHFVMCAQFHPTE-DLVVSASLDETVRVWDI 166

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 72/332 (21%), Positives = 137/332 (41%), Gaps = 80/332 (24%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKV-----IDSDFAAGH--LVSSASID 81
           + +G  +G I+  D +S + +   KA   +I  L +     IDS  +     ++SS+   
Sbjct: 83  IASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSSSDDK 142

Query: 82  AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLA---CGTELQGIDAA----------- 127
            VK++ +  +   A + N+       +++ +GL+         QG+D +           
Sbjct: 143 TVKLWSV-NHEDFAHVDNDQ-----VINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGP 196

Query: 128 -VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDA 186
            + ++DI R   PL S +    D++  +KF+ +D NVL S  +D    +YDL+ +    A
Sbjct: 197 RINLWDINR-SKPL-SDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNS---A 251

Query: 187 LHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREAWNC- 245
             +++    ++S  W         + ME F     ++  + +      D  ++  A N  
Sbjct: 252 TQKIVQTMRVNSMCW---------NPMEAFNFVVASEDHNAYY----YDMRNMSRALNVF 298

Query: 246 -DYV-----VDVYPGLIATGK---TQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEV-- 294
            D+V     VD+ P    TG+   T      +R+ P             I + H  E+  
Sbjct: 299 KDHVSAVMDVDISP----TGEEVVTASYDKTIRIFP-------------INKGHSREIYH 341

Query: 295 ---VRDVFISALQSDLLY--SCGEDGFVKIWK 321
              ++ VF +    D  Y  S  +DG V++W+
Sbjct: 342 TKRMQHVFQAKFSMDSKYVMSGSDDGNVRLWR 373

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 11/154 (7%)

Query: 36  GEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDA-VKVFDIRTNACV 94
           G++ + +W S   + K +    S N L         G  V +AS D  +KV+DI +  C+
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPD----GSRVVTASDDGKIKVWDITSGFCL 378

Query: 95  AKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCI 154
           A      +S      ++ G +   + L   D  V  +D+ R+    R+   +      C+
Sbjct: 379 ATFEEHTSSVTAVQFAKRGQVMFSSSL---DGTVRAWDLIRY-RNFRTFTGTERIQFNCL 434

Query: 155 KFHPSDVNVLLSGSTDGY-TNIYDLKQDEEEDAL 187
              PS   V+ +GS D +  +++ ++  +  DAL
Sbjct: 435 AVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 467

>Smik_14.235 Chr14 (431155..432357) [1203 bp, 400 aa] {ON} YNL092W
           (REAL)
          Length = 400

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query: 216 FAIHELNDKSDEFKEPRPADFGDIREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRD 275
           +A+  +N  S+E  +P   D         C  +  VY    A   ++      RL+PF  
Sbjct: 79  YAMQSINLASEEIVQPNNLDMSK-----TCSLLTQVYREWSAEAISERSCLHSRLVPFLK 133

Query: 276 EKVDAENEIVIPRAHGDEVVRDV 298
            +V +E +I+IP      ++ D+
Sbjct: 134 AEVPSEADILIPGCGTGRLLVDL 156

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 19/86 (22%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSI---------IDSHHDDVTCIKF 156
           +S++  +GLLA GTE   ++          WD   RS          ID+    VT   F
Sbjct: 186 VSINEVNGLLAAGTETNVVEF---------WDPRSRSRVSKLYLENNIDNRPFQVTTTSF 236

Query: 157 HPSDVNVLLSGSTDGYTNIYDLKQDE 182
             +D      G+++GY+ IYDL+  E
Sbjct: 237 R-NDGLTFACGTSNGYSYIYDLRTSE 261

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           PLR I   H +DV C+ FHP+   V  +GSTD    ++D+
Sbjct: 552 PLR-IFAGHLNDVDCVSFHPNGTYV-FTGSTDKTCRMWDI 589

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 59/143 (41%), Gaps = 12/143 (8%)

Query: 43  WNSGQSLQKIKA--SETSINDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNE 100
           W    S Q +K   S T I    V   DFA    V+S++   V++F  RT   +      
Sbjct: 27  WRQYSSAQLVKEHNSVTHIAFNPVHPHDFA----VTSST--RVQLFSSRTRQVIKTFSRF 80

Query: 101 ANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSD 160
            +  + +     G L C  +  G+   V +YD     A L SI  S H      KFH  D
Sbjct: 81  KDVVYSASFRNDGKLLCAGDATGL---VSVYDSYNPRALLVSINASTHP-THVTKFHSHD 136

Query: 161 VNVLLSGSTDGYTNIYDLKQDEE 183
              L++ S D  T ++D+ Q  E
Sbjct: 137 SKSLVTASDDRITRVWDISQSYE 159

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVID-------SDFAAGHLVSSASID 81
           L TG ++G I+  + ++ +     KA    I  L V         SD+   + + S S D
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHDKKSDWKNQNFMLSCSDD 142

Query: 82  -AVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC---GTELQGID------------ 125
             VK++ I     V    N+ +S   S+ +  GL+      +  QGID            
Sbjct: 143 KTVKLWSIN----VDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGIDSHRENSTFATGG 198

Query: 126 AAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEED 185
           A ++++D+ R   P+ S +    D++T ++F+ ++ ++L S  +D    +YDL+ +    
Sbjct: 199 AKIHLWDVNRL-KPI-SNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 186 ALHQVINYASI 196
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLL 165
           ISL+    LLA G    G D +  ++DI   D P++  +  H   V  I F P   ++L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 166 SG 167
           +G
Sbjct: 64  TG 65

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 106 ISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLL 165
           ISL+    LLA G    G D +  ++DI   D P++  +  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 166 SG 167
           +G
Sbjct: 452 TG 453

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 129 YIYDIRRWDAP--LRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           YI     W AP  L+ +I+ H   V C+   P D    ++GS D    I+DL +
Sbjct: 101 YISQRPEWHAPWKLKRVINGHLGWVRCVAVDPIDNEWFVTGSNDATIKIWDLAK 154

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 83/191 (43%), Gaps = 29/191 (15%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDF--------AAGHLVSSASI 80
           L TG ++G I+  + ++ +     KA    +  L V    F        +   ++S +  
Sbjct: 83  LATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDD 142

Query: 81  DAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLAC---GTELQGID------------ 125
             VK++ I     V    N+ +S   S+ +  GL+      +  QGID            
Sbjct: 143 KTVKLWSIN----VDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGG 198

Query: 126 AAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEED 185
           A ++++D+ R   P+ S +    D++T +KF+ ++ ++L S  +D    +YDL+ +    
Sbjct: 199 AKIHLWDVNRL-KPV-SDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 186 ALHQVINYASI 196
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 65/160 (40%), Gaps = 9/160 (5%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASIDAVKVFDI 88
            +TG    +I L D N  + +  +     +I  +K   ++     L S+ S +A+ ++D+
Sbjct: 187 FVTG--GAQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVDI--LASTGSDNAIVLYDL 242

Query: 89  RTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHH 148
           RTN+   KI     +  I  +    + A    +   D   Y YD+R     L  +   H 
Sbjct: 243 RTNSPTQKIIQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSRALH-VFKDHV 298

Query: 149 DDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALH 188
             V  + F P+  + +++GS D    I+        +  H
Sbjct: 299 SAVMDVDFSPTG-DEIVTGSYDKTIRIFKTNHGHAREVYH 337

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 121 LQGID----AAVYIY---DIRRWDAPLRSIIDS---HHDDVTCIKFHPSDVNVLLSGSTD 170
            QGID    A+ ++     I  WD+     I +     D++T +KF+ ++V++L S  +D
Sbjct: 175 FQGIDHHREASTFVTGGAQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVDILASTGSD 234

Query: 171 GYTNIYDLKQDEEEDALHQVINYASI 196
               +YDL+ +     + Q +   +I
Sbjct: 235 NAIVLYDLRTNSPTQKIIQTMRTNAI 260

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 73/170 (42%), Gaps = 15/170 (8%)

Query: 13  GSENW--CLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70
           G   W  C+++ P       TG ++  I++ D  SG+    +     ++ D+ + +    
Sbjct: 109 GHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKITLSGHAMTVRDIAISNRH-- 166

Query: 71  AGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYI 130
             +L S++     K +D+  N  +   H    S   ++D    L    T   G D+ V +
Sbjct: 167 -PYLFSASEDKLAKCWDLEKNTAIRDYHGHL-SGVHTVDIHPTLDLIATA--GRDSVVKL 222

Query: 131 YDIRRWDAPLRSII--DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           +DIR    P+ ++I   S  + V C+  +P     ++S S D    ++D+
Sbjct: 223 WDIRS-RVPVVTLIGHKSPINKVHCLPVNPQ----VISSSVDATIRLWDI 267

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 136 WDAP--LRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178
           W AP  L  +I  H+  V C++  P D     +GS D    I+DL
Sbjct: 97  WHAPWKLMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDL 141

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 15  ENWCLKLQPSYKYG-LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGH 73
           E + L   P  K G LLTG  +G+I L   N+ + +   K   T  N+  V D  ++   
Sbjct: 280 EGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTD-KQPFTVGNNKSVEDIQWSRTE 338

Query: 74  LVSSASIDA---VKVFDIRTNACVAKIHNEANSP---FISLDSRHG-LLACGTELQGIDA 126
               AS      V+++D R+      +  +A++     IS + + G LLA G +    + 
Sbjct: 339 ATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDD----NG 394

Query: 127 AVYIYDIRRWDA-------PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLK 179
           +  ++D+R++         P+    D H   +T I F+P + +++   S D    ++DL 
Sbjct: 395 SWGVWDLRQFTPDNINNVQPVAQY-DFHKGAITSISFNPLEESIIAVASEDNTVTLWDLS 453

Query: 180 QDEEEDALHQ 189
            + +++ + Q
Sbjct: 454 VEADDEEIKQ 463

>Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii AER337W
          Length = 445

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 12/119 (10%)

Query: 67  SDFAAGHLVSSASIDAVKVFDIRTNACV-AKIHNEANSPFISLDSRHGLLACGTELQGID 125
           +D   G+ VS   +  +K +D+ T+ CV  K  + +    + + +R  LLACG+  + I 
Sbjct: 283 NDSTVGYSVSQDHM--IKTWDLVTSRCVDTKTTSYSLLSIVEMPARR-LLACGSSARHI- 338

Query: 126 AAVYIYDIRRWDAPLRSI---IDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181
               I    R D+  + I   +  H++ V  +   P +  +L SGS DG   ++D++ D
Sbjct: 339 ----ILHDPRMDSSSKIIQKQLIGHNNFVVSLDTCPENEYMLCSGSHDGTVRVWDVRSD 393

>Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa]
           {ON} YGL137W (REAL)
          Length = 887

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 67/156 (42%), Gaps = 15/156 (9%)

Query: 29  LLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAAGHLVSSASID-AVKVFD 87
           +LT L +G + + ++ +   ++ I+ +ET +   K I    A  + +   S D  ++VF+
Sbjct: 22  VLTTLYSGRVEIWNYETQIEVRSIQVTETPVRAGKFI----ARKNWIIVGSDDFRIRVFN 77

Query: 88  IRTNACVAKIHNEANSPFISLDSRHG---LLACGTELQGIDAAVYIYDIRRWDAPLRSII 144
             T   V     EA+  +I   + H     +  G++    D  V +++    +  L    
Sbjct: 78  YNTGEKVVDF--EAHPDYIRSIAVHPTKPYVLSGSD----DLTVKLWNWEN-NWALEQTF 130

Query: 145 DSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180
           + H   V C+ F+P D     SG  D    ++ L Q
Sbjct: 131 EGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQ 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,295,458
Number of extensions: 2042635
Number of successful extensions: 9223
Number of sequences better than 10.0: 510
Number of HSP's gapped: 9352
Number of HSP's successfully gapped: 575
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)