Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.2112.152ON61761729780.0
Suva_14.2192.152ON61761728350.0
YNL121C (TOM70)2.152ON61761728180.0
Smik_14.2072.152ON61761727740.0
Kpol_1048.212.152ON59754619630.0
SAKL0E10956g2.152ON60055319160.0
KLTH0B05170g2.152ON59354719010.0
ZYRO0G06512g2.152ON60454418880.0
TDEL0B051402.152ON59954618780.0
Kwal_33.147672.152ON59454918730.0
NCAS0G024802.152ON59654118340.0
TPHA0I015102.152ON60355118110.0
TBLA0C055302.152ON61055118040.0
Ecym_82042.152ON59754417590.0
KLLA0F24046g2.152ON60454417560.0
NDAI0F028102.152ON60955017460.0
ABR131W2.152ON59454417450.0
NCAS0B070102.152ON62555917060.0
KNAG0H035302.152ON61456316980.0
CAGL0L12936g2.152ON60054416930.0
KAFR0F007202.152ON60854416370.0
CAGL0L04048g2.152ON58755615610.0
YHR117W (TOM71)2.152ON63955814970.0
Skud_8.1782.152ON63855614910.0
Smik_8.1952.152ON63555014840.0
Suva_15.3142.152ON64455614820.0
NDAI0B043402.152ON66455514240.0
NCAS0G008105.617ON584861539e-10
TBLA0E033005.617ON582851521e-09
AEL224W5.617ON580851474e-09
KLLA0A07062g5.617ON581861466e-09
Suva_8.805.617ON586851441e-08
Kwal_55.199355.617ON593861431e-08
YOR027W (STI1)5.617ON589851431e-08
ACR005W6.21ON3271241401e-08
SAKL0G07084g5.617ON585851422e-08
CAGL0H08195g5.617ON583851422e-08
Skud_15.1925.617ON589881412e-08
NDAI0B057903.481ON5231441412e-08
KNAG0B032005.617ON579851403e-08
NCAS0A112003.367ON9072491386e-08
Smik_15.2055.617ON589851377e-08
Kpol_1032.86.21ON3431081348e-08
Kpol_1018.695.617ON590851332e-07
TPHA0D028805.617ON585851323e-07
KLTH0F14542g3.481ON5131031314e-07
NDAI0F009105.617ON583851304e-07
TDEL0A048405.617ON576851271e-06
SAKL0E01210g6.21ON3231151213e-06
Ecym_30256.21ON3181251204e-06
Kwal_55.211753.481ON5111031207e-06
ZYRO0A05676g5.617ON572861199e-06
TDEL0C050903.367ON7592611191e-05
KAFR0C058905.617ON575851181e-05
TPHA0J003406.21ON3381071161e-05
KNAG0A079003.481ON5121321172e-05
Ecym_55825.617ON584851172e-05
Ecym_44133.481ON510951172e-05
KLLA0D01155g6.21ON335681152e-05
KLTH0E02178g5.617ON593861163e-05
Kpol_1006.43.367ON7322501153e-05
NDAI0I022406.21ON350881143e-05
AAR083C3.481ON5382081135e-05
NCAS0H008306.21ON3381531116e-05
CAGL0D05060g3.481ON5101021126e-05
KAFR0H008703.367ON8872201136e-05
Kpol_1037.266.21ON3421191108e-05
TBLA0A072706.21ON3731031108e-05
TDEL0G044806.21ON3431171109e-05
KNAG0H006103.367ON9731191082e-04
SAKL0F03102g3.481ON5131431072e-04
TBLA0C039503.481ON5121051063e-04
KAFR0L004106.21ON3311071053e-04
TPHA0D032203.481ON5131021063e-04
Kpol_505.413.481ON5131051063e-04
NDAI0D008106.21ON3491011054e-04
Kwal_27.118908.506ON3341261044e-04
NCAS0F034903.481ON512971045e-04
KLLA0B09966g8.506ON370981037e-04
Kpol_1018.1067.412ON7531681030.001
ZYRO0F08624g8.506ON3791631010.001
KAFR0B066103.481ON511971020.001
CAGL0E02739g6.21ON343841000.001
TDEL0E027505.352ON5641281000.002
Kwal_56.224336.21ON322102980.002
KLLA0B10912g3.481ON51295990.002
KNAG0M011706.21ON339108980.002
CAGL0C01903g7.412ON769168980.004
NCAS0D026706.21ON351172960.004
TBLA0D004607.412ON835116960.006
TPHA0D038606.328ON12071890.006
Smik_2.367.412ON751168960.007
KNAG0I025206.328ON11790880.007
YBL084C (CDC27)7.412ON758168950.007
KNAG0F040107.546ON1418125960.008
ZYRO0C07788g6.21ON334148940.008
Suva_15.1826.21ON34698940.008
Kpol_513.28.506ON37497940.008
Ecym_20906.328ON17259900.009
Suva_7.4083.481ON51395930.012
Skud_2.2828.506ON38587920.012
TBLA0G010506.21ON35084920.013
SAKL0H10934g8.506ON380204920.014
YBR155W (CNS1)8.506ON38587920.014
TBLA0H015203.367ON689169930.015
Ecym_71427.412ON675147920.017
NCAS0A00490singletonON62086920.018
TDEL0B013108.506ON380126910.018
Skud_15.1686.21ON34865910.019
KNAG0B022407.412ON739119910.021
KLTH0E11748g8.506ON37897900.022
KLTH0C11220g6.21ON327115900.024
AGL294W7.412ON65669900.026
TPHA0E007407.412ON746168910.027
TBLA0H033808.506ON37587900.027
Smik_2.2958.506ON385134900.028
YGR123C (PPT1)3.481ON513103900.029
YOR007C (SGT2)6.21ON34665890.031
NCAS0E024907.412ON809268900.033
TPHA0E011105.352ON693125890.040
NDAI0E040407.412ON783134880.053
KAFR0C018505.352ON646122880.055
KAFR0J025706.328ON12137820.056
KAFR0E029808.506ON38097870.060
Smik_15.1766.21ON34565860.062
Smik_6.2153.481ON51395870.069
YBR112C (CYC8)3.367ON966111870.074
TBLA0I023106.328ON11661800.084
NCAS0F028705.352ON700125860.090
Smik_4.5795.352ON667162860.093
Smik_2.2543.367ON1020111850.13
TPHA0G002407.546ON1430375850.14
Skud_2.247.412ON769168840.16
TDEL0C027207.412ON70092840.16
KLTH0G00660g3.570ON38394830.16
KLTH0C06204g7.412ON627161840.16
ZYRO0B04224g3.481ON51395840.16
Kpol_1050.1127.546ON136058840.17
CAGL0H07425g8.506ON38098830.17
Kwal_27.107407.412ON628161830.18
Suva_4.4058.506ON38583820.21
CAGL0G10087g7.546ON141195830.24
Skud_3.1356.328ON11887770.25
AGL268C8.506ON37987820.26
YCR060W (TAH1)6.328ON11170760.26
NDAI0A051003.367ON1007114820.32
YLR072W8.14ON69393810.33
KAFR0B002507.546ON1420117820.34
ACR168W2.665ON70778810.36
TBLA0B049907.546ON1410386810.37
NCAS0C043503.5ON1087187810.39
NDAI0I004406.328ON12860760.41
Skud_7.4323.481ON51391800.42
KNAG0A039508.506ON38689790.50
Ecym_56372.665ON71778800.53
NCAS0B024008.506ON38097790.54
Smik_12.1328.14ON69681790.62
KLTH0E10934g8.470ON56892790.67
KNAG0C055005.352ON585125780.76
Kpol_1028.516.328ON11763730.77
Suva_8.1295.689ON74135770.96
ZYRO0B03828g7.412ON727120771.0
AAR054C6.328ON13361731.1
KLLA0B09262g3.367ON941108771.2
KAFR0D023405.689ON69744771.2
Suva_3.956.328ON11170711.4
Ecym_25598.506ON37087751.4
Kpol_339.135.352ON686178761.4
NDAI0C043205.352ON706132761.5
CAGL0K09240g6.328ON14271721.5
YDR320C (SWA2)5.352ON668111761.6
Suva_2.347.412ON76367751.8
Ecym_55648.231ON161474751.9
Kpol_1014.323.5ON1084141751.9
NDAI0G037103.5ON112197742.5
Skud_15.2455.689ON75035742.5
CAGL0D01364g3.367ON1148107742.7
TDEL0D055703.489ON649126742.7
SAKL0B07986g3.367ON880105742.7
Suva_16.5217.546ON142473742.9
YPR189W (SKI3)7.546ON143273742.9
SAKL0D03564g3.265ON908169733.0
Ecym_34593.367ON1115112733.1
KLTH0A00638g7.546ON1411112733.1
Kwal_34.160921.456ON39582733.1
TBLA0B079705.72ON68767733.3
SAKL0A01672g6.328ON12862693.3
Kwal_27.117378.470ON57592733.4
TBLA0F012303.367ON1189107733.7
Kwal_23.54087.546ON141072733.8
Smik_2.1783.265ON90075733.8
KNAG0K026303.5ON1076179725.0
TPHA0M016303.367ON1043123725.0
ADL344W3.367ON910105716.2
CAGL0B01375g3.5ON1110182716.4
Kpol_1057.142.665ON72478706.6
TDEL0B023305.689ON70235707.1
KLLA0E20857g7.412ON710254707.8
Skud_12.1378.14ON698102708.0
TBLA0H019705.352ON840121708.3
CAGL0A03630g1.88ON106273708.6
Suva_2.4895.352ON659112698.6
YBR055C (PRP6)3.265ON89975698.9
TPHA0M002706.21ON37766699.4
AGR398W3.5ON1057916910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.211
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...  1151   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...  1096   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...  1090   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...  1073   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   760   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   742   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   736   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   731   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   728   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   726   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   711   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   702   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   699   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   682   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   681   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   677   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   676   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   661   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   658   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   656   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   635   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   605   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   581   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   578   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   576   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   575   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   553   0.0  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    64   9e-10
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    63   1e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    61   4e-09
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    61   6e-09
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    60   1e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    60   1e-08
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    60   1e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    59   1e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    59   2e-08
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    59   2e-08
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    59   2e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   2e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    59   3e-08
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    58   6e-08
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    57   7e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    56   8e-08
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    56   2e-07
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    55   3e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    55   4e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     55   4e-07
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    54   1e-06
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    51   3e-06
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    51   4e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    51   7e-06
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    50   9e-06
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    50   1e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    50   1e-05
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    49   1e-05
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    50   2e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    50   2e-05
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    50   2e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    49   2e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   3e-05
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    49   3e-05
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    49   3e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    48   5e-05
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    47   6e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    48   6e-05
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    48   6e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    47   8e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    47   8e-05
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    47   9e-05
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    46   2e-04
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    46   2e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   3e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    45   3e-04
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    45   3e-04
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    45   3e-04
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    45   4e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    45   4e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    45   5e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    44   7e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    44   0.001
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    44   0.001
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    44   0.001
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    43   0.001
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    43   0.002
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    42   0.002
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    43   0.002
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    42   0.002
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    42   0.004
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    42   0.004
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    42   0.006
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.006
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    42   0.007
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    39   0.007
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    41   0.007
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    42   0.008
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    41   0.008
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    41   0.008
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    41   0.008
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    39   0.009
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    40   0.012
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.012
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    40   0.013
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    40   0.014
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    40   0.014
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    40   0.015
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    40   0.017
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       40   0.018
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    40   0.018
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    40   0.019
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    40   0.021
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    39   0.022
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    39   0.024
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    39   0.026
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.027
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    39   0.027
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.028
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    39   0.029
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    39   0.031
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    39   0.033
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    39   0.040
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    39   0.053
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    39   0.055
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    36   0.056
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    38   0.060
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    38   0.062
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    38   0.069
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.074
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.084
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    38   0.090
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    38   0.093
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    37   0.13 
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    37   0.14 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    37   0.16 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    37   0.16 
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    37   0.16 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    37   0.16 
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    37   0.16 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    37   0.17 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    37   0.17 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.18 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    36   0.21 
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    37   0.24 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    34   0.25 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    36   0.26 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    34   0.26 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    36   0.32 
YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of...    36   0.33 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    36   0.34 
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    36   0.36 
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    36   0.37 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    36   0.39 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    34   0.41 
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    35   0.42 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    35   0.50 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    35   0.53 
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    35   0.54 
Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072...    35   0.62 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    35   0.67 
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    35   0.76 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.77 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    34   0.96 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    34   1.0  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    33   1.1  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    34   1.2  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    34   1.2  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    32   1.4  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    33   1.4  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    34   1.4  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    34   1.5  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    32   1.5  
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    34   1.6  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    33   1.8  
Ecym_5564 Chr5 (1147940..1152784) [4845 bp, 1614 aa] {ON} simila...    33   1.9  
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    33   1.9  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    33   2.5  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    33   2.5  
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    33   2.7  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...    33   2.7  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    33   2.7  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    33   2.9  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    33   2.9  
SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} simila...    33   3.0  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   3.1  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    33   3.1  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    33   3.1  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    33   3.3  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    31   3.3  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   3.4  
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    33   3.7  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    33   3.8  
Smik_2.178 Chr2 complement(326305..329007) [2703 bp, 900 aa] {ON...    33   3.8  
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    32   5.0  
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    32   5.0  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    32   6.2  
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    32   6.4  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    32   6.6  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    32   7.1  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   7.8  
Skud_12.137 Chr12 (263617..265713) [2097 bp, 698 aa] {ON} YLR072...    32   8.0  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   8.3  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   8.6  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    31   8.6  
YBR055C Chr2 complement(344602..347301) [2700 bp, 899 aa] {ON}  ...    31   8.9  
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    31   9.4  
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    31   10.0 

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/617 (93%), Positives = 575/617 (93%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGXXXXXXXXXXXXXXGSQKKAE 60
           MKSFISKNK                            RG              GSQKKAE
Sbjct: 1   MKSFISKNKTAILATIGATGAAVGAYYYYTQLQQQQQRGKKDTITKDEKKDVKGSQKKAE 60

Query: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
           GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK
Sbjct: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240

Query: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300
           PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR
Sbjct: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300

Query: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600

Query: 601 AAKIQETLAKLREQGLM 617
           AAKIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/617 (87%), Positives = 564/617 (91%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGXXXXXXXXXXXXXXGSQKKAE 60
           MKSFISKNK                            +G              GSQKK+E
Sbjct: 1   MKSFISKNKTAILATIAATGTAVGAYYYYTQLQQQQQQGKKETLSRDEKKEAKGSQKKSE 60

Query: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
           GSKK+A ESK P+YPV++NGEPDFSKKA+FTAEEKDKYALALKDKGNQYFRNKKYDDAIK
Sbjct: 61  GSKKSAGESKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE+KPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGD+DAATATPTELSTQP
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQP 240

Query: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300
           PKERKDKQE+LPS+TSMASFFGIFKPELTFAN DE N+ADKELM+GLANLYKRSP+SYDR
Sbjct: 241 PKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDR 300

Query: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKA KLFE+QLDK NEDEK+KEKLAISLEHTGIFKFLKNDPLGAHEDI KAI+LF
Sbjct: 301 ADESFTKAVKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKL+ NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKL+ IYVGIAPLVGKATLLTRNPTVENF+EATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQQ+IRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 AAKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 ATKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/617 (87%), Positives = 560/617 (90%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGXXXXXXXXXXXXXXGSQKKAE 60
           MKSFI++NK                            RG               SQK+ E
Sbjct: 1   MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETE 60

Query: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
           G+KK+ + S  P+YPVSSNGEPDFS KANFTAEEKDKYALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  GAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE+KPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240
            FADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGD+D ATATPTELSTQP
Sbjct: 181 KFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQP 240

Query: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300
            KERKDKQENLPS+TSMASFFGIFKPELTFANYDE N+ADKELM+GL+NLYKRSPESYD+
Sbjct: 241 AKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDK 300

Query: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKAA+LFEEQLDK+NEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKL+ NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540
           FDKALKQYDLAIELENKLD IYVGIAPLVGKATLLTRNPTVENF+EATNLLEKASKLDPR
Sbjct: 481 FDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQQ+IRSDP+L
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVL 600

Query: 601 AAKIQETLAKLREQGLM 617
           A KIQETLAKLREQGLM
Sbjct: 601 AKKIQETLAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/617 (86%), Positives = 556/617 (90%)

Query: 1   MKSFISKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGXXXXXXXXXXXXXXGSQKKAE 60
           MK+FISKNK                            +G              GSQKK +
Sbjct: 1   MKNFISKNKTAILATIAATGTALGAYYYYSQLQQQQQQGKKNTITKDDKKEVKGSQKKTK 60

Query: 61  GSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIK 120
              ++ +ES  PVYPVSSNG+PDFS KANFTAEEKD+YALALKDKGNQ+FRNKKYDDAIK
Sbjct: 61  DGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIK 120

Query: 121 YYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           YYNWALELK+DPVFYSNLSACYVSVGDLKKVVEMSTKALE+KPDYSKVLLRRASANEGLG
Sbjct: 121 YYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLG 180

Query: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQP 240
           NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS+LKEKFGD+D ATATPTELSTQ 
Sbjct: 181 NFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQA 240

Query: 241 PKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDR 300
           PKE KDK ENLPSITSMASFFGIFKPELTFANYDE N+ADK+LM+GL NLYKRSPESYD+
Sbjct: 241 PKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDK 300

Query: 301 ADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360
           ADESFTKA KLF+EQLDK+NEDEK KEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF
Sbjct: 301 ADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELF 360

Query: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDF 420
           PRVNSYIYMALIMADRNDSTEYYNYFDKALKL+ NNSSVYYHRGQMNFILQNYDQAGKDF
Sbjct: 361 PRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDF 420

Query: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480
           DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND
Sbjct: 421 DKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND 480

Query: 481 FDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPR 540
           F+KALKQYDLAIELENKLD IYVGIAPLVGKATLLTRNPTVENF+EATNLLE+ASKLDPR
Sbjct: 481 FEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPR 540

Query: 541 SEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPIL 600
           SEQAKIGLAQMKLQQEDIDEAI LFEESADLARTMEEKLQAITFAEAAKVQ++IRSDPIL
Sbjct: 541 SEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPIL 600

Query: 601 AAKIQETLAKLREQGLM 617
           AAKIQETLAKLREQGLM
Sbjct: 601 AAKIQETLAKLREQGLM 617

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/546 (67%), Positives = 445/546 (81%), Gaps = 20/546 (3%)

Query: 72  PVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P YP+ SNGEPD    ANFT E+K+ Y++ALKDKGNQ+F+ +KY+DA+KYYN+AL+LK+D
Sbjct: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALE+KPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENL 251
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D ++ L
Sbjct: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231

Query: 252 PSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKL 311
           PS T +ASFFGIF PE T  N+DE N+AD EL++ L NLYKR  ESY  ADESF+KAA+ 
Sbjct: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291

Query: 312 FEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           + +QL+ + +DE LKEK A +LE+ GIFKFLKNDPLG+HEDI+++IEL PRVN+YIY AL
Sbjct: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351

Query: 372 IMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+ +S  Y+++FDKAL ++PN++ VYYHRGQM+F+ Q Y++A  DF+KAKE D  NI
Sbjct: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNI 411

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DFD A KQYD+A
Sbjct: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471

Query: 492 IELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQM 551
             LE  LD I+VG++PLVGKATLL R PTVEN +E+T LLE+A K+D RSEQAKIGLAQ+
Sbjct: 472 KRLEESLDAIHVGVSPLVGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQL 531

Query: 552 KLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKL 611
           KLQQE+IDEAI LFEE++DLAR MEEKLQA TFAEA+KVQ+KIR+DP++ AKIQ TLA  
Sbjct: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591

Query: 612 REQGLM 617
           REQGL+
Sbjct: 592 REQGLI 597

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/553 (66%), Positives = 442/553 (79%), Gaps = 20/553 (3%)

Query: 65  TASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNW 124
           T+    A  YPV  NGEP        T E+K+KYA+ LKDKGN++F+ KK+DDAIKYYN 
Sbjct: 68  TSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNL 127

Query: 125 ALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFAD 184
           ALELK+DPVFYSN SACYVS+G L+KVVE +T AL++K DYSK LLRRASANE LGN+AD
Sbjct: 128 ALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYAD 187

Query: 185 AMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKER 244
           AMFDLS LSL GDFN ASIEPMLERN+NKQAM  LKEK                   +E+
Sbjct: 188 AMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKL------------------EEK 229

Query: 245 KDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADES 304
           KD +  LPS TS+ASFFGIF+PE +F NYDE  +AD+ L+ GL NLYKR+ E YD ADES
Sbjct: 230 KDHR--LPSNTSLASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADES 287

Query: 305 FTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVN 364
           FTKAA  ++  L++S E+E LK+K AI+LEH GIFKFLKNDPL AH+D+K+A+E  PRVN
Sbjct: 288 FTKAAAAYKTLLEESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVN 347

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           SYIY+ALIMAD+  +TEY+  FDKAL+L+PN ++VYYHRGQM FI Q Y+ AGKDFDKAK
Sbjct: 348 SYIYLALIMADKGQATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAK 407

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKA 484
           E +  NIFPYIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D   A
Sbjct: 408 ECNENNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANA 467

Query: 485 LKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQA 544
            KQY++A +LE+ LD I+VGIAPLVGKATLL R PTVENFVEAT   E+A + DPRSEQA
Sbjct: 468 KKQYEIARKLEDALDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQA 527

Query: 545 KIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKI 604
           KIGLAQ+KLQQE++DEAI LFEE+ADLAR+ +EKLQA TFAEA K+Q+KIR+DPI++AKI
Sbjct: 528 KIGLAQLKLQQEEVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKI 587

Query: 605 QETLAKLREQGLM 617
           +ETLA  R QG++
Sbjct: 588 EETLAAYRAQGMI 600

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/547 (65%), Positives = 439/547 (80%), Gaps = 20/547 (3%)

Query: 71  APVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE 130
            P YPV+  GEPD S  A  + E+KDKYA+ LKDKGN++F+NKKYD+AI+YY+WA+E+KE
Sbjct: 67  GPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKE 126

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           DPVFYSN SACYVS+G  +KVVE +T AL++KPDYSK LLRRASANE LGNFADAMFDLS
Sbjct: 127 DPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLS 186

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN 250
            +SL GDF+ ASIEP+LERN+NKQ+M  LKEK                      K ++  
Sbjct: 187 AVSLYGDFSGASIEPLLERNMNKQSMLVLKEKL--------------------EKQQEYK 226

Query: 251 LPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAK 310
           LPS TS+ASFFGIF+PE TF NYD+ ++ADK L++GL NLYKR+ + Y+ AD SF KA  
Sbjct: 227 LPSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARD 286

Query: 311 LFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMA 370
            F+  L+++ ED  LK K AI+LEH GIFKFLKNDP+ AHED+KKA+E FPR N+YIYMA
Sbjct: 287 AFKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMA 346

Query: 371 LIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           LIMAD+  +TEY++ F+KALKL+P+ ++VYYHRGQM FI Q ++QAGKDF+KAKEL   N
Sbjct: 347 LIMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESN 406

Query: 431 IFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDL 490
           IFPYIQLACL YRE KFDD ETLFSEA+RKFP APEVPNF+AE L+DK D   A KQYD+
Sbjct: 407 IFPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDI 466

Query: 491 AIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQ 550
           A +LE+ LD I+VG++PL+GKATLL+R P+VENFVEAT L EKA + DPRSEQAKIGLAQ
Sbjct: 467 AAKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQ 526

Query: 551 MKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAK 610
           +KLQQEDIDEAI LFEE+ADLAR+ +EKLQA TFAEA K+Q+KIR+DP+++AKI+ETLA 
Sbjct: 527 LKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAA 586

Query: 611 LREQGLM 617
            R QG++
Sbjct: 587 YRAQGMI 593

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/544 (65%), Positives = 436/544 (80%), Gaps = 20/544 (3%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV   GEP     A  + E+K+ ++ ALKDKGN++F+ K YD+A+KYY++AL LK+DPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+  L KVVE STKALE+KPDYSK LLRRASANE L N+ DAMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253
           LNGDF  +SIEPMLERNLNKQAM+ LK+K G                    + K + LPS
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLG--------------------QQKNQLLPS 240

Query: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313
            T++ASFFGIF PE  FANYDE ++AD++L  GL NLYKRS E Y +ADE F++A   + 
Sbjct: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300

Query: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
           +  + +++D  LKEK AI+LEH GIF+FLKNDPLGAHED++KAI+L PRVNSYIYMALIM
Sbjct: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360

Query: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EYY +FDKA+KL+P N++VYYHRGQM FI   Y++AG+DFDKAK+L+ ENIFP
Sbjct: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRENKFDDCETLFSEAKRKF  APEVPNFFAEIL DK D +KALKQYD+A  
Sbjct: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480

Query: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE  +D I+VGI+PLVGKATLL R P+VENF+EAT LLE+A   DPRSEQ K+GLAQ+KL
Sbjct: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540

Query: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613
           QQEDID+AI LFEE+A LART++EKLQA TFAEAAKVQ++IR+DP+++AKI+ETLA  + 
Sbjct: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600

Query: 614 QGLM 617
           QG++
Sbjct: 601 QGVI 604

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/546 (65%), Positives = 432/546 (79%), Gaps = 20/546 (3%)

Query: 72  PVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           PVYPV  NGEP        + E ++ YA ALKD+GN++F+ K YD+A+KYYN+AL +K+D
Sbjct: 74  PVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKD 133

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PVFYSN+SACYVS+G L KVVE STKALE+KPDYSK LLRRASANE L N+ADAMFDLSV
Sbjct: 134 PVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSV 193

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENL 251
           LSLNGDFN +SIEPMLERNLNKQAM  LK+K G+                    +  + L
Sbjct: 194 LSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGN--------------------NVSQQL 233

Query: 252 PSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKL 311
           PS T++ASFFGIF PE TFANY+E ++AD  L +GL +LYKRS E Y  ADE+F K+A  
Sbjct: 234 PSNTALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASF 293

Query: 312 FEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           F  +L +  +D  LKEK AI+LEH GIFKFLKNDPL AH+DI+KAI+L PR+NSYIYMAL
Sbjct: 294 FTNKLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMAL 353

Query: 372 IMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           IMAD+  + EYY YFDKA+ L+PN    YYHRGQM +I   Y++AGKDFDKAKE D  NI
Sbjct: 354 IMADKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNI 413

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACLAYRE+KFDDCETLFSEAKRKFP APEVPNF+AEIL DK D + ALKQY++A
Sbjct: 414 FPYIQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIA 473

Query: 492 IELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQM 551
             LE  LD I+VG+APLVGKATLL R P+VENF EAT LLE+A + DP SEQAK+GLAQ+
Sbjct: 474 KRLEEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQL 533

Query: 552 KLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKL 611
           KLQQE++DEAI LFEE+A+LART++EKLQA TFAEAAKVQ++I++DP+++AKI+ETLA  
Sbjct: 534 KLQQEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAY 593

Query: 612 REQGLM 617
           R QG+M
Sbjct: 594 RAQGMM 599

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/549 (63%), Positives = 440/549 (80%), Gaps = 20/549 (3%)

Query: 69  SKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128
           ++ P +PV   GEPD  K    +AEEKDK+A+ LKDKGN++F+NK+++DA+KYY+ A+E+
Sbjct: 66  TQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV 125

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFD 188
           KEDPVFYSN SACYVS+G  +KVVE +T AL++KPDYSK LLRRASANE LG FADAMFD
Sbjct: 126 KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFD 185

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQ 248
           LS +SL GDFN +SIEP+LERN+NKQAM  LKEK                      K ++
Sbjct: 186 LSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKL--------------------EKQQE 225

Query: 249 ENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKA 308
             LPS TS+ASFFGIF+PE +F NYDE ++ADK L+DGL NLYKR+   Y+ AD +F+KA
Sbjct: 226 YKLPSNTSLASFFGIFQPETSFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKA 285

Query: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
              ++  L+ ++ED  LK+K AI+LEH GIFKFLKNDP+ AHED+KKA+E FPR N+YIY
Sbjct: 286 RDEYKTLLEHNSEDASLKQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIY 345

Query: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MALIMAD+  +TEY++ F+KAL+L+PN ++VYYHRGQM+FI Q ++QAGKDF+KAKEL+ 
Sbjct: 346 MALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNE 405

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            NIFPYIQLACL YRE KF D ETLFSEA+RKFP +PEVPNF+AE L+DK D   A K+Y
Sbjct: 406 SNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEY 465

Query: 489 DLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGL 548
           D+A +LE+ LD I+VG++PL+GKATLL+R P+VENF+EAT L E+A + DPRSEQAKIGL
Sbjct: 466 DIAAKLESALDGIHVGVSPLIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGL 525

Query: 549 AQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETL 608
           AQ+KLQQEDIDEAI LFEE+ADLAR+ +EKLQA TFAEA K+Q+KIR+DPI++AKI+ETL
Sbjct: 526 AQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETL 585

Query: 609 AKLREQGLM 617
           A  R QG++
Sbjct: 586 AAYRAQGMI 594

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/541 (64%), Positives = 431/541 (79%), Gaps = 19/541 (3%)

Query: 72  PVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131
           P+YP+ +NGEP          + K+++A ALK+KGN  F+ K +++AIKYY +AL LKED
Sbjct: 68  PIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKED 127

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSV 191
           PV+YSN+SACY S+ + +KV+EM+TKAL ++PDYSKVL+RRA+A E LGNF DAMFDLSV
Sbjct: 128 PVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSV 187

Query: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENL 251
            SLN D +DASIEP+LERNLN+QAM  L  K G  D                   K+  L
Sbjct: 188 CSLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTD-------------------KKSQL 228

Query: 252 PSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKL 311
           PS T++ SFFGIFKPEL+FANYD+  + DKEL++GL NLY+ + E Y+ AD SFTKA + 
Sbjct: 229 PSNTALTSFFGIFKPELSFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEY 288

Query: 312 FEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371
           F +QL ++ +DE +KEK AI+LEH GIFKFLKN+PL AHEDIKKA+EL PR+NSYIYMAL
Sbjct: 289 FLKQLSETPDDETVKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMAL 348

Query: 372 IMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           I+AD+ D+  Y+  ++KA+KL+  N+++YYHRGQM FI Q Y++AG+DFDKAKELDPENI
Sbjct: 349 ILADKGDTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENI 408

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491
           FPYIQLACL+YRENKFDDCETLFSEA+RKFP + EVPNF+AEIL DK DFD ALK+Y+ A
Sbjct: 409 FPYIQLACLSYRENKFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERA 468

Query: 492 IELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQM 551
           IELE K D ++VGIAPLVGKATLL R PTVENFVEAT+LLE+A K DPRSEQAKI L Q+
Sbjct: 469 IELEKKQDAVHVGIAPLVGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQL 528

Query: 552 KLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKL 611
           KLQQEDIDEAI LFE +A LART EEKLQA TFAEAAK+Q++IR+DP ++AKIQET+A L
Sbjct: 529 KLQQEDIDEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAAL 588

Query: 612 R 612
           R
Sbjct: 589 R 589

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/551 (62%), Positives = 441/551 (80%), Gaps = 20/551 (3%)

Query: 67  SESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL 126
           +E+   +YPV+SNGEPD S K +F+ E K+KYA+ALKDKGN YF+ + +++A+KYYN+AL
Sbjct: 73  NETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYAL 132

Query: 127 ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186
            LK+DPVFYSN+SACYVS+G L+KVVE ST+AL++K DYSK LLRRASA E L N+ DAM
Sbjct: 133 TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAM 192

Query: 187 FDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKD 246
            DLSVLSLNGDFN ASIEPMLERNLNKQAM  LKEK  +                    +
Sbjct: 193 VDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAE--------------------N 232

Query: 247 KQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFT 306
           K + LPS TS+ASFFG+FKPE++  N++E ++++KEL++GL NLY R+ + Y  ADESF 
Sbjct: 233 KPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQ 292

Query: 307 KAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSY 366
           KA KL E++ +++ E+  +KEK AI+LE+ GI KFLKNDPL AH DI+KAI +FPRVNSY
Sbjct: 293 KAVKLLEKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSY 352

Query: 367 IYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKEL 426
           IY +LI+AD+ ++ E    FD A+ L+  N++ YYHRGQ+ F+ Q Y++AG DFDKAKEL
Sbjct: 353 IYNSLILADKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKEL 412

Query: 427 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALK 486
           D  NI PYIQLACLAY+ENKF+DCETLFSEA+RKFP APEVPNF+A++L ++N+FDKALK
Sbjct: 413 DESNILPYIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALK 472

Query: 487 QYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKI 546
           QYD++ +LE  ++ I+VGIAP++GKATLL RNP VEN +E+T L E+A KLDPRSEQAKI
Sbjct: 473 QYDISKKLEEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKI 532

Query: 547 GLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQE 606
           GLAQ+KLQQE++DEAI LFEE+A LAR M+EKLQA TFAEA+KVQ+K+RSDP++  KIQE
Sbjct: 533 GLAQLKLQQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQE 592

Query: 607 TLAKLREQGLM 617
           TLA  ++QGLM
Sbjct: 593 TLAAYQQQGLM 603

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/551 (63%), Positives = 433/551 (78%), Gaps = 21/551 (3%)

Query: 66  ASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWA 125
           A+    P+YPV  NGEP+   K  FT EEK+KY++ALKDKGN  F+  K+++AIKYYNWA
Sbjct: 78  ATTDGKPIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWA 137

Query: 126 LELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA 185
           +ELKE+P+FYSNLSACYVS+  L+++++   KALE+KPDYSKVLLRRA+ANE L N+ADA
Sbjct: 138 IELKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADA 197

Query: 186 MFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERK 245
           MFDLSVLSLNGD+N ASIEP+LERNLNKQAMS LK+K                   K  K
Sbjct: 198 MFDLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKL------------------KNSK 239

Query: 246 DKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESF 305
           D Q  LPS TS+++FFGIFKPEL+F NYDE N ADKEL++GL +L+KR  ESY  AD+SF
Sbjct: 240 DDQ--LPSDTSLSAFFGIFKPELSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSF 297

Query: 306 TKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS 365
             A +L+ +QL+++ +D  LK K +I+ E+ GIF FLKND  GA E+I K+I+L PR+NS
Sbjct: 298 MNALELYIKQLEETPDDTDLKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINS 357

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           YIY ALI+AD+ +S +Y +YFDKALKL+  + +VYYHR Q+NF+ Q++ +A  DF+KAKE
Sbjct: 358 YIYRALIIADKGESQDYLDYFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKE 417

Query: 426 LDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKAL 485
            DP NIFPYIQLACL YRENKFDDCETLFSEAKRKFP  PEVPNF+AE+LTDK DFD A+
Sbjct: 418 CDPTNIFPYIQLACLTYRENKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAM 477

Query: 486 KQYDLAIELEN-KLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQA 544
           K Y+ A  LE    D I+VG+APL+GKATLL R PT+EN   A  LLE+A+++DPRSEQA
Sbjct: 478 KNYETARRLEEASKDGIHVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQA 537

Query: 545 KIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKI 604
           KIGLAQ+KLQ+E+IDE+I LFEESADLARTMEEKLQA TFAEAAKVQ+ IR+DPI++ KI
Sbjct: 538 KIGLAQLKLQKEEIDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKI 597

Query: 605 QETLAKLREQG 615
           +ETLA  R Q 
Sbjct: 598 EETLAAYRAQN 608

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/544 (61%), Positives = 417/544 (76%), Gaps = 20/544 (3%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV SNGEPD S   +FT E+K++Y++A+KDKGN+ F+ KKY++AIKYY+ AL LK+DPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SAC+V +  L+KVVE +T ALE+KPDYSK LLRRA+ANE LGNFADAM DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253
           L G +N  SIEP+LERN+NKQAM  LK K  D                      +  LPS
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--------------------GSKHQLPS 232

Query: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313
            TS+ASFFGIF  E +FANYDE ++AD  L+ GL  L +R   SY+ +DE F KAA L  
Sbjct: 233 NTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS 292

Query: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
                 +ED  L+ KLAI+LEH GIFKFLKN+PL A++ ++KA++L PR NSYIYMALIM
Sbjct: 293 LSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIM 352

Query: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EY  YFDKAL+L PN+S+VYYHRGQM F+ Q ++++GKDFDKAKE +P+NIFP
Sbjct: 353 ADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFP 412

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D + ALK+Y+ A +
Sbjct: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472

Query: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE+  + I+VG+APLVGKAT+L R     +F EAT L E+A K DPRSEQAKIGLAQ+KL
Sbjct: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532

Query: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613
           QQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q++IR+DPI++AKIQETL   R 
Sbjct: 533 QQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRV 592

Query: 614 QGLM 617
           QG++
Sbjct: 593 QGVV 596

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 425/544 (78%), Gaps = 18/544 (3%)

Query: 73  VYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132
           VYPV +NG+PD SKK  FT E+ DKYALALKDKGN++F+ K ++ AI+YY  A+ LKEDP
Sbjct: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN SA YVS+ + +KVVE +T AL++KPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K+  LP
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239

Query: 253 SITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLF 312
           S TS+ASFFGIF PE +F +YD  N+AD EL  GL NLYK     Y+ ADE FTKAA+L+
Sbjct: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299

Query: 313 EEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372
           +++L+ S ++E LK+K AI+ EH GIFKF KNDP+ AH ++++++ L PR ++YIYMALI
Sbjct: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359

Query: 373 MADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           MAD+ ++ +Y  YFDKAL+L+PN S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  D A+KQYD+AI
Sbjct: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479

Query: 493 ELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMK 552
           +LE+ L  I+VGIAP++GKAT L RNPTVENFVEA+ L E+A K+DPRSEQAKIGLAQ+K
Sbjct: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539

Query: 553 LQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLR 612
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQ+KIR+DP +  KI E +A  R
Sbjct: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599

Query: 613 EQGL 616
            QGL
Sbjct: 600 AQGL 603

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/550 (60%), Positives = 429/550 (78%), Gaps = 21/550 (3%)

Query: 69  SKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128
           +K P+Y V SNGEP+ S   + T E K+++A+ALKDKGN+ F+  K++DAIKYY++AL+L
Sbjct: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFD 188
           K+DP++YSN+SACY S+   +KV+E +TKAL+++P +SKVL+RRA A E +GNF DAMFD
Sbjct: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQ 248
           +S  SLNGD NDASIEP+LER LNKQA   LKEK                       +K+
Sbjct: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS--------------------ANKE 239

Query: 249 ENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKA 308
           +NLPS T +ASFF +FKPE +FANY+E N+AD+ELM+GL NLYK S E +  AD+SF KA
Sbjct: 240 QNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKA 299

Query: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
           A+LF++QL ++ ++E +KEK AI+LE++GI  ++KN+ L AH+ IK AIEL PRVNSYIY
Sbjct: 300 AELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIY 359

Query: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
            +LI +D   ++EY   FDKAL+L PNN ++YYHRGQ  FI Q Y++AGKDFDK KELD 
Sbjct: 360 QSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE 419

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + +KA+K++
Sbjct: 420 NNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479

Query: 489 DLAIELENKL-DRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIG 547
           D AIELE K  + I+VGIAPL+GKATLL   PTVENFVE   LL++A   DPRSEQA++G
Sbjct: 480 DKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLG 539

Query: 548 LAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQET 607
           LAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+Q++IR+DP + AKI++T
Sbjct: 540 LAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQT 599

Query: 608 LAKLREQGLM 617
           + ++R Q  M
Sbjct: 600 IEQMRSQMSM 609

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/544 (60%), Positives = 416/544 (76%), Gaps = 20/544 (3%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           YPV  NGEPD S  A FT E+K+KYA+ALKDKGN+ F++++Y++AIK+Y+ AL+LKEDPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN SACYV +  L+KVVE +T AL++KPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253
           L G ++  +IEP+LERN+NKQAM  LK+K                        ++  LPS
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229

Query: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313
            TS+ASFF IF  E +  NYDE ++AD+ L+ GL  L+ R   SY+ ADE+FT A + F 
Sbjct: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289

Query: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
              + + ++  LK+KLAI+LEH GI KFLKN+PL AH  ++KAI+LFPR NSYIYM LIM
Sbjct: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349

Query: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+  + EY   F+KAL+L+P +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DF+ ALK+YD A +
Sbjct: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469

Query: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LE+  + I+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529

Query: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+Q++IR+DP+++AKIQETL   R 
Sbjct: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589

Query: 614 QGLM 617
           QG++
Sbjct: 590 QGMV 593

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 422/559 (75%), Gaps = 15/559 (2%)

Query: 59  AEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDA 118
           A   + TA+      YP + + +PD  +  +   EE+ K ++ LKDKGN+YF+ K Y +A
Sbjct: 82  ATPDQTTATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNA 141

Query: 119 IKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEG 178
           IKYYN AL+L +DP+FYSN+SACYVS+G L KV+E STKALE+ P+YSK LLRRASANE 
Sbjct: 142 IKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANES 201

Query: 179 LGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELST 238
           L N++DA+FDLSVLSLNGD++ ASIEP+LERNLNKQA+  L E+   +  +         
Sbjct: 202 LENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSN-------- 253

Query: 239 QPPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESY 298
                   +Q+ LPS TS+ SFFGIF PELTF NY+E ++AD EL+ GL NL+KR+ + Y
Sbjct: 254 -------KEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGY 306

Query: 299 DRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358
             AD++F KA+ LF E+L K+ +D+ L EK AI+LE+ GIF+FLKND LGA  DI+KAI 
Sbjct: 307 LDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIG 366

Query: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGK 418
            FPRVNSY+Y+ALI AD++ S EY  YFDKAL+LNP++ SVYYHRGQ+ FI Q+Y +A  
Sbjct: 367 FFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKV 426

Query: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478
           +F+KAKELD  NIFPYIQLACLAYREN FD C+ LF E ++KFP  PEVP F+AEIL DK
Sbjct: 427 EFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADK 486

Query: 479 NDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLD 538
            DF  A+KQYD+A  LE     I+VGIAPLVGKAT+L R P + N  EAT L+EKA ++D
Sbjct: 487 GDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEID 546

Query: 539 PRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDP 598
           PRSEQA +GLAQ+KLQ E++D AI LFE++ADL+RTM+EK+QA+TFAEAAK+Q++IR+DP
Sbjct: 547 PRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADP 606

Query: 599 ILAAKIQETLAKLREQGLM 617
           +++AK+ E LA  R QG++
Sbjct: 607 VISAKVDEALASYRSQGVI 625

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/563 (59%), Positives = 416/563 (73%), Gaps = 26/563 (4%)

Query: 63  KKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYY 122
           KKT   ++ PVYP++++GEPD S+  ++T E+++ YALALKDKGN+ F+ K  ++AIKYY
Sbjct: 70  KKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYY 129

Query: 123 NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNF 182
            WALE K+DPVFY+N+SACYVS+ D +KV+E   KALE+KPDYSKVLLRRA+  E + NF
Sbjct: 130 QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENF 189

Query: 183 ADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPK 242
           ADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +                 
Sbjct: 190 ADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT---------------- 233

Query: 243 ERKDKQEN-LPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRA 301
             +DK E  LPS TSMASFFGIFKPE  F  YDE  +AD+ L  GL  L+  +   + +A
Sbjct: 234 --QDKFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKA 291

Query: 302 DESFTKAAKLFEEQLDKSNEDEKL----KEKLAISLEHTGIFKFLKNDPLGAHEDIKKAI 357
           D  F +A   + E   K++++EKL     EK AI+LE++GIFKFLKND +GA   + +AI
Sbjct: 292 DTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAI 351

Query: 358 ELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAG 417
           +LFPRVNSYIY+AL  AD  +S+EY   FDKAL+LNPN+S+ YYHRGQ+ FI Q+Y +A 
Sbjct: 352 KLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAK 411

Query: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
            DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F+AEIL D
Sbjct: 412 ADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILAD 471

Query: 478 KNDFDKALKQYDLAIELENKLDR---IYVGIAPLVGKATLLTRNPTVENFVEATNLLEKA 534
           K DF  A KQYD+A  LE  +     I VG+APLVGKAT+L R P+ ENF EAT L E+A
Sbjct: 472 KGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEA 531

Query: 535 SKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKI 594
            K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEAAKVQ+KI
Sbjct: 532 CKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKI 591

Query: 595 RSDPILAAKIQETLAKLREQGLM 617
           R+DPI+ AK++E LA+ R QG++
Sbjct: 592 RADPIIRAKVEEALAEYRAQGMI 614

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/544 (59%), Positives = 419/544 (77%), Gaps = 14/544 (2%)

Query: 76  VSSNGE---PDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132
           ++ NG+   PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L EDP
Sbjct: 67  LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP 126

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VF+SN+SACYVS+GDL KVVE ST+ALE+KPDYSK LLRRASA E +G + DAMFD+SVL
Sbjct: 127 VFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252
           SLNGDFN +SIEPMLERNLNKQA+  LKE  G +DA+         + P+ER++    LP
Sbjct: 187 SLNGDFNGSSIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LP 236

Query: 253 SITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLF 312
           S TS++SFFGIFKPE     YDE N+AD  L+ GL  LY  + + Y  ADE F KAAKL+
Sbjct: 237 SNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY 296

Query: 313 EEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372
            EQL  +N D   KEK A +LE+ GIF FLKND   + +++K+A+ L PRVN+YIY+AL 
Sbjct: 297 REQL-ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALT 355

Query: 373 MADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           MADR  S +Y++YF+KA+ L+PNN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIF
Sbjct: 356 MADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415

Query: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492
           PYIQLACLAYRENK  +CE LF EA++ FP APEVPNF+AEIL DK D D+A+KQY++A 
Sbjct: 416 PYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY 475

Query: 493 ELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMK 552
            LE+   +I+VGIAPLVGKAT+L R PT ENF   + LLE A K DPRSEQAK+GLAQ++
Sbjct: 476 RLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLR 535

Query: 553 LQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLR 612
           LQQE +DEAI LFEE+A +ART++EKLQAITFAEA KVQ++IR+DP+++ K++ETLA  +
Sbjct: 536 LQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQ 595

Query: 613 EQGL 616
            Q +
Sbjct: 596 AQNM 599

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/544 (57%), Positives = 405/544 (74%), Gaps = 18/544 (3%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133
           +P   NGEPDF+   N TA++KDK+A+ LKDKGN+YF+ K Y++A+K+Y++AL LK+DPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193
           FYSN+SACYVS+ +L KV+EMSTKALE+KPDYSK LLRRA+ANE L N++DAMFDLSVLS
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253
           LN DFN A+IEPMLERNLNKQA+  L +K              S  P K     +  LPS
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQK--------------SKNPSK----NESELPS 244

Query: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313
            TSMASFF IF PE++F +YDE + ADKEL++GL  LY      Y+ A+ SF K+ +L++
Sbjct: 245 NTSMASFFSIFTPEISFDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYK 304

Query: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373
             L+ + + E + +K AI+LE+ GIF FL+ND + A +   ++I   PRVNSYIY+ALI 
Sbjct: 305 ILLESTEDKETISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALIS 364

Query: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           AD+N+  E   YFD+ALKL+PN S +YYHRGQ+NF+ Q+Y  A  DF KAKELD  NIFP
Sbjct: 365 ADKNEKDESNKYFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFP 424

Query: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493
           YIQLACL+YRE  F+DC+  F  A++KFP APE+P F  EIL DK D D A KQY+  I 
Sbjct: 425 YIQLACLSYREGDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIR 484

Query: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553
           LEN    I+VGIAPL+GKAT L R PT ENF EA+ LL+ A + DPRSEQA +GLAQ+KL
Sbjct: 485 LENTQKSIHVGIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKL 544

Query: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613
           Q+ED+D AI LFE+++D +R+M+EKLQA TFAEAAKVQ++IR+DP++ AK++ETLA+   
Sbjct: 545 QEEDVDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHA 604

Query: 614 QGLM 617
           QG M
Sbjct: 605 QGFM 608

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/556 (54%), Positives = 396/556 (71%), Gaps = 19/556 (3%)

Query: 60  EGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAI 119
           +G+    + SK     +  N EPD          EK++YA  LK +GN YF+ K Y++AI
Sbjct: 47  DGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAI 106

Query: 120 KYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGL 179
            YY +AL+LK DPVFYSN++ACY+S+   K+ +E  +KALE+ PDYSKVLL+RA+  E +
Sbjct: 107 NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENI 166

Query: 180 GNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQ 239
           G FADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+                  
Sbjct: 167 GKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------------- 210

Query: 240 PPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYD 299
              E  +K + LPS TSMA+FFG+F  E     +D   ++DK L D L +LY ++ E YD
Sbjct: 211 ---EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYD 267

Query: 300 RADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIEL 359
           R D  FTKA +L++ +L+    +    EK AI+ EHT I  FLKNDPL A E + +AI+L
Sbjct: 268 RCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKL 327

Query: 360 FPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKD 419
            PR  SYIY+ L+MAD+    EYY+ F KA+ L+PN +++YYHRGQMNFI+Q Y++AG+D
Sbjct: 328 HPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGED 387

Query: 420 FDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKN 479
           FDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVPNFFAEIL+DK 
Sbjct: 388 FDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKG 447

Query: 480 DFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDP 539
           + +KA  +YD AIELE+K + I+VGIAPLVGKAT L + PTVENF+EA +L E+A+  DP
Sbjct: 448 EIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDP 507

Query: 540 RSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPI 599
           RSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA KVQ ++R+D  
Sbjct: 508 RSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADER 567

Query: 600 LAAKIQETLAKLREQG 615
           L AK  + L ++R  G
Sbjct: 568 LQAKTMKALDEIRRNG 583

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/558 (53%), Positives = 389/558 (69%), Gaps = 34/558 (6%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP   NGEPD ++    +  ++  YA+ LK++GN +F  K +++AIKYY +A+EL   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL+KV+E +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252
           SLNGDF+ ASIEPMLERNLNKQAM  L E                    K+     + LP
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLS-----------------KDEGRGSQVLP 264

Query: 253 SITSMASFFGIFKPEL------TFANYDEFNKADKELMDGLANLYKRSPESYDRADESFT 306
           S TS+ASFFGIF   L      T +NYD    A   L D L  LY  + E Y  A++  T
Sbjct: 265 SNTSLASFFGIFDSHLEVSSVNTSSNYD---TAYALLSDALQRLYSATDEGYLVANDLLT 321

Query: 307 KAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSY 366
           K+  ++   L  +  D+ L+E  A++L +TGIF FLKN+ L A   ++++I L P  NSY
Sbjct: 322 KSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSY 381

Query: 367 IYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKEL 426
           I++AL +AD+ +S E++ +F KA+ LNP     YYHRGQM FILQ+Y  A +DF KA+ L
Sbjct: 382 IFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSL 441

Query: 427 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALK 486
           +PEN++PYIQLACL Y++ KF + E  F+E K KFP  PEVP FFAEILTD+ DFD A+K
Sbjct: 442 NPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIK 501

Query: 487 QYDLAIELENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDP 539
           QYD+A  LE   ++I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDP
Sbjct: 502 QYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDP 561

Query: 540 RSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPI 599
           RSEQAKIGLAQ+KLQ E IDEAI LFE+SA LARTM+EKLQA TFAEAAK+Q+++R+DPI
Sbjct: 562 RSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPI 621

Query: 600 LAAKIQETLAKLREQGLM 617
           ++AK++ TLA+ R +G++
Sbjct: 622 ISAKMELTLARYRAKGML 639

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 382/556 (68%), Gaps = 29/556 (5%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP+ S+GEPD ++       ++ +YA+ LKDKGN +F +K +DDAIKYY  A+EL   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDK-QENL 251
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+  E L
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262

Query: 252 PSITSMASFFGIFKPELTFANYDEFNKADKE---LMDGLANLYKRSPESYDRADESFTKA 308
           PS TS+ASFFGIF P+L  +     +  D     L++ L  LY  + E Y  A+  FTKA
Sbjct: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322

Query: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
              +   L  S  D  ++   A++  + GIF+FLKND L A   ++++I L P  NSYI+
Sbjct: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382

Query: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MAL +AD+ +S E++++F KA+ L+P  S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D++ A+KQY
Sbjct: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502

Query: 489 DLAIELENKLDRIYVGIAPLVGKATLLTRNPTV-------ENFVEATNLLEKASKLDPRS 541
           D+A  L+    +I+VGI PL+GKAT+L R  T        E F  A  LL +A  LDPRS
Sbjct: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562

Query: 542 EQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILA 601
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+++R+DPI++
Sbjct: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622

Query: 602 AKIQETLAKLREQGLM 617
           AK+++TLA  R  G++
Sbjct: 623 AKMEQTLASYRANGMI 638

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/550 (55%), Positives = 378/550 (68%), Gaps = 29/550 (5%)

Query: 79  NGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSN 137
           NGEPD S+    T  +K  YA+ LK+KGN +F  K + +AIKYY  A+EL   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 138 LSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197
           +SACY+S GDL KV+E +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 198 FNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPSITSM 257
           F+ ASIEPMLERNLNKQAM  L E     D   +                 + LPS TS+
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-----------------QLLPSNTSL 266

Query: 258 ASFFGIFKPELTFA---NYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEE 314
            SFFGIF P+L  +   N   F+ A   L D L  LY  + E Y  AD+ FT A   +  
Sbjct: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326

Query: 315 QLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMA 374
            L  S  D  LKE  A++  +TGIF FLKN+ LGA   ++++I L P  NSYI++AL +A
Sbjct: 327 LL-ASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385

Query: 375 DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D+ +S E++ YF KA+ L+      YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445

Query: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIEL 494
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505

Query: 495 ENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDPRSEQAKIG 547
           E   ++I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSEQAKIG
Sbjct: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565

Query: 548 LAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQET 607
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+++R+DPI++AK++ T
Sbjct: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625

Query: 608 LAKLREQGLM 617
           LA  R +G++
Sbjct: 626 LASYRAKGMI 635

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 385/556 (69%), Gaps = 29/556 (5%)

Query: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132
           YP+  +GEPD  +    +A ++  +A+ LKDKGN +F  K + DAIKYY +A+EL   DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           VFYSN+SACY+S GDL KVVE +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN-L 251
           SLNGDF+  SIEPMLERNLNKQAM  L E                    K   DK    L
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESL-----------------LKNGDDKSSQIL 268

Query: 252 PSITSMASFFGIFKPELTFANYDE---FNKADKELMDGLANLYKRSPESYDRADESFTKA 308
           PS TS+ASFFGIF P+L  +  +     + A   L + L +LY  + E Y  AD+  TKA
Sbjct: 269 PSNTSLASFFGIFDPDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKA 328

Query: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368
              +   L  + ED  ++E  A++  + GIF+FLKND L A   ++++I L P  NSY++
Sbjct: 329 TDEYHSLLRANKEDRVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVF 388

Query: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           MAL +AD+ +S E++ +F  A+ L+P     YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 389 MALTVADKENSQEFFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNP 448

Query: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488
            N++PYIQLACL Y+++KF + E+LF+EAK KFP  PEVP F+AEILTDK DF+ A+KQY
Sbjct: 449 GNVYPYIQLACLLYKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQY 508

Query: 489 DLAIELENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDPRS 541
           D+A  LE    +I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRS
Sbjct: 509 DIAKRLEEVQKKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRS 568

Query: 542 EQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILA 601
           EQAKIGLAQ++LQ E ID AI LF+ESA LARTM+EKLQA TFAEAAK+Q+++R+DPI++
Sbjct: 569 EQAKIGLAQLELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 628

Query: 602 AKIQETLAKLREQGLM 617
           AK+++TLA  R QG++
Sbjct: 629 AKMEQTLANYRAQGMI 644

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/555 (52%), Positives = 387/555 (69%), Gaps = 27/555 (4%)

Query: 72  PVYPVSSNGEPDFSKKANFTAEE---KDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128
           P YP+ S  +PDF++     A     K K+A  LK+KGNQYF++K  ++AIKYY +AL L
Sbjct: 128 PSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL 187

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFD 188
            +DPVFYSN+SACY ++  L KV+E S KALE+KPDYSK LLRRA+A E LGN  +A++D
Sbjct: 188 DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYD 247

Query: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQ 248
            S+LSL G+++   +EP+L R L+K +   L+ K  +                  +K   
Sbjct: 248 FSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDN------------------KKTDN 289

Query: 249 ENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKA 308
             L S +++ SFFGIF PE T  NY+  ++ADKEL+ GL  L K++ E +  AD+ F KA
Sbjct: 290 FILLSDSALVSFFGIFPPETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKA 349

Query: 309 AKLFEEQL---DKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS 365
            +LF E+L   + ++E+  L EK+AI+LE++G+FKFLK D LG+  D++KAI+L+PR NS
Sbjct: 350 NELFMEKLLSSEDNDENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNS 409

Query: 366 YIYMALIMADRNDS---TEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDK 422
           YIYMA+++AD+N+     +Y+ YFDKA  LNPN +  YYHRGQ+  + Q +D+A   F K
Sbjct: 410 YIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLK 469

Query: 423 AKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFD 482
           AKELD  N++PYIQLAC+AY  + F  C+ LF EA+ KFP  PEVP F+AEIL DK + +
Sbjct: 470 AKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELE 529

Query: 483 KALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSE 542
            A+KQYD+A  LE     I+VGIAPL+GKA  L R PT ENF   T LLEKA +LDPRSE
Sbjct: 530 AAMKQYDIAYRLETAYKYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSE 589

Query: 543 QAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAA 602
           QAKI LAQ+KLQ EDID AI LFEE+ADLART ++KLQA TFAEAAK+Q++I+ +PI AA
Sbjct: 590 QAKISLAQLKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAA 649

Query: 603 KIQETLAKLREQGLM 617
           KI+ETLA  R  G++
Sbjct: 650 KIEETLATYRADGII 664

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN  F +K +  AI+Y+  A+     P  V YSN SACY S+   ++ +  + + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           +I PD+SK   R  +A+ GLG+  DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL----EI 161
           GN+ +++ K+D+AI  YN A +L +D  + +N SA     GD +  +    +A+    E+
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 162 KPDY 165
           + DY
Sbjct: 323 RADY 326

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           KD+GN  F  K YD+AI+ +  A+E+ E P  V YSN SACY S     K +E + + ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 75  PVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVF 134
           P  S   P+  ++A+   +E    A A K +GN+ ++  K+D+AI++YN A EL  D  +
Sbjct: 231 PKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITY 290

Query: 135 YSNLSACYVSVGDLKKVVEMSTKAL----EIKPDYSKV 168
            +N SA     GD +  +E   +A+    E++ DY  V
Sbjct: 291 LNNRSAAEFEKGDYQTAIETLHEAVEKGREMRADYKLV 328

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   +     D   YSN +A    +    + +     A+E  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   + +F  A+  L
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETL 480

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ E P  V YSN SACY S+   ++ +  + + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           IKPD+SK   R  +A+ GLG+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K KGN+ ++ +++D+AI  Y  A +L +D  + +N +A     GD +  ++   KA+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 160 -EIKPDY---SKVLLRRASANEGLGNFADAM 186
            E++ DY   +K   R  +A+  L +   A+
Sbjct: 318 RELRADYKVIAKSFARLGNAHYKLADLKKAI 348

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G +YF N  + +A+K Y   ++   ED   YSN +A    +      ++    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  +A A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GNQ F +K Y  AI+ +  A+E+ E P  V +SN SACY S  D  K ++ + + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           +I P ++K   R  +A+ GLG+  +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 7/95 (7%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A A K +GN+ ++ +K+D+AI+ YN A E   D  + +N +A     GD +  +E  TKA
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 159 L----EIKPDY---SKVLLRRASANEGLGNFADAM 186
           +    E++ DY   SK   R  ++   LG+   A+
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G +YF    +  A++ Y   ++    D   YSN +A    +      +    KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+    + ++A A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 9/91 (9%)

Query: 349 AHEDIKKAIELFPRV-------NSYIY--MALIMADRNDSTEYYNYFDKALKLNPNNSSV 399
           A +D  KAIELF +        N  ++   +   A   D  +  +  ++ +K+NP+ +  
Sbjct: 15  ASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINPSWAKG 74

Query: 400 YYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           Y   G  ++ L + D+A + + KA ELD  N
Sbjct: 75  YNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC 439
           + + +K NPN++  Y +R      L ++  A +D DKA E DP  +  YI+ A 
Sbjct: 412 YTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRKAT 465

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ E P  V YSN SACY S+      +  +T+ ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 16/136 (11%)

Query: 56  QKKAEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDK--GNQYFRNK 113
           Q  A  + K+ S SKAP    +   EP          +E D    A K+K  GN++++ +
Sbjct: 221 QDAAPQTTKSESSSKAPQQEETKEAEP-------MEVDEDDSKVEADKEKAEGNKFYKAR 273

Query: 114 KYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL----EIKPDY---S 166
           ++++AI++YN A EL  D  + +N +A     GD +  +   T A+    E++ DY   S
Sbjct: 274 QFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVIS 333

Query: 167 KVLLRRASANEGLGNF 182
           K   R  +A   LG+ 
Sbjct: 334 KSFARIGNAYHKLGDL 349

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  FA A+  L
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETL 484

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K ++ A + ++ A+E  E P  V YSN SACY S+   K+ +E + + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           +I P +SK   R  +A  GLGN  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL- 159
           A K +GN+Y++ +K+D+AI++YN A +L  D  + +N SA     GD ++ ++  T+A+ 
Sbjct: 269 AEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

Query: 160 ---EIKPDY 165
              E++ DY
Sbjct: 329 QGREMRADY 337

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 6/106 (5%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G ++F    +  A+  Y   ++   ED   YSN +A    +      ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIE 204
           ++ +  +R+ASA   +  FA AM  L       L +N   N   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 352 DIKKAIELFPRV--NSYIYMALIMADRNDSTEYYNYFDKAL-------KLNPNNSSVYYH 402
           D +KA ELF +   +S     ++ ++R+        F +AL       K+NP  S  Y  
Sbjct: 18  DFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINPTWSKGYNR 77

Query: 403 RGQMNFILQNYDQAGKDFDKAKELDPEN 430
            G   + L N D A K++ KA E+D  N
Sbjct: 78  VGAAQYGLGNLDDAEKEYKKALEIDSSN 105

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ E P  V YSN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 16/123 (13%)

Query: 69  SKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDK--GNQYFRNKKYDDAIKYYNWAL 126
           SKAP    S   EP          +E D    A K+K  GN++++ +++D+AI++YN A 
Sbjct: 237 SKAPQKEESKESEP-------MEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAW 289

Query: 127 ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL----EIKPDY---SKVLLRRASANEGL 179
           EL +D  + +N +A     G+ +  +     A+    E++ DY   SK   R  +A   L
Sbjct: 290 ELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKL 349

Query: 180 GNF 182
           G+ 
Sbjct: 350 GDL 352

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+A+A   +  +A A+  L +  + + + N+ S
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGS 501

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 76  VSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVF 134
            S  GEP  +      AEE  K A ALK +GN+    K Y+ AI+ Y  A+E L  D V+
Sbjct: 73  TSDAGEPKVA------AEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVY 126

Query: 135 YSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLS-VLS 193
           Y+N +A Y S+   +K VE + KA ++   YSK   R   A   LG   +A+     VL 
Sbjct: 127 YANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLD 186

Query: 194 LNGD 197
           + GD
Sbjct: 187 IEGD 190

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K ++ AI+ +  A+E+ E P  V YSN SACY S     K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 55  SQKKAEGSKKTASESKAP-VYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNK 113
           ++ KAE  K   S ++ P   P  S  EP    +     E     A A K +GN++++ +
Sbjct: 214 TESKAEEEKPNVSSTQIPKAAPSESKPEPMEVDEPEQEEESSKAKADAEKAEGNKFYKAR 273

Query: 114 KYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL----EIKPDYSKV 168
           K+D+AI++Y+ A EL +D  + +N +A     G+ +  ++  T+A+    E++ DY  +
Sbjct: 274 KFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYKVI 332

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 349 AHEDIKKAIELFPRV-------NSYIYMALIMADRNDSTEYYNYFDKALK-------LNP 394
           A +D +KAIELF +        N  +Y     ++R+        F+KAL+       +NP
Sbjct: 15  AAKDFEKAIELFTKAIEVSEKPNHVLY-----SNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 395 NNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
             S  Y   G  +F L + D+A + + KA ELD  N
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN 105

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G +YF    + +A+K Y   ++   ED   YSN +A    +    + ++    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ AI  ++ A+E+ E P  VFYSN SACY S+    + +  + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 9/136 (6%)

Query: 60  EGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDK--GNQYFRNKKYDD 117
           E SK+T +E K+     ++  EP+  +  +   EE  K   A K+K  GN+ ++ +++D+
Sbjct: 215 EQSKETPAEQKSEPQAEATKAEPEPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQFDE 274

Query: 118 AIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKALEIKPDY---SKVLL 170
           AI +Y+ A  L +D  + +N SA     GD    LK + E   K  E++ DY   +K   
Sbjct: 275 AIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREMRTDYKLIAKSFA 334

Query: 171 RRASANEGLGNFADAM 186
           R  + +    N   A+
Sbjct: 335 RMGNVHHKTNNLKKAI 350

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G  YF    + +A+K Y   ++   ED   YSN +A    +    + +E   KA+E  P+
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  FA A+  L
Sbjct: 457 FIRAYIRKATAQIAVKEFAAAIETL 481

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ E P  V +SN SACY S+      +  + + ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADAMFD 188
           I P +SK   R  +A+ GLG+  +A  D
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 63/128 (49%), Gaps = 12/128 (9%)

Query: 62  SKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKY 121
           + K  S S AP    +   EP    + N  AE  ++     K +GN++++  ++D+AI++
Sbjct: 230 TTKNESSSTAPQQKDAEEPEPMEVDEDNSKAEADNE-----KAEGNKFYKAHQFDEAIEH 284

Query: 122 YNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE----IKPDY---SKVLLRRAS 174
           YN A EL +D  + +N +A     GD + V+     A+E    ++ DY   SK   R  +
Sbjct: 285 YNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYKVISKSFARIGN 344

Query: 175 ANEGLGNF 182
           A   LG+ 
Sbjct: 345 AYHKLGDL 352

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSV 191
           + +  +R A+A   +  FA A+  L V
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDV 489

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 2/144 (1%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVV 152
           E  + A+ LK++GN+Y + KKY  A++YY  A+EL     +F+SN +   + + + +  +
Sbjct: 8   EAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCL 67

Query: 153 EMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLN 212
           +    ALE+ P   K   RR  +  GL +F  A  DLS++ L    +DA+ +  L+    
Sbjct: 68  DDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV-LKAKPSDATAKRALDMCEK 126

Query: 213 KQAMSRLKEKFGDVDAATATPTEL 236
                R K+  G  D     P ++
Sbjct: 127 VIREERFKKAIGGDDTDRVNPCQV 150

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 380 TEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY----- 434
           T+   Y+ KA++L+   S  + +R      L N+     D + A ELDP+NI  Y     
Sbjct: 30  TKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHRRGL 89

Query: 435 IQLACLAYRENKFD 448
            QL  L +++ K D
Sbjct: 90  SQLGLLHFKKAKND 103

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  KKYD+A+  +  A+E+ E P  V YSN SA Y S     + ++ + +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P ++K   R  +A+ G+GN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVV----EMSTKA 158
           K +GN+ ++ + +D+AI  YN A EL  +  + +N SA     G+    +    E   K 
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 159 LEIKPDY---SKVLLRRASANEGLGNFADAM 186
            E++ DY   +K   R  +A   +GN  +A+
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G +YF    +  A+K Y   ++   ED   YSN +A    +      +    KA+E  P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV-----LSLNGDFNDASIEPMLERNLNKQAMSR 218
           ++ +  +R+A+A   + +F+ A+  L         +NG  N   I+ +      K A  R
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQL----YMKAAQQR 506

Query: 219 LKEKFGD 225
            +   GD
Sbjct: 507 FQPATGD 513

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 355 KAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALK-------LNPNNSSVYYHRGQMN 407
           KAIE+    N  +Y     ++R+ S      F++ALK       +NP+ +  Y   G  +
Sbjct: 30  KAIEVSETPNHVLY-----SNRSASYASEQKFNEALKDALECTKINPSWAKGYTREGAAH 84

Query: 408 FILQNYDQAGKDFDKAKELDPEN 430
           F + N D A   + KA ELD  N
Sbjct: 85  FGMGNLDDAEASYKKALELDANN 107

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 105/249 (42%), Gaps = 41/249 (16%)

Query: 283 LMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTG----- 337
           L  G+  LY R   S D A+E+F K  +L + Q +K+NE   +  +L I  +H G     
Sbjct: 162 LWHGIGILYDRY-GSLDYAEEAFAKVLEL-DPQFEKANE---IYFRLGIIYKHQGKWTQA 216

Query: 338 --IFKFLKNDPLGAHEDIKKAIELFPRVNSY--------IYMALIMADRN---------- 377
              F+++ N P    ++     +L   + S          Y  +++ + N          
Sbjct: 217 LECFRYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGC 276

Query: 378 ----------DSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
                     D  +  NY  K+L+++PN+S+ +YH G+++ I  +Y  A   F +A   D
Sbjct: 277 LYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRD 336

Query: 428 PENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKALK 486
             N   +  +  L Y+ +++ D    ++ A R  P   EV      +  T  N  + AL 
Sbjct: 337 SRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALD 396

Query: 487 QYDLAIELE 495
            Y  A  L+
Sbjct: 397 AYKQAARLD 405

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI+ +  A+E+ + P  V YSN SACY S+      +  + + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 93  EEKDKYALALKDK--GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKK 150
           +E D  A A K+K  GN++++ +++D+AI++YN A EL  D  + +N +A     G+ K 
Sbjct: 254 DEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKT 313

Query: 151 VVEMSTKAL----EIKPDY---SKVLLRRASANEGLGNF 182
            +     A+    E++ DY   S+   R  +A   LG+ 
Sbjct: 314 AIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDL 352

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G  YF    + +A+K Y   ++   ED   YSN +A    +    + +    KA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKF 223
           + +  +R+A+A   +  +A A+  L +  + + D N+ +    +++   K +  R +   
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQPGT 522

Query: 224 GD 225
           G+
Sbjct: 523 GN 524

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150
           +E+K K A ALK +GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D   
Sbjct: 91  SEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTN 150

Query: 151 VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            V  +  A+++ P YSK   R  +A    GN  DA+     VL L GD
Sbjct: 151 AVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K YD AI  ++ A+++ E P  V YSN SACY S+      ++ + + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ G+G+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKALEI 161
           GN+ ++ +++D+A+  YN A E   D  + +N SA     GD    +K + E   K  E+
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 162 KPDYSKVLLRRASANEGLGNFADAMFDL 189
           + DY KV+   A +   +GN    + DL
Sbjct: 330 RADY-KVI---AKSFARMGNCYTKLNDL 353

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G  YF    + +A+K Y   ++   ED   YSN +A    +    + ++   KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 165 YSKVLLRRASANEGLGNFADAMFDL 189
           + +  +R+A+A   +  F+ A+  L
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETL 488

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K+Y+ A+  ++ A+E+  +P  V YSN SACY S+      +  + +  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A+ GLG+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 55  SQKKAEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKD---KYALALKDKGNQYFR 111
           ++K  E       E+K    P S   EP  +   N   ++ D   K A A KD+GN+ ++
Sbjct: 211 AEKTPEAPVAATKETKTETVPESKEKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYK 270

Query: 112 NKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKALEIKPDY-- 165
             K+D+AI++Y+ A EL  D  + +N +A     GD    +K + +   K  E++ DY  
Sbjct: 271 AHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKI 330

Query: 166 -SKVLLRRASANEGLGNFADA 185
            +K   R  +A E L +   A
Sbjct: 331 IAKAFTRMGNAYEKLNDLKKA 351

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 105 KGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G  +F   ++ DA+K Y   +    +D   YSN +A    +    + +    KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSVL-SLNGDFNDAS 202
           ++ K  +R+A+A   +  ++ A+  L +  S + + N+ S
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGS 497

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 355 KAIELFPRVNSYIY--MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQN 412
           KAIE+ P  N  +Y   +         T+  N  ++  K+NP  S  Y   G  ++ L +
Sbjct: 30  KAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINPTWSKGYNRVGAAHYGLGD 89

Query: 413 YDQAGKDFDKAKELDPEN 430
            D+A K + KA ELD  N
Sbjct: 90  LDEAEKSYKKALELDASN 107

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLK 149
            +EE  + AL  K++GN + + KKY +A++YY+ A+EL +   +F+SN +   + + +  
Sbjct: 4   VSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFL 63

Query: 150 KVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +E   K++E+ P   K + RR  +  GL  F+ A  DL  +
Sbjct: 64  TALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 381 EYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           E   Y+ KA++L+   S  + +R      L N+  A +D +K+ ELDP+NI
Sbjct: 30  EAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F +K ++ AI+ +  A+E+   P  V YSN SA Y S    ++ +  +T+ ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A  GLGN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++  K+D+AI+ YN A  L +D  + +N SA     GD +  +    +A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 160 -EIKPDY 165
            E++ DY
Sbjct: 319 RELRADY 325

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y+  ++   ED   YSN +A    +    + ++    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 165 YSKVLLRRASANEGLGNFADAM 186
           + +  +R+A+A   +  +A+A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 45/103 (43%), Gaps = 16/103 (15%)

Query: 337 GIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY----MALIMADR-----NDSTEYYNYFD 387
           G   F   D   A E   KAIE+ P  N  +Y     A   A +     ND+TE      
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATE------ 65

Query: 388 KALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
             +K+NP  S  Y   G   F L N ++A K++ +A +LD  N
Sbjct: 66  -CVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y+ A + +  A+++ E P  V YSN SACY S+    + ++ + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P +SK   R  +A  GL N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 18/119 (15%)

Query: 75  PVSSNGEPDF----SKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE 130
           P+  N EP+      K     AEE+       K +GN++++ +K+D+AI++YN A EL +
Sbjct: 227 PLKENNEPEPMEVDEKGPQVAAEEE-------KAEGNKFYKARKFDEAIEHYNKAWELHK 279

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKAL----EIKPDY---SKVLLRRASANEGLGNF 182
           D  + +N +A     GD +  +   T A+    E++ DY   +K   R  +A   LG+ 
Sbjct: 280 DITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDL 338

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 2/99 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   ++   +D   YSN +A    +    + +    +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDAS 202
           + +  +R+ASA   +  FA A+  L +V + + + N+ +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGA 487

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 387 DKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           ++ +K+NP  S  Y   G   F L N + A K + KA ELD  N
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 87  KANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYV 143
           K N  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E L  + V+Y+N +A Y 
Sbjct: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYS 142

Query: 144 SVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           S+   ++ V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 143 SLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 75  PVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV 133
           P  S+ EP      +  A E  + A  LK +GN+ F  K ++ A+K Y  A+EL   + V
Sbjct: 73  PTLSSSEPT-GNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192
           FY N +A Y S    ++ V  +  A+ I P YS+   R   A   LG   +AM     VL
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191

Query: 193 SLNGD 197
            + GD
Sbjct: 192 DIEGD 196

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLK 149
             +E  + AL  K++GN Y + KKY +A++YY+ A+EL +   +++SN +   + + +  
Sbjct: 2   VTQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFL 61

Query: 150 KVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
              E   KA+ + P   K + RR  +  GL  F  A  DL V+
Sbjct: 62  TAQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 385 YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           Y+ KA++L+   S  + +R      L N+  A +D DKA  LDP+NI
Sbjct: 32  YYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNI 78

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y  AI  +  A+E+ E P  V YSN SACY S    ++ ++ + + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           +I P +SK   R  +A  GL    +A
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEM 154
           A A K +GN+ ++ +++++AI++YN A EL +D  + +N SA     GD    +K + + 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDA 305

Query: 155 STKALEIKPDYSKV 168
             +  E++ DY  +
Sbjct: 306 VEQGRELRADYKTI 319

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G ++F    + +A+K Y   ++   +D   +SN +A    +    + +E   KA+ I P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 164 DYSKVLLRRASANEGLGNFADAMFDLSV 191
           ++ +  +R+A+A   +  FA A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query: 333 LEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY--MALIMADRNDSTEYYNYFDKAL 390
            +  G   FL  D + A +   KAIE+    N  +Y   +   A      E     ++ +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 391 KLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           K++P+ S  Y   G   F L   D+A K + +A ELD  N
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 107/261 (40%), Gaps = 41/261 (15%)

Query: 271 ANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLA 330
           A Y   N    +L  G+  LY R   S D A+E+F K  +L +   +K+NE   +  +L 
Sbjct: 120 ALYHLSNPNVPKLWHGIGILYDRY-GSLDYAEEAFAKVLEL-DPHFEKANE---IYFRLG 174

Query: 331 ISLEHTG-------IFKFLKNDP-------------------LGAHEDIKKAIELFPRVN 364
           I  +H G        F+++   P                   +G     ++A E     N
Sbjct: 175 IIYKHQGKWNQALECFRYILPQPPAPLQEWDIWFQLGSVLENMGEWHGAREAYEHVLLQN 234

Query: 365 SY---IYMALIMADRNDSTEYY------NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQ 415
            +   +   L      ++ ++Y      N+  K+L++NP++++ +YH G+++ I  +Y  
Sbjct: 235 EHHAKVLQQLGCLYGMNTVQFYDPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTA 294

Query: 416 AGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL 475
           A   F +A   D  N   +  +  L Y+ +++ D    ++ A R  P   EV      + 
Sbjct: 295 AYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 354

Query: 476 -TDKNDFDKALKQYDLAIELE 495
            T  N    AL  Y  A  L+
Sbjct: 355 ETCNNQLTDALDAYKQAARLD 375

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K Y  AI  +  A+E+ E P  V YSN SA Y S    ++ +  + + ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           I P ++K   R+ +A +GL  + +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKAL--- 159
           K +GN+ ++ +++D+AI +YN A E  +D  + +N SA     GD +  ++  T+A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 160 -EIKPDYSKV 168
            E++ DY  V
Sbjct: 315 RELRTDYKIV 324

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    + +A+K Y   ++   +D   YSN +A    +      +    KA+E  P 
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSV 191
           + +  LR+A+    +  FA A+  L +
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDL 478

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 93  EEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKV 151
           EE+   A  LK +GN+    K Y+ AIK Y+ A+E L  + V+Y+N +A Y S+      
Sbjct: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDA 146

Query: 152 VEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           V  +  A+++ P YSK   R   A    G   DA+     VL + GD
Sbjct: 147 VNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN Y +++ Y  AI+ Y  A+EL     +FYSN +  ++ + + +  +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           A+++  +  K   RR  A  GL  F  A  DL++L L    NDA+ +  LE   +     
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL-LKYKPNDATAKRGLEMCESFIREE 130

Query: 218 RLKEKFGDVDAA 229
           R K+  G  D  
Sbjct: 131 RFKKAIGGDDHG 142

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           K +GN  F  K +  A++ +  A++  E+P  V YSN S  Y S+    + +  +T+ ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 161 IKPDYSKVLLRRASANEGLGNFADA 185
           IK D+SK   R  +A+ GLGN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGD----LKKVVEMSTKA 158
           K +GNQ ++ +K+D+AI  Y  A  L++D  + +N +A     GD    +K + E   + 
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 159 LEIKPDYSKV 168
            E++ DY  +
Sbjct: 322 RELRADYKVI 331

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 106 GNQYFRNKKYDDAIKYYN-WALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G +YF    +  A+K Y+   +    D   YSN +A    +      ++   KA+EI P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 165 YSKVLLRRASANEGLGNFADAMFDLSV 191
           + +  +R+A+A   +  ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN++  +K Y  AI+ Y  A+EL     +F+SN +   + +   +  +E S+K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+E+     K   RR  A  GL +F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +GN+    KK+D+AI+ Y  A+E+   + V+YSN +A Y S+   ++ V+ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 164 DYSKVLLR 171
            YSK   R
Sbjct: 161 TYSKGFSR 168

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 12/112 (10%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           +  A++++P+N+  Y +R      L+ Y+QA KD ++A E+DP     + +L    Y  N
Sbjct: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELE 495
           K ++    +           +V +   E  TD  K D++ A K+ + ++ LE
Sbjct: 178 KPEEALDAYK----------KVLDIEGEKATDVMKRDYETAKKKVETSMNLE 219

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDP--VFYSNLSACYVSVGDLKKVVEMSTKAL 159
            K +GN  F  K Y+ A + +  A+E  E P  V YSN SAC+ S+    + +  + + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           +I P +SK   R  +A  GLG   +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 57/97 (58%), Gaps = 7/97 (7%)

Query: 97  KYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMST 156
           K A A K +GN++++ +K+D+AI++YN A +L +D  + +N SA     GD ++ ++  T
Sbjct: 265 KNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLT 324

Query: 157 KAL----EIKPDY---SKVLLRRASANEGLGNFADAM 186
           +A+    E++ DY   SK   R  +A   L +F  A+
Sbjct: 325 EAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 105 KGNQYFRNKKYDDAIKYYN-WALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKP 163
           +G +YF    + +A+K Y        ED   YSN +A    +    + ++    A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 164 DYSKVLLRRASANEGLGNFADAMFDL 189
           ++ +  +R+A+A   +  FA A+  L
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETL 492

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 102/250 (40%), Gaps = 42/250 (16%)

Query: 283 LMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFK-- 340
           L  G+  LY R   S + A+E+F K  +L + + DK+NE   +  +L I  +H G F   
Sbjct: 141 LWHGIGILYDRY-GSLEYAEEAFAKVLEL-DPKFDKANE---IYFRLGIIYKHQGKFNQA 195

Query: 341 ------FLKNDP------------------LGAHEDIKKAIELFPRVNSYIYMAL----I 372
                  L N P                  +G  E+ K A E     N      L     
Sbjct: 196 LDCFNYILTNPPQPLKQWDIWFQIGNVLENIGVWENAKIAYENVLLQNDRHAKVLQQLGC 255

Query: 373 MADRNDSTEYYN------YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKEL 426
           +   N++  +YN      Y  ++L+++  +S+ +YH G+++ I  +Y+ A + F +A   
Sbjct: 256 LYAMNNNLNFYNPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNR 315

Query: 427 DPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKAL 485
           D  N   +  +  L Y+  ++ D    ++ A R  P   EV      +  T  N    AL
Sbjct: 316 DARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 375

Query: 486 KQYDLAIELE 495
             Y  A  LE
Sbjct: 376 DAYKQAARLE 385

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158
           A ALK +GN+     +Y++AIK Y  A++  ++  +YSN S  Y  +G  +  V  +T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 159 LEIKPDYSKVLLRRASANEGLGNFADAM 186
           + I P +SK   R   A        D M
Sbjct: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 88/208 (42%), Gaps = 31/208 (14%)

Query: 61  GSKKTASESKAPVY--PVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDA 118
           G+   A  ++   Y   V+ +G P   ++ + TA      AL  K++GN++ + K Y  A
Sbjct: 2   GALTCAGRARNACYVRTVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARA 57

Query: 119 IKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANE 177
           ++ Y  A+E      +F+SN +   + +   +  +E S +A+E+     K   RR  A+ 
Sbjct: 58  VEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHC 117

Query: 178 GLGNFADAMFDLSVLSLNGDFNDASIEPML---ERNLNKQAMSRLKEKFGDVDAATATPT 234
           GL  +  A  DL V+ +     D ++   L   ER L ++   R     GD         
Sbjct: 118 GLLEWGPAKRDLEVV-VRAKPGDEAVRRALEVCERMLRRERFERAIRADGD--------- 167

Query: 235 ELSTQPPKERKDKQENLPSITSMASFFG 262
                      ++Q  L    S+ASF G
Sbjct: 168 -----------EEQRRLCKTLSLASFAG 184

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 77/153 (50%), Gaps = 9/153 (5%)

Query: 85  SKKANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSAC 141
           S K N   E+ +  A A   K +GN+    K Y  AI+ Y+ A++ L  + ++Y+N +A 
Sbjct: 83  SVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAA 142

Query: 142 YVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM-FDLSVLSLNGDFND 200
           Y SV +    ++ + KA+EI P YSK   R A A   L    +A+ +   VL + GD   
Sbjct: 143 YSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD--- 199

Query: 201 ASIEPMLERNLNKQAMSRLKEKFGDVDAATATP 233
               P ++R+  + A +R++       ++T TP
Sbjct: 200 -KATPAMKRDF-EMAKNRVESSMNLEKSSTTTP 230

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+K  P N   Y +R      ++ YD A KD +KA E+DP     Y +LA   Y  N
Sbjct: 122 YSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALN 181

Query: 446 K 446
           K
Sbjct: 182 K 182

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 2/102 (1%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKK 150
           A + DK AL  K++GN   + + Y  AI+ Y+ A+EL +   V++SN + C++ + + + 
Sbjct: 3   ATDADK-ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQC 61

Query: 151 VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +   KAL + P   K   RR  A  GL  F  A  DL+V+
Sbjct: 62  ASQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           +DKA++L+   S  + +R   +  L N+  A +D DKA  LDP+N+  Y +  LAC+   
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLL 91

Query: 444 ENK 446
           E K
Sbjct: 92  EFK 94

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 98/220 (44%), Gaps = 40/220 (18%)

Query: 283 LMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTG----- 337
           L  G+  LY R   S D A+E+F K  +L + Q +K+NE   +  +L I  +H G     
Sbjct: 160 LWHGIGILYDRY-GSLDYAEEAFAKVLEL-DPQFEKANE---IYFRLGIIYKHQGKWNQA 214

Query: 338 --IFKFLKNDPLGAHEDIKKAIEL---FPRVNSY-----IYMALIMADRN---------- 377
              F+++   P    ++     +L      +N +      Y  +++ + N          
Sbjct: 215 LECFRYILPQPPAPLQEWDIWFQLGSVLESMNEWQGAKEAYEHVLLQNDNHAKVLQQLGC 274

Query: 378 ----DSTEYY------NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
               ++ ++Y      NY  K+L+++P++++ +YH G+++ I  +Y  A   F +A   D
Sbjct: 275 LYGMNNVQFYDPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRD 334

Query: 428 PENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEV 467
             N   +  +  L Y+ +++ D    ++ A R  P   EV
Sbjct: 335 SRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEV 374

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 4/119 (3%)

Query: 83  DFSKKANFTAE--EKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLS 139
           D + K N T +  E  + A ALK +GN+    K Y+ AIK Y  A+  L  + V+++N +
Sbjct: 82  DETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRA 141

Query: 140 ACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           A Y S+    + VE +  A++I P YSK   R   A    G   DA+     VL + GD
Sbjct: 142 AAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 85  SKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYV 143
           + K NF+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182

Query: 144 SVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186
            V D +  +  +   + I  ++SK  +R A+       + DA+
Sbjct: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 85  SKKANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSAC 141
           S K N  AE+ +  A A  LK +GN+    K +D AIK Y+ A+E L  + V+Y+N +A 
Sbjct: 81  SIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAA 140

Query: 142 YVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           + S+   ++ ++ +  A++  P YSK   R   A   LG   DA+     VL + GD
Sbjct: 141 HSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 1/119 (0%)

Query: 378 DSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQL 437
           D  +  NY  K+L+++P++++ +YH G+++ +  +Y  A   F +A   D  N   +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 438 ACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEIL-TDKNDFDKALKQYDLAIELE 495
             L Y+ +++ D    ++ A R  P   EV      +  T  N    AL  Y  A  L+
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 414

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 11/143 (7%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  A + Y+ A+EL     +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMS 217
           A+E+ P   K   RR  +  GL  F  A  DL ++ L    N    EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-LRAKPN----EPVATRALDVCERV 126

Query: 218 RLKEKF-----GDVDAATATPTE 235
             KEKF     G  DA T    E
Sbjct: 127 IRKEKFEKAISGGSDAVTVNVCE 149

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFIL 410
           ED+ KA+E   + N +I       + + + E Y+   KA++L+   S  + +R   +  L
Sbjct: 7   EDVNKALEFKNQGNVFIKGK----NFSKAAELYS---KAIELDGTQSIYFSNRAFAHLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D +KA ELDP+N+  Y
Sbjct: 60  DNFQTALNDCNKAIELDPKNVKAY 83

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN   + + Y  AI+ Y  A++L +   +++SN +  ++ + + +  +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDAS 202
           ALEI P   K   RR  +  GL  F +A  DL ++ L    NDA+
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-LASKPNDAT 115

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 352 DIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQ 411
           D  KA+E   R N     A+   D   + E Y    +A+KL+   S  + +R   +  + 
Sbjct: 8   DAAKALEFKNRGND----AIKTQDYPGAIELYT---EAIKLDDTVSIYFSNRAMGHLKMD 60

Query: 412 NYDQAGKDFDKAKELDPENIFPY 434
           N+     D DKA E+DP+NI  Y
Sbjct: 61  NFQSGINDCDKALEIDPKNIKAY 83

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 93  EEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKV 151
           EE    A  LK +GN+    K +D AI  Y+ A+ +   + ++Y+N +A Y S+ D +K 
Sbjct: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKA 152

Query: 152 VEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            E +  A+ + P+YSK   R   A   L    +A+     VL L GD
Sbjct: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+ ++PNN+  Y +R      L+++++A +D + A  +DP     Y +L    Y  N
Sbjct: 122 YSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALN 181

Query: 446 K 446
           K
Sbjct: 182 K 182

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKK 150
           ++E    AL  K+KGN+Y +   YD AI++Y+ A+ L     +++SN +  ++   +   
Sbjct: 5   SQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYS 64

Query: 151 VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            V     AL++ P   K   RR  +  G+  F  A  DL+V+
Sbjct: 65  AVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 6/105 (5%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGD 147
           TAE+  K A+  K++GN + + + Y  AI+ Y  A+EL  DP   +FYSN +   + + +
Sbjct: 5   TAEDIAK-AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDN 61

Query: 148 LKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            +       +AL +     K   RR  AN GL  F  A  DL+V+
Sbjct: 62  FQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFIL 410
           EDI KA+E     N +I          + ++    + KA++L+PN S  Y +R      L
Sbjct: 7   EDIAKAVEFKNEGNVFI-------KEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKL 59

Query: 411 QNYDQAGKDFDKAKELDPENIFPY 434
            N+  A  D ++A  LD +N+  Y
Sbjct: 60  DNFQSAYNDCNEALTLDSKNVKAY 83

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           A++I P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 370 ALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429
           A+ M D + + E Y    +A+K+ P N+  Y +R   +  L+ +++A KD + A ++DP 
Sbjct: 111 AMAMKDFHLAVEKYT---EAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167

Query: 430 NIFPYIQLACLAYRENKFDDC 450
               Y +LA   Y   K ++ 
Sbjct: 168 YSKGYSRLAFAKYGLGKHEEA 188

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP-----VFYSNLSACYVSVGDL 148
           E  + A   K++GN+ ++ K+Y DA + YN  +E+K D        +SN +AC + + + 
Sbjct: 73  EPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNY 132

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ V    +AL+  P   K   R A A   L    DA   +    L  D   A+++ +L+
Sbjct: 133 RRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQ 191

Query: 209 RNLNKQ 214
           + + ++
Sbjct: 192 KVIKRE 197

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A+A K++GN Y + + Y  AI+ Y+ A+EL  DP   +F+SN +   + + + +  +   
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 156 TKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             AL + P   K   RR  ++ GL     A  DL V+
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%)

Query: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFD 188
           KE  V + N    Y+   +  K +E+ ++A+E+ P  S     RA A   L NF   M D
Sbjct: 9   KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMND 68

Query: 189 LSV 191
             V
Sbjct: 69  CDV 71

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           + +A++L+P  S  + +R      L N+     D D A  LDP+NI  Y
Sbjct: 35  YSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPKNIKAY 83

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA   Y  AL++K D +      Y NL+AC + + + 
Sbjct: 65  EPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNY 124

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186
           +  +    +AL++     K   R   A   LG F D++
Sbjct: 125 RSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NYD +   F   ++L P  +      + L +  +       L +E     P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
           AP+        L+ + D + A+K ++ A +++      Y     L G       + + ++
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYT----LQGH-----EHSSNDS 584

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
           F  A N   KA   DP+   A  GL    ++    DEA++ FE++  +
Sbjct: 585 FDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 79/196 (40%), Gaps = 45/196 (22%)

Query: 350 HEDIKKAIELFPRVN-SYIYMALIMADRNDSTEYY----NYFDKALKLNPNNSSVYYHRG 404
           HED  KA E   +V+ ++ Y   +    + S + +    N + KAL  +P + + YY  G
Sbjct: 551 HEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLG 610

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENI-------------------FPYIQLAC------ 439
                L  YD+A   F+KA+ ++P N+                     Y +LAC      
Sbjct: 611 MSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPSS 670

Query: 440 ---------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFFA---EILTDKNDFDKALKQ 487
                    L Y   ++      F E  +  P+   V        +IL  K D   A+K+
Sbjct: 671 SLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVHFLLGQLYQILGRKKD---AVKE 727

Query: 488 YDLAIELENKLDRIYV 503
           + +A+ L+ K +++ +
Sbjct: 728 FTIAMNLDPKGNQLII 743

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 58/131 (44%)

Query: 365 SYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAK 424
           ++  M   ++ + D  +    F+KA +++PN +  Y  +G  +    ++D A   + KA 
Sbjct: 537 TWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKAL 596

Query: 425 ELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKA 484
             DP++   Y  L     +  ++D+    F +A+   P    +       L      +KA
Sbjct: 597 ACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKA 656

Query: 485 LKQYDLAIELE 495
           L  Y+LA EL+
Sbjct: 657 LSYYELACELQ 667

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 23/163 (14%)

Query: 81  EPDFSKKANFTAE---------EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK-- 129
           E D  K AN   E         E  + A   K++ N  ++ K++ +A + Y   +E+K  
Sbjct: 51  ETDGDKGANLELEALKALAYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCN 110

Query: 130 EDPV---FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA- 185
           +D V    ++NL+AC + + + ++ + +  KAL+  P   K   R A A   L    +A 
Sbjct: 111 DDKVNESLFANLAACELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAK 170

Query: 186 ---MFDLSVLSLNGDFNDASIEPMLERN---LNKQAMSRLKEK 222
               F L++ S N      ++E +++R    L++  + RL+EK
Sbjct: 171 ESVKFGLTIDSENKSLQ--TLEGVIDRKQQELHEAEVKRLEEK 211

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
           A + KD+GN++ + + +  A + Y  A+E   DP   +FYSN +   + + +    +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 156 TKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           T A+E+     K   RR  AN GL NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 54/130 (41%), Gaps = 26/130 (20%)

Query: 340 KFLKN-DPLGAHEDIKKAIELFP--------RVNSYIYMALIMADRNDSTEYYNYFDKAL 390
           KFLK  D   A+E   KAIE  P        R  + + +   M   ND T        A+
Sbjct: 18  KFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCT-------NAI 70

Query: 391 KLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDC 450
           +LN +N   Y+ RG  N  L N+  A  DF+   +  P +I            +N FD C
Sbjct: 71  ELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTC 120

Query: 451 ETLFSEAKRK 460
           E +  E + K
Sbjct: 121 EKVIREERFK 130

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 87  KANFTAE--EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYV 143
           K N  AE  E    A ALK +GN+    K ++ AI  Y+ A+E L  + ++Y+N +A + 
Sbjct: 79  KVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHS 138

Query: 144 SVGDLKKVVEMSTKALEIKPDYSK 167
           S+    + V  + KA+EI P YSK
Sbjct: 139 SLKQYDEAVVDAEKAIEIDPAYSK 162

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+++ P N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175

Query: 446 K 446
           K
Sbjct: 176 K 176

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 34/128 (26%)

Query: 103 KDKGNQYFRNKKYDDAIKYY---------NWALELKEDPVFYSNLSACYVSVGDLKKVVE 153
           KD+G ++F+   Y  A + Y         N AL +    V YSNL+A    VG+ K+ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 154 MSTKALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVL 192
               ALE+ P                      + K++ RRA A E + N+  A+ D   L
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 193 SLNGDFND 200
               +FND
Sbjct: 393 IEKNNFND 400

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 82  PDFSKKANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNL 138
           P  S K N   E+ +  A A  LK +GN+    K ++ A+  Y+ A++ L  + V+Y+N 
Sbjct: 78  PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANR 137

Query: 139 SACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           +A + S+   ++ V+ +  A+++ P YSK   R   A   LG
Sbjct: 138 AAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+++ P N+  Y +R   +  L+ Y++A KD + A +++P     Y +L    Y   
Sbjct: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELE 495
           K ++    +           +V +   E  TD  K D+D A+K+   ++ +E
Sbjct: 180 KPEEALDAYK----------KVLDIEGEAATDAMKRDYDTAMKKVGQSLNVE 221

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL LK++GN++ + K Y  A +YY  A+E   E+ + YSN +   + + + +  ++ + +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+E+  +  K   RRA +  GL  F  A  DL ++
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 385 YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLA 438
           Y+ KA++ +P N+ +Y +R   N  L N+  +  D  +A ELD  N+  Y + A
Sbjct: 35  YYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKAYHRRA 88

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 92  AEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKK 150
           AE K K A ALK +GN+   +K YD A++ Y  A++ L  + V+++N +A Y +  +  +
Sbjct: 95  AETKAK-AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDE 153

Query: 151 VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
            V+ + +A+++ P YSK   R A A     NF +++     VL + GD
Sbjct: 154 AVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+K+ P N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183

Query: 446 KFDD 449
            F++
Sbjct: 184 NFEE 187

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 69/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+ A   F +  EL P  I      + L +    +    +L       +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ K D + A++ ++ A +++ K    Y     L G         + ++
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYT----LQGHEC-----SSNDS 600

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
           F  A     KA   DPR   A  G+    ++    DEA++ FE++  +
Sbjct: 601 FDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 13/188 (6%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA K++P  +  Y  +G       ++D A K F KA   DP +   Y  +   + +  
Sbjct: 574 FEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE--NKLDRIYV 503
            +D+    F +A++ +P    +       L      DKAL+ Y+LA  L+  + L R   
Sbjct: 634 HYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTLQPNSNLARF-- 691

Query: 504 GIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIM 563
                  +A LL     +  +  A    E+ SKL P        L Q+       +EAI 
Sbjct: 692 ------KRANLLY---AMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEAIR 742

Query: 564 LFEESADL 571
            F  + +L
Sbjct: 743 EFTVAMNL 750

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 96/221 (43%), Gaps = 4/221 (1%)

Query: 283 LMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFL 342
           L+D L   Y   PE++     ++    K  E+ ++   +  K+  K A +    G  +  
Sbjct: 539 LVDYLLTYYPNKPETWCCVG-NYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQG-HECS 596

Query: 343 KNDPL-GAHEDIKKAIELFPR-VNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVY 400
            ND    A +  +KAI   PR  N+Y  M +         E   YF+KA ++ P N+ + 
Sbjct: 597 SNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLI 656

Query: 401 YHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRK 460
              G     L+  D+A + ++ A  L P +     + A L Y   +++     F E  + 
Sbjct: 657 CCCGVALEKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKL 716

Query: 461 FPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRI 501
            PE P V     ++       ++A++++ +A+ L+ K +++
Sbjct: 717 TPEEPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPKGNQL 757

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 75/172 (43%), Gaps = 15/172 (8%)

Query: 81  EPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE------DPVF 134
           EP  S+K      E+   A+ LK +GN+    + Y DAI  Y  A++L +      D  +
Sbjct: 69  EPKLSEKERELVNEQ---AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125

Query: 135 YSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLS 193
            SN S      G  ++  + +   ++I P +SK   R A A  G   + DAM     VL 
Sbjct: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185

Query: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQ--PPKE 243
           L G  N A+     +  + KQ    L      +D+ +ATP   +    PPK+
Sbjct: 186 LEG--NKATDTMKRDFEITKQKFETLNFS-THIDSGSATPISEAANKYPPKD 234

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYY----NY 385
           +IS    G +  L ND   A + +KKA  + PR   + Y   +      S + +    N 
Sbjct: 618 SISWCFIGNYFSLINDHDKAIKYLKKATTINPR---FTYAYTLEGHEQASIDAFDTAKNC 674

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441
           + KA+  +PN+ + YY  G     L  YDQA   F+KAK ++P N    I L C  
Sbjct: 675 YRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCG 727

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 74/197 (37%), Gaps = 26/197 (13%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPEN-----IFPYIQLACLAYRENKFDDCETLFSEAK 458
           G++ F + NY  +   F K  +L P       IF  + L  L  + N     +TL     
Sbjct: 557 GKLQFEIVNYKLSINYFKKLYDLQPTRLKDFEIFSTV-LWHLKDKINLSQISKTLIDNYP 615

Query: 459 RKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRN 518
                   + N+F+ I    ND DKA+K    A  +  +    Y     L G        
Sbjct: 616 NNSISWCFIGNYFSLI----NDHDKAIKYLKKATTINPRFTYAYT----LEGH-----EQ 662

Query: 519 PTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEES-------ADL 571
            +++ F  A N   KA   DP    A  GL    ++    D+A++ FE++       A L
Sbjct: 663 ASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNAIL 722

Query: 572 ARTMEEKLQAITFAEAA 588
                  L+ + F E A
Sbjct: 723 LCCCGSALEKLNFNEKA 739

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEI 161
           K++GN+ F+   Y  A + Y   ++++ E+P+ YSN +   + +G   +VVE+  K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 162 KPDYSKVLLRR 172
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 582

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
              A     KA   DP+   A  GL    ++    +EA++ FE++  +
Sbjct: 583 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 375 DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  +P + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 581 DSSDSAK--TCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 635

Query: 435 IQLACLA 441
           + + C  
Sbjct: 636 VLICCCG 642

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +L+PN +  Y  +G  +    + D A   + KA   DP++   Y  L   + +  
Sbjct: 556 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 615

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      +KAL+ Y+LA  L+
Sbjct: 616 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 665

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            +K++GN  FRN  +  A +YY   + L+ E+P+ YSN +   + +    + ++   + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 160 -------EIKPDYSKVLLRRASANEGLGNF 182
                  + +P   K+L R   A E L  F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 589

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
              A     KA   DP+   A  GL    ++    +EA++ FE++  +
Sbjct: 590 SDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +L+PN +  Y  +G  +    + D A   + KA   DP++   Y  L   A +  
Sbjct: 563 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLG 622

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      +KAL+ Y+LA  L+
Sbjct: 623 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 672

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 4/125 (3%)

Query: 355 KAIELFPRVNSYIYMALIMA--DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQN 412
           +AI++  R  ++ Y  + +A  +R   +E   +F  AL+++PN+   +   GQ  F    
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 413 YDQAGKDFDKAKELDPENIFP-YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
            + + K F+KA E+DP +++  Y     LA     F++C  +     +  PE       +
Sbjct: 735 VEASTKVFEKAIEIDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVSY 793

Query: 472 AEILT 476
           + IL 
Sbjct: 794 SSILV 798

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 71/148 (47%), Gaps = 7/148 (4%)

Query: 54  GSQKKAEGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKD--KYALALKDKGNQYFR 111
           GS   A G K  A    A     SS GE   + K N  AE+ +    A +LK +GN+   
Sbjct: 49  GSSSAAFGGKNLAELLSAGAGAPSSQGE---NVKVNIPAEDAELKSKAESLKLEGNKAMA 105

Query: 112 NKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLL 170
            K Y+ AIK Y+ A+ +   + V+Y+N +A + S+ +  + ++ +  A+++   YSK   
Sbjct: 106 GKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYS 165

Query: 171 RRASANEGLGNFADAMFDL-SVLSLNGD 197
           R   A    G   +A+     VL + GD
Sbjct: 166 RLGYAKFAQGKSEEALEAYKKVLDIEGD 193

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 13/116 (11%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+ + P N+  Y +R   +  L+NYD+A KD + A ++D      Y +L    + + 
Sbjct: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFDKALKQYDLAIELENKLD 499
           K +  E L  EA +K      V +   +  TD  K D++ A ++ + A+EL NK D
Sbjct: 176 KSE--EAL--EAYKK------VLDIEGDSATDVMKRDYETAKRKVEQALEL-NKTD 220

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK+Y+ AIK Y  A++ L  + ++Y+N +A + S+ +  + ++ +  A+ 
Sbjct: 105 LKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164

Query: 161 IKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197
           + P Y +   R   A    G   +A+     VL + GD
Sbjct: 165 VDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + +A+ + P N+  Y +R   +  L+ YD+A KD + A  +DP     Y +L    Y + 
Sbjct: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184

Query: 446 K 446
           K
Sbjct: 185 K 185

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + YN A+++K D        Y+N +AC + + + 
Sbjct: 69  EPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNY 128

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA 185
           ++ +     AL + P   K   R A A   +  F D 
Sbjct: 129 RRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 378 DSTEYYNYFDKALKLNPN----NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433
           D+ E YN   KA+ +  +    N S+Y +R      L+NY +   D   A  L+P+NI  
Sbjct: 92  DARELYN---KAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKC 148

Query: 434 YIQLACLAYRENKFDDC 450
           Y ++A       KFDDC
Sbjct: 149 YFRMAKAFLAIEKFDDC 165

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK KGN +F+N  Y+ AI YY  A  L   +P+++SN++   + +   ++ V    K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           AL++ P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ L+   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVF-----YSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y   L ++ +  F     ++N +AC + + + 
Sbjct: 78  EPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNY 137

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASA 175
           ++ +E  +KAL I P  +K   R + A
Sbjct: 138 RRCIEDCSKALSINPKNTKCYYRTSKA 164

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 93  EEKDK----YALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGD 147
           EE+DK     A ALK +GN+    K Y+ A++ YN A++L     V+Y+N +A Y S   
Sbjct: 93  EEEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEK 152

Query: 148 LKKVVEMSTKALEIKPDYSKVLLR 171
             + ++ +  A++++P++SK   R
Sbjct: 153 YDEAIKDAESAIKVEPNWSKGYSR 176

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 88/204 (43%), Gaps = 22/204 (10%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  +R ++Y DA + YN  +E+  D        + N +AC + + + 
Sbjct: 75  EPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNH 134

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +    +AL   P   K   R   A   L    +A   +    L  D N+A++  +L+
Sbjct: 135 RRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLD 193

Query: 209 RNLNK-----------QAMSRLKEKFGDVDAATATPTELS----TQPPKERKDKQENLPS 253
           + + K           +   + KE+ G +  A      +S    +QPP+  KD + +L +
Sbjct: 194 KIVKKDEEIKAYEAKKENEKKEKERLGAILQAAVVVRNISIVNTSQPPELVKDAKISLEN 253

Query: 254 ITSMASFFGIFKPELTFANYDEFN 277
              + S   IF   + +   DEF+
Sbjct: 254 EEDIESQL-IFPSMVMYPTTDEFD 276

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYN--WALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y+   A+E ++  +    Y+N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNY 137

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASA 175
           ++ +E  +KAL I P   K   R + A
Sbjct: 138 RRCIEDCSKALTINPKNVKCYYRTSKA 164

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 396 NSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS 455
           N S+Y +R      L+NY +  +D  KA  ++P+N+  Y + +   ++ NK ++ ++  +
Sbjct: 120 NESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAAT 179

Query: 456 EAKRKF-PEAPEVPNFFAEILTDKNDFD-KALKQYDLAIELENK 497
            A ++  PE   + N  + I   + +   K  KQ   A E ENK
Sbjct: 180 FANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENK 223

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 27/169 (15%)

Query: 378 DSTEYYN------YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++ E+YN      +  K+L+L+P +S+ +Y+ G+++   +++  A +   +A   D  N 
Sbjct: 389 ENVEFYNLDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNP 448

Query: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKND-FDKALKQYDL 490
             +  +  L Y+  +  D    ++ A R  P   EV      +    ND    AL  Y+ 
Sbjct: 449 IFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYER 508

Query: 491 AIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDP 539
           A+ L+                      NP ++  + A  + +K S+ DP
Sbjct: 509 ALSLD--------------------PENPVIQGRLNALKIQDKKSEYDP 537

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 61/147 (41%), Gaps = 25/147 (17%)

Query: 317 DKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADR 376
           D  +E  +  +K AI+    G    L  D   A + +KKA  L PR  +Y Y        
Sbjct: 444 DLCHELMEQDDKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRF-AYAYTL------ 496

Query: 377 NDSTEYYN---------YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
               EY N          + KAL +NPN+ + +Y  G     L  YD+A   F+KA+ ++
Sbjct: 497 -QGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 555

Query: 428 PENIFPYIQLAC------LAYRENKFD 448
           P N+   +   C      L  RE   D
Sbjct: 556 PVNVI--LNCCCGVALERLGRREKALD 580

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
           LK+ GN+ ++ K Y+ A+ Y+  AL        + YSN +A ++ +    + +E     +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 160 EIKPDYSKVLLRRASANEGLGNFADA 185
           E+ P++ K   R   A  GL    +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G Q+F N++Y  A+K Y   ++     PV + N +A +  +    +V++   KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 165 YSKVLLRRASA 175
           Y K  +R+  A
Sbjct: 496 YIKAYVRKGFA 506

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 6/126 (4%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + YN  +E+K D        Y+N +AC + + + 
Sbjct: 73  EPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNY 132

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +     AL+  P   K   R   A   L    +A   +    L  D ++  ++ +L+
Sbjct: 133 RRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLD 191

Query: 209 RNLNKQ 214
             L KQ
Sbjct: 192 IVLKKQ 197

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+    + VE +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 161 IKPDY 165
           I P Y
Sbjct: 165 IDPTY 169

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+ P N+  Y +R   +  L+ YD+A +D + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%)

Query: 385 YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           YF+KA  +NP N+ +    G     L   DQA   ++ A++L PE   P  + A L +  
Sbjct: 611 YFEKARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSL 670

Query: 445 NKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYV 503
            KF     +F    +  PE   V     +I         A+K+Y +A+ L+   +++ +
Sbjct: 671 GKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIKEYTIALNLDPMGNQVII 729

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 34/178 (19%)

Query: 404 GQMNFILQNYDQAGK------DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS-- 455
           G++++ + NY    +       F   +   P N F  +    L +  +KF    TLF+  
Sbjct: 459 GKLHYEISNYGIVAEILPELTKFPTYENEGPGNFFQLL----LWHLRDKF----TLFNLS 510

Query: 456 -EAKRKFPEAPE----VPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVG 510
            E    FPEAPE    V N+F+ I     D  +A+K ++ A  L+ K    Y     L G
Sbjct: 511 DELMNSFPEAPETWCVVGNYFSLI----KDHGEAIKAFEKATSLDRKFAYAYT----LQG 562

Query: 511 KATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEES 568
                  +   E +  A  +  KA   DP+   A  GL     +    D+A++ FE++
Sbjct: 563 H-----EHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKA 615

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  +R K+Y DA + YN  +++K D        +SN +AC + + + 
Sbjct: 73  EPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNY 132

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA 185
           ++ V    +AL+      K   R A A   L    DA
Sbjct: 133 RRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 6/115 (5%)

Query: 75  PVSSNGEPDFSKKANFTAEEKD--KYALALKDKGNQYFRNKKYDDAIKYYNWALE-LKED 131
           P ++  EP    K N   E+ +    A ALK +GN+    K ++ AI  Y+ A+  L  +
Sbjct: 75  PTATQQEP---VKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSN 131

Query: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186
            V+++N +A Y S+    + VE +  A+++ P YSK   R   A   LG   +A+
Sbjct: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC------ 439
           + KAL +NPN+ + +Y  G     L  YD+A   F+KA+ ++P N+   +   C      
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCCGVALER 552

Query: 440 LAYRENKFD 448
           L  RE   D
Sbjct: 553 LGRREKALD 561

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428
           +++  A +L PN+S   + + Q+ F L  Y  A ++F+K ++L P
Sbjct: 561 DFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTP 605

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 69/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ L NY+ + + F   K L P  +      + L +  N       L SE     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            PE        L+ + +  +A+K ++ A +++ K    Y     L G         + ++
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYT----LQGH-----EYTSSDS 577

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
           F  A     KA   DP    A  GL  + ++    +EA++ FE++  +
Sbjct: 578 FDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 57/146 (39%), Gaps = 34/146 (23%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI-------------- 431
           + KA+  +P + + YY  G ++  L  Y++A   F+KA+ ++P N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 432 -----FPYIQLAC---------------LAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471
                  Y +LAC               L Y   ++      F E K   P+   V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 472 AEILTDKNDFDKALKQYDLAIELENK 497
            +I +       A+K+Y +A+ L+ K
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPK 730

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN++++ K+Y DA + Y   +++K D        Y+N +AC + + + 
Sbjct: 69  EPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNF 128

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASA 175
           +K +E   KAL       K   R   A
Sbjct: 129 RKCIEDCKKALSFNVKNIKCYYRMGKA 155

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYN--WALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y    A+E ++  +    ++N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNY 137

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLE 208
           ++ +E  +KAL I P   K   R + A   L    +A            F + SIEP  +
Sbjct: 138 RRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENK 190

Query: 209 RNLNKQAMSRLKEK 222
             LN  ++   KE+
Sbjct: 191 SILNMLSVIERKEQ 204

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)

Query: 91  TAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLK 149
           TA ++ K AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +
Sbjct: 5   TAADRAK-ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQ 63

Query: 150 KVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
             +    +A+++ P   K   RRA +   L  F  A  DL+VL
Sbjct: 64  SALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ L+   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 161 IKPDY 165
           I P Y
Sbjct: 165 IDPSY 169

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+K+ P N+  Y +R   +  L+ YDQA KD + A  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 113/268 (42%), Gaps = 27/268 (10%)

Query: 363 VNSYIYM-ALIM--ADRNDSTEYYNYFDKAL--KLNPNNSSVYYHRGQMNFILQNYDQAG 417
           +N  +Y+ ALI+  A + DS +    FD  L  ++  N        G+++F + NY  + 
Sbjct: 483 LNDILYIFALILKSASQFDSYKAIRLFDSKLPKQIKNNMPWCQAQLGKLHFEIVNYKTSL 542

Query: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
           K F K + L P  I      + L +  +   +   L +    +F + PE       + + 
Sbjct: 543 KYFKKLRLLQPTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSL 602

Query: 478 KNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKL 537
           + D D+A++ +D A     KLD  +V    L G   L     +++++  A     KA   
Sbjct: 603 QKDHDEAIRAFDKA----TKLDPNFVYAYTLQGHEYL-----SMDSYDTAKTFYRKAISN 653

Query: 538 DPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSD 597
           D     A  G+    ++  + ++A++ FE+    AR++     AI         +K+ + 
Sbjct: 654 DLHHYNAYYGMGMCSMKLGEYEQALVYFEK----ARSINPS-NAILICCCGVTMEKLGNQ 708

Query: 598 PI------LAAKIQET--LAKLREQGLM 617
                   LA +IQ T  LAK +   L+
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLL 736

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 57/134 (42%)

Query: 364 NSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKA 423
           N+Y  M +      +  +   YF+KA  +NP+N+ +    G     L N ++A   ++ A
Sbjct: 659 NAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELA 718

Query: 424 KELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDK 483
            ++ P +     + A L Y   K+      F E  +  PE   V     ++         
Sbjct: 719 CQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKD 778

Query: 484 ALKQYDLAIELENK 497
           A+K+Y +A+ L+ K
Sbjct: 779 AIKRYTIAMNLDPK 792

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            KD+G +YF+   Y  A + Y  +L    K  P   +  SNL A  +  GD   ++ +ST
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL++ P                      +SK++ RRA A E + N+  A     +L  N
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 196 GDFND 200
             FN+
Sbjct: 520 NIFNE 524

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 63/134 (47%), Gaps = 20/134 (14%)

Query: 325 LKEKLAISLEHTGIFKFLKNDP-----LG----AHEDIKKAIELFPRVN----SYIYMAL 371
           L +K+ +++    + K  KN+P     LG      +D K+AI+ F +V     ++ Y   
Sbjct: 544 LHDKIKLTVLSNELLKEFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYT 603

Query: 372 IMADRNDSTEYY----NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELD 427
           + A    S + +    NYF KA+  +  + + YY  G  +  L  ++ A   F+KA+ ++
Sbjct: 604 LQAHEYLSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSIN 663

Query: 428 PENIFPYIQLACLA 441
           P N+   I + C  
Sbjct: 664 PSNV---ILICCCG 674

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 90/217 (41%), Gaps = 12/217 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G ++F + NY+ + K F+K ++L P  +      + L +  +       L +E  ++F  
Sbjct: 504 GMLHFEIVNYEMSLKYFEKLRKLQPTRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKN 563

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D  +A+K    A E   KLD  +     L     L     + ++
Sbjct: 564 EPQTWCCLGNLFSLQKDHKEAIK----AFEKVTKLDPTFTYGYTLQAHEYL-----SDDS 614

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAIT 583
           F  A N   KA   D +   A  G+    ++  + + A++ FE++  +  +    +    
Sbjct: 615 FDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCG 674

Query: 584 FA-EAAKVQQKIRSDPILAAKIQ--ETLAKLREQGLM 617
            A E     +K  S   LA ++Q   +LAK +   L+
Sbjct: 675 VAFEKLSYPEKALSYYELACQVQPSSSLAKFKRAHLL 711

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 105 KGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKAL 159
           +G+ +F+N  Y  A++ Y  +L    +  P   + YSN++A  + +G+   +V+ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 160 EIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDF 198
           ++ P                      +SK++LR+A A E L NF  A      L  N  F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482

Query: 199 ND 200
           +D
Sbjct: 483 SD 484

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSN 137
            K +GNQYF+   Y  AIK Y   +E+  E+P+ YSN
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSN 42

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV-----FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA + Y   +E+K D        Y+N +AC + + + 
Sbjct: 73  EPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNF 132

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA 185
           +  +     AL   P   K   R   A   +  F  A
Sbjct: 133 RSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN+   NK Y+ AI  Y  A++ L  + ++Y+N +A + S+ +  + V+ +  ++ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164

Query: 161 IKPDY 165
           I P Y
Sbjct: 165 IDPSY 169

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%)

Query: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYR 443
           N + +A+++ P N+  Y +R   +  L+ YD+A KD + +  +DP     Y +L    Y 
Sbjct: 123 NKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYA 182

Query: 444 ENK 446
           + K
Sbjct: 183 QGK 185

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  K++GN + + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           A+++ P   K   RRA +   L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ L+   S  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ + P  S+V     +  E   N      D  
Sbjct: 329 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 388

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPP 241
             +   D N+  I   LE      A+++  E  G+++ +   PT  S  PP
Sbjct: 389 KQAARLDVNNVHIRERLE------ALTKQLENPGNINKSNGAPTNASPAPP 433

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK KGN  F+N  Y +AI +YN  + +   +P+ YSN +   +      + +    K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 161 I 161
           +
Sbjct: 66  L 66

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            +++G QYF+N  Y  + + Y  +L       P   + YSN+ A  + +G+  K ++ S+
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALE+ PD                     + KV LR+A A E + +F  A+     L   
Sbjct: 466 SALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEK 525

Query: 196 GDFND 200
           G  ND
Sbjct: 526 GFAND 530

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 30/162 (18%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG+ +F+N  Y ++++ Y  +L       P   +  SN+ A  + VG+  K +E S+
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            AL + P                      + K+++RRA + E L +F++A+     L +N
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQEL-IN 495

Query: 196 GDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATAT--PTE 235
            +F D  I     R  N      +K KF  V  AT+T  PTE
Sbjct: 496 KNFFDEKIMQGKRRCQNFINPPPVK-KFSPVKKATSTQSPTE 536

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 6/111 (5%)

Query: 131 DPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLS 190
           +P+F+ ++   Y  +   +  ++  T+A+ + P  S+V     +  E   N      D  
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 390

Query: 191 VLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPP 241
             +   D N+  I   LE      A+++  E  G+++ +   PT  S  PP
Sbjct: 391 KQAARLDVNNVHIRERLE------ALTKQLENPGNMNKSNGAPTNASPAPP 435

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1430

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 75/375 (20%), Positives = 158/375 (42%), Gaps = 27/375 (7%)

Query: 106  GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
            G  +   ++  ++I+++  AL + KED   +  L   YV  G ++  +++  KA+E+  +
Sbjct: 705  GISHLERQQEAESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSN 764

Query: 165  --YSKVLLRRASANEGLGNFADAMF---DLSVLSLNGDFNDASIEPMLERN----LNKQA 215
              Y+K+ L  + +N  +G + D++    +L++ SL+ +   A+    L        N+  
Sbjct: 765  HLYAKLFLAESLSN--IGEYEDSILLLKELTLSSLDQEVFHATYASTLTNYATDLYNRGF 822

Query: 216  MSR-LKEKFGDVDAATATPTELSTQPPKERKDKQENLPSITSMASFFGIFKPELTFANYD 274
            +++ +K     +D+      +L T P         +L    S+ S       E   + ++
Sbjct: 823  LTKSIKVSVEAIDSIYHLFVDLQTHPQIAWISLFSSLQLFISVQSKIEELPIETLVSIFE 882

Query: 275  EFNKADKELMDGLANLYKRSPESYDRADESFTKAAK---LFEEQLDKSNEDEKLKEKLAI 331
                   E +D +  +   S  S    D++ T A K   L  +    S  + +    +  
Sbjct: 883  TVKNLQIEELDAIDKINLESILS-STDDDNITIACKFLVLSSKCAFTSGTNSETSATVKS 941

Query: 332  SLEH-TGIFKFLKNDPL-------GAHEDIKKAIELFPR-VNSYIYMALIMADRNDSTEY 382
            SL H  G+ + +    L        A    KKAIE       S+I + +   D N     
Sbjct: 942  SLWHNIGVSELVSLLMLRLPESRDAAIFSFKKAIEYQSNSTKSWIALGISTMDINWRVSQ 1001

Query: 383  YNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAY 442
            +  F K++ L+P ++ V+++   +    ++ D A +   + + + P+   P++ +A L  
Sbjct: 1002 HC-FIKSIALSPKDTEVWFNLSLLALKAKDLDFARQVLARTQSIAPQESSPWLGMALLLE 1060

Query: 443  RENKFDDCETLFSEA 457
            +E    +   +FS A
Sbjct: 1061 KEGNTQESINMFSHA 1075

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 70/168 (41%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F + NYD + K F++ K+L P  +      + L +  +       L +      P 
Sbjct: 490 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDIMPN 549

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            PE       +L+ + D D A+K ++ A +L+      Y     L G       + + ++
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYT----LQGH-----EHSSNDS 600

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
              A     KA   D +   A  GL    ++    +EA++ FE++  +
Sbjct: 601 SDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 648

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 274 DEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNEDEKLKEKLAISL 333
           ++++    E+M  LA L  RS   Y+    SF KA +LFE Q+        +K+ +   L
Sbjct: 438 NDYSVTLPEIMYNLA-LILRSSSQYN----SF-KAIRLFESQIP-----SHIKDTMPWCL 486

Query: 334 EHTGIFKFLKNDPLGAHEDIKKAIELFP-RVNSYIYMALIMADRNDSTEYYNYFDKALKL 392
              G   F   +   + +   +  +L P RV      + ++   +D  +  N  +  + +
Sbjct: 487 VQLGKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDI 546

Query: 393 NPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
            PN    +   G +  + +++D A K F+KA +LDP   + Y
Sbjct: 547 MPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY 588

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 14/92 (15%)

Query: 384 NYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLAC---- 439
           N + +AL  +P + + YY  G     L  YD+A   F+KA+ ++P N+   I + C    
Sbjct: 537 NCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVA 593

Query: 440 ---LAYRENKF----DDCETLFSEAKRKFPEA 464
              L+Y+E         CE   S +  KF +A
Sbjct: 594 LEKLSYQEKALQYYEQACELQPSSSLAKFKKA 625

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/168 (17%), Positives = 72/168 (42%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G++++ + NY+++   F++ + + P         + L +  +       L +E     P 
Sbjct: 421 GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN 480

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
            P+       + + + D + A+K ++ A +++      Y     L G     + N +++ 
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYT----LQGHEH--SSNDSIDT 534

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
              A N   +A   DP+   A  GL    ++    D+A++ FE++ ++
Sbjct: 535 ---AKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/185 (19%), Positives = 77/185 (41%), Gaps = 1/185 (0%)

Query: 312 FEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFP-RVNSYIYMA 370
           +EE L+  N+  +++      +E      +  +D         + +E  P +  ++  + 
Sbjct: 430 YEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPNKPQTWCCLG 489

Query: 371 LIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
            + + + D  +   YF+KA K++ N +  Y  +G  +    + D A   + +A   DP++
Sbjct: 490 NLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQH 549

Query: 431 IFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDL 490
              Y  L     +  ++D     F +A+   P    +       L   +  +KAL+ Y+ 
Sbjct: 550 YNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQ 609

Query: 491 AIELE 495
           A EL+
Sbjct: 610 ACELQ 614

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 10/94 (10%)

Query: 207 LERNLN-KQAMSRLKEKFG--DVDAATATPTELSTQPPKERKDKQENLPSITSMASFFGI 263
           LERNL+    + + KE FG  DVDA T +    + Q  +ERK+K+  +P+   + +F GI
Sbjct: 53  LERNLDLCSGIKKFKECFGNPDVDACTLSGLLKTIQAYEERKNKK--VPA--DIITFRGI 108

Query: 264 FKPELTFANYD--EFNKADKELMDGLANLYKRSP 295
            + +L  A +D  ++N+ D  ++     L+ R P
Sbjct: 109 MR-KLISAAFDSPKYNRVDLRVLSFNGQLFIREP 141

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 20/161 (12%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + KAL  NP + + +Y  G     L  Y++    F+KA+ ++P N+   I + C      
Sbjct: 466 YRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALE 522

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGI 505
           K    E    +A + +  A E+    +  L  +     A+ +Y+ A+E   KL    V I
Sbjct: 523 KLSHQE----KALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKL----VTI 574

Query: 506 AP-------LVGKATLLT--RNPTVENFVEATNLLEKASKL 537
           AP       L+G+   +   +   V+    A NL  K S+L
Sbjct: 575 APDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQL 615

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 66/168 (39%), Gaps = 9/168 (5%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE 463
           G+++F L NY+ + K F   +EL P  I      + L +  N       L  E       
Sbjct: 348 GKLHFELVNYEMSKKYFAALRELQPFRIPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL 407

Query: 464 APEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVEN 523
           APE       + + K D ++++K +  + +L+      Y     L G         + + 
Sbjct: 408 APETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYT----LQGH-----EYSSNDA 458

Query: 524 FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADL 571
           F  A     KA   +P+   A  GL    L+    +E ++ FE++  +
Sbjct: 459 FDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTK 157
           AL  KD+GN + + + +  A + Y  A+EL +   +F+SN +  ++   + +  +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
           ALE+     K   RR  +  GL  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%)

Query: 375 DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432
           +R   ++   +F  AL++ PNN   +   GQ        + + + F+KA ELDP++++
Sbjct: 680 ERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE-----DPVFYSNLSACYVSVGDL 148
           E  + A   K +GN  ++ K++ DA + Y+  +++K      +   Y+N +AC + + + 
Sbjct: 76  EPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNY 135

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186
           ++ +    +AL++ P   K   R A A   L    +A+
Sbjct: 136 RRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 378 DSTEYYNY-FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ 436
           D+ E Y+   D   ++N  N S+Y +R      ++NY +   D  +A +L+P+NI  Y +
Sbjct: 99  DARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYR 158

Query: 437 LA 438
           +A
Sbjct: 159 IA 160

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 68/161 (42%), Gaps = 20/161 (12%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           + KAL  N  + + YY  G  +  L  Y++    F+KA+ ++P N+   I + C      
Sbjct: 467 YRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALE 523

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGI 505
           K    E     A + +  A E+    +  L  +     A+ +Y+ A+E   KL    V I
Sbjct: 524 KLSHQE----RALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKL----VKI 575

Query: 506 AP-------LVGKATLLT--RNPTVENFVEATNLLEKASKL 537
           AP       L+G+   +   +   V+    A NL  K S+L
Sbjct: 576 APDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQL 616

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYY--NWALELKEDPV---FYSNLSACYVSVGDL 148
           E  + A   K +GN+ ++ K++ DA + Y    A+E ++  +    ++N +AC + + + 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNY 137

Query: 149 KKVVEMSTKALEIKPDYSKVLLR 171
           +K VE   KAL I P   K   R
Sbjct: 138 RKCVEDCGKALTINPKNIKCYYR 160

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar to
            uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
            antiviral protein
          Length = 1411

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 363  VNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDK 422
            V S+  +A+   D N     +  F KA+ L+P + ++ +    ++    + D A +  +K
Sbjct: 963  VESWFGLAVSTMDFNYRVSQHC-FIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINK 1021

Query: 423  AKELDPENIFPYIQLACLAYRENKFDDCETLFSEA 457
            A+ + P    P++ LA L  ++N   +  +LFS A
Sbjct: 1022 AQTISPAESSPWLGLALLNEKKNGSSNSVSLFSHA 1056

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 12/87 (13%)

Query: 88  ANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVG 146
            N T+ EKDK       +GN  F+   Y +A+  Y+  +  + ++PV YSN +   + +G
Sbjct: 3   GNMTSFEKDK------QQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLG 56

Query: 147 DLKKVVEMSTKALE-----IKPDYSKV 168
           +  + ++   + L+       PD+  +
Sbjct: 57  EHAQAIQACQQGLQHASTTTTPDHVTI 83

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNL-----SACYVSVGDL 148
           E  + A   K++GN  ++ K++ DA   YN  +E+K D    S L     +AC + + + 
Sbjct: 72  EPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNY 131

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASA 175
           ++ +    +AL++ P   K   R   A
Sbjct: 132 RRCINDCREALKLNPKNPKAFFRIGKA 158

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 33.9 bits (76), Expect = 0.26,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEI 161
           K++GN  F+   Y +A+  Y+  +  + ++PV YSN +   + +G+  + ++M  + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 162 KPDYSKVLLR 171
                 V +R
Sbjct: 68  TSTAEHVAIR 77

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 20/114 (17%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFD-- 387
           A +  H G    ++ND   A++  ++A+    R  + I+   I       ++Y +  D  
Sbjct: 311 ATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAY 368

Query: 388 -KALKLNPNNSSVYYHRG--------QMNFILQNYDQAGKDFDKAKELDPENIF 432
            +A++LNP  S V+Y  G        Q+N  L  Y QA +       LDPENI 
Sbjct: 369 TRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAAR-------LDPENIH 415

>YLR072W Chr12 (278862..280943) [2082 bp, 693 aa] {ON} Protein of
           unknown function; green fluorescent protein (GFP)-fusion
           protein localizes to the cytoplasm in a punctate
           pattern; YLR072W is not an esssential gene
          Length = 693

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN 250
           +S   D+N +S I+PM+E N     +S  K+    V+       ELS    KE+ D  + 
Sbjct: 533 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADTLKP 588

Query: 251 LPSITSMASFFGIFKPELTFANYDEFNKADKEL 283
           LPS+TS  S   +  PELT    +   +A+ E+
Sbjct: 589 LPSVTSFGSPRKVAAPELTMVQPESKPEAEAEI 621

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 5/117 (4%)

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y  M +   +  + T+   +F  AL+++PN+   +   GQ  F     + + K F+KA E
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 426 LDPE-NIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDF 481
           L P+ N   Y     LA    + D+ E      +    + PE   F  E+ T   D+
Sbjct: 747 LSPDHNYAKYFNSVALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDY 799

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 386  FDKALKLNPNNSSVYYHRGQMNFILQNYDQ--AGKDFDKAKELDPENIFPYIQLACLAYR 443
            F KA+ L+P +  ++++   +   LQN D   AG+   +A+ + P+N  P++ +A L  +
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLA--LQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEK 1050

Query: 444  ENKFDDCETLFSEA 457
            E K  +   +F  +
Sbjct: 1051 EGKSTESANMFGHS 1064

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 394 PNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETL 453
           P +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + 
Sbjct: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478

Query: 454 FSEAKRKFPEAPEVPNFF 471
           +S A R FP    +P+ +
Sbjct: 479 YSTAARFFP-GTHLPHLY 495

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 54/144 (37%), Gaps = 1/144 (0%)

Query: 354 KKAIELFPRVN-SYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQN 412
            K  E FP+ + ++  +       N+ TE   YF KA  L+PN    +        +   
Sbjct: 412 HKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGE 471

Query: 413 YDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFA 472
           ++QA   +  A    P    P++ L     R +     E  F  A    P  P + N   
Sbjct: 472 HEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELG 531

Query: 473 EILTDKNDFDKALKQYDLAIELEN 496
            +   K D+ +A K +  A E  N
Sbjct: 532 VVYFKKMDYPRAKKFFKRACEAIN 555

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_7.546
            YPR189W
          Length = 1410

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 82/386 (21%), Positives = 157/386 (40%), Gaps = 48/386 (12%)

Query: 106  GNQYFRNKKYDDAIKYYNWALELKEDPV-FYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
            G  Y   ++  D+I+++  A+ + +  V  +  L   Y S G ++  +++  K LE+ P 
Sbjct: 682  GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 165  YSKVLLRRASANEGLGNFADAMFDLSVLS-LNGDFNDASIEPMLERNLNKQAMSRLKEKF 223
            +   L  +A     +G F +++  L  ++ LN   N+ + +  L + L K A     + F
Sbjct: 742  HPHALYFKALGLSDVGQFVESIEILEYITDLNP--NNEAFKICLAKILVKYATDLFTQGF 799

Query: 224  GDVDAATATPT-----ELSTQPPKERKDKQENLPSITSMA-------------SFFGIFK 265
                 ATAT +      L TQ     ++    L S  +M              +   IF 
Sbjct: 800  LMKAIATATKSISIIESLVTQMGCTSQNLWVLLSSALNMYLLVSSQSHEVPLDNLISIFS 859

Query: 266  PELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLF---EEQLDKSNED 322
              + F+  +E +  D+ + + L           D+  ++ T    L     +    S++ 
Sbjct: 860  S-IRFSGIEELDDIDEIIFEHLL--------EDDKGIDNNTIICTLLILSSKYALSSSDF 910

Query: 323  EKLKEKLAISLEH-TGI-----FKFLKNDPL--GAHEDIKKAIELFPR-VNSYIYMALIM 373
            E L   L  SL +  G+     +  L  D     A    KK+I+      +S+I + +  
Sbjct: 911  ESLSAPLRSSLWYNIGLSELTSYILLNEDKFRDAAIYAFKKSIKFQSNTTSSWIGLGIAT 970

Query: 374  ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQ--AGKDFDKAKELDPENI 431
             D N     +  F KA  L P ++ ++++   ++  L+N D   A +  D+ + + P+  
Sbjct: 971  MDINYRVSQH-CFIKASALEPRDTEIWFNLSMLS--LKNNDTTFAKQVLDRTQSIAPQES 1027

Query: 432  FPYIQLACLAYRENKFDDCETLFSEA 457
             P++ LA L   E    +   LF+ A
Sbjct: 1028 TPWLGLALLHELEGNRQESSRLFAHA 1053

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 35/187 (18%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACL---------------AYREN--- 445
           G   + L++Y  A K +++A +LD  +      + CL                ++EN   
Sbjct: 229 GACFWHLKDYKMAIKSWERATQLDANS---SASILCLLGKFHNSLTESENDTQFKENYTA 285

Query: 446 KFDDCETLFSEAKRKFPEAPEVP---NFFAEILTDKNDFDKALKQYDLAIELENKLDRIY 502
              D  TL+++     PE  E P            KNDF+  LK YD       K+  I 
Sbjct: 286 SLMDLNTLYNDTNH--PENKENPVLLTLLQSYFYYKNDFENVLKIYD------EKIKPIS 337

Query: 503 VGIA-PLVGKATLLTRNP--TVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDID 559
             +A  ++ ++TL        ++++ +A  + +++ K +  +  AK+GL Q +L+   ++
Sbjct: 338 TLVADSILSESTLWCGRAYYALDDYRKAFAMFQESLKTNEENLLAKLGLGQAQLKTNLLE 397

Query: 560 EAIMLFE 566
           E+I+ FE
Sbjct: 398 ESILTFE 404

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           LK +GN +F+   Y  A  YY+  ++L+  +P+ YSN +   +  G+    VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEI 161
           K++GN   + K +  AI+ Y  A++L     +++SN +  +  V + +  +    +A+++
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 162 KPDYSKVLLRRASANEGLGNFADAMFDLSVL 192
            P   K   RRA +   L  F  A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQ--LACLAYR 443
           + +A+ L+   +  + +R   +F + N+  A  D D+A +LDP+NI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 444 ENK 446
           E K
Sbjct: 95  EFK 97

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV----FYSNLSACYVSVGDLKKVVEMST 156
            K++ N  ++ K++ DA + Y   +++  ED       ++N +AC + + + +  V    
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 157 KALEIKPDYSKVLLRRASANEGLGNFADA 185
           KA+EI P   K   R   A   LG F +A
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 394 PNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETL 453
           P +S  ++  G   F + N  +A K F KA  LDP   + ++  A     E + +   + 
Sbjct: 429 PKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 488

Query: 454 FSEAKRKFPEAPEVPNFF 471
           +S A R FP    +P+ +
Sbjct: 489 YSTAARFFP-GTHLPHLY 505

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 53/144 (36%), Gaps = 1/144 (0%)

Query: 354 KKAIELFPRVN-SYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQN 412
            K  E FP+ + ++  +       N+  E   YF KA  L+PN    +        +   
Sbjct: 422 HKLAESFPKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGE 481

Query: 413 YDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFA 472
           ++QA   +  A    P    P++ L     R +     E  F  A    P  P + N   
Sbjct: 482 HEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNELG 541

Query: 473 EILTDKNDFDKALKQYDLAIELEN 496
            +   K D+ +A K +  A E  N
Sbjct: 542 VVYFKKMDYPRAKKFFKRACEAIN 565

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVSVGDL 148
           E  + A   K++GN  F  K++ +A   YN  +E+K +        ++N +AC + + + 
Sbjct: 75  EPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNY 134

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADA 185
           +  +     AL + P   K   R   A   L N  +A
Sbjct: 135 RSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 389 ALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPEN 430
           AL LNP N   YY  G+  ++L N ++A +     +++D EN
Sbjct: 144 ALTLNPKNIKCYYRMGKAFYLLNNIEEAKESVGFGQKVDKEN 185

>Smik_12.132 Chr12 (258696..260786) [2091 bp, 696 aa] {ON} YLR072W
           (REAL)
          Length = 696

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN 250
           +S   D+N +S I+PM+E N     +S  K+    V+       ELS    KE+ D  + 
Sbjct: 536 ISFWVDWNASSWIKPMVESNCKNGQISATKDLVKLVEEFVEKYVELS----KEKADALKT 591

Query: 251 LPSITSMASFFGIFKPELTFA 271
           LPS+TS  S   +  P+LT A
Sbjct: 592 LPSVTSFGSPRKVAVPQLTSA 612

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G  ++ N  YD  +  +  AL +K +D + ++ L A   +    ++ ++   KAL++KP 
Sbjct: 426 GILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 485

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A +   +G F +A  + L+ LS++
Sbjct: 486 FVRARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMST 156
            + KG + F+   Y  A+  Y  +L    ++ P   +  SN+   Y+ +G+  K ++++ 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLN 195
            ALE+ P+                     +SK+++R A A E   N+  A  +  +L  N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 196 GDFND 200
           G  N+
Sbjct: 413 GITNE 417

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEI 161
           K  GN YF++  Y  A++YY   +E++ E+P+ YSN +   + +    + +E     L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 162 KPD 164
             D
Sbjct: 67  VND 69

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLR 171
           N+ ACY  + DLK  + +S K+L++ PD +K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 55/120 (45%)

Query: 376 RNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYI 435
           + D  E   YF+KA +++P+ +  Y  +G  +    + D A   + KA   DP++   Y 
Sbjct: 522 QRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYY 581

Query: 436 QLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
            L     +  ++++    F +A+   P    +       L   +  +KAL+ Y+LA EL+
Sbjct: 582 GLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQ 641

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 75/186 (40%), Gaps = 9/186 (4%)

Query: 387 DKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENK 446
           ++ L+  P+    +   G +  + +++D+A + F+KA E+DP   + Y          + 
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDS 558

Query: 447 FDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIA 506
            D  +T + +A    P+                 +++AL    L  E    ++ + V + 
Sbjct: 559 IDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEAL----LYFEKARSINPVNVILI 614

Query: 507 PLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFE 566
              G A  L +    E   +A    E AS+L P S  AK   A +         A+  FE
Sbjct: 615 CCCGVA--LEKMSYQE---KALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALENFE 669

Query: 567 ESADLA 572
           E A+LA
Sbjct: 670 ELAELA 675

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQYFRNKKYDDAIKYY-NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALE 160
           L+ KGN  +   +Y+ A+ YY N +L    +PV  +N+S   + +   +  +    +ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 161 I 161
           I
Sbjct: 71  I 71

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 8/108 (7%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM----ADRNDSTEYYNY 385
           A S  H G    ++ND   A++  ++A+    R  ++     ++    A   D+ + Y  
Sbjct: 358 ATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYT- 416

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQN-YDQAGKDFDKAKELDPENIF 432
             +A++LNP  S V+Y  G +     N  + A   + +A  LDP N+ 
Sbjct: 417 --RAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARLDPNNVH 462

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLG 180
           NL+AC+  + DLK+ +  S K ++++P   K  +RR    + LG
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLG 115

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 32.0 bits (71), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 103 KDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEI 161
           K++GN+ ++   Y DAI  Y+  +  + ++PV +SN +   + +G+  + +E   + L++
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 162 KPDYSKVLLR 171
                   LR
Sbjct: 68  AASPQHAALR 77

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 94  EKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELK--EDPV---FYSNLSACYVSVGDL 148
           E  + A   K++GN  ++ K+Y DA   Y+  +E+K  +D +    Y N +AC + + + 
Sbjct: 74  EPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNF 133

Query: 149 KKVVEMSTKALEIKPDYSKVLLRRASA 175
           +  +    KAL       K   R   A
Sbjct: 134 RSCINDCKKALNFNAKCVKAFYRMGQA 160

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 52/178 (29%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFY-------SNLSACYVSVGDLKKVVEM 154
            K++G + F+   Y  A++ Y  +L     P+ +       SN+ A     G+ +K +E+
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTL--PIKHPLRIIASSNILASMSKTGEYRKSIEI 454

Query: 155 STKALEIKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLS 193
           ST ALE  P                      + K++L+RA A E + ++ +A+       
Sbjct: 455 STSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL------- 507

Query: 194 LNGDFNDASIEPMLERN-LNKQAMS---RLKEKFGDVDA----ATATPTELSTQPPKE 243
                   + + M+E+N  N + MS   R +     V      ++A P + +T+P KE
Sbjct: 508 -------ETYQQMIEKNFFNDKVMSGKRRCQHVINPVKPTKSNSSALPRQTNTKPKKE 558

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 29/132 (21%)

Query: 100 LALKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEM 154
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 155 STKAL-------------EIKPD----------YSKVLLRRASANEGLGNFADAMFDLSV 191
              AL             +I PD          +SK+++R+A + E L N+  A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 192 LSLNGDFNDASI 203
           L  NG F ++ I
Sbjct: 535 LIENG-FTNSKI 545

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 80  GEPDFSKKANFTAEE---KDKYALAL---KDKGNQYFRNKKYDDAIKYYNWALELK-EDP 132
           G  D +++ N        +DK  ++    KD GN++F+  +YD AI+ Y   + L+  + 
Sbjct: 10  GHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNA 69

Query: 133 VFYSNLSACYV 143
           V YSNL+  Y+
Sbjct: 70  VGYSNLAMAYL 80

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK--EDP---VFYSNLSACYVSVGDLKKVVEMST 156
            K KG   F+N  Y ++++ Y  +L       P   +  SN+ A  + +G+  K +E S+
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAM 186
            ALE+ P                      + K+++RRA + E L +F  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 375 DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434
           D +DS +    + KAL  +P + + YY  G  +  L  Y++A   F+KA+ ++P N+   
Sbjct: 593 DSSDSAK--TCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV--- 647

Query: 435 IQLACLA 441
           + + C  
Sbjct: 648 VLICCCG 654

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 50/110 (45%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
           F+KA +L+PN +  Y  +G  +    + D A   + KA   DP++   Y  L   + +  
Sbjct: 568 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 627

Query: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELE 495
           ++++    F +A+   P    +       L      +K L+ Y+LA +L+
Sbjct: 628 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQ 677

>Ecym_5564 Chr5 (1147940..1152784) [4845 bp, 1614 aa] {ON} similar
           to Ashbya gossypii AGR120C
          Length = 1614

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 262 GIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEEQLDKSNE 321
           G+ K E    N  EFN A K  M  +  +   SPE   +A      A  +   +LD+SN 
Sbjct: 905 GVHK-EFEILNVLEFNSARKR-MSCIVKIPAESPEQKPKALLLCKGADSVIYSRLDRSNN 962

Query: 322 DEKLKEKLAISLEH 335
           D  L E+ A+ LE 
Sbjct: 963 DSSLLERTALHLEQ 976

>Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON}
           (58546..61800) [3255 nt, 1085 aa]
          Length = 1084

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 30/141 (21%)

Query: 358 ELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRG-QMNFILQNYDQA 416
           E   + NS+   AL     N    +YNY  K  K NP  +  YY +  Q+          
Sbjct: 650 ETLVKFNSHDVFAL-----NSMGNFYNYLAKENKRNPEKAKQYYLKSIQL---------- 694

Query: 417 GKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFS--EAKRKFPEAPEVPNF---F 471
              F KA ++DP N+F    LA +      F +C+ L    E  RK  ++ +  +     
Sbjct: 695 ---FQKALQVDPLNVFAAQGLAII------FAECKRLGPSLEILRKIRDSLDTEDVHLNL 745

Query: 472 AEILTDKNDFDKALKQYDLAI 492
           A  L + +++ KA+++Y+  +
Sbjct: 746 ANCLLEMHEYAKAIEEYEFIL 766

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 18/97 (18%)

Query: 110 FRNKKYDDAIKYYNWALE----LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD- 164
           FR K +  ++K +   L     LK DP     + AC+  + D K  +    ++LE+ P  
Sbjct: 208 FRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPTN 265

Query: 165 -----------YSKVLLRRASANEGLGNFADAMFDLS 190
                      + K L+   + +E   NF DAM DLS
Sbjct: 266 KNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLR 171
           N+ ACY  + DLK  +++S ++L++ PD  K  +R
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIR 126

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFD-- 387
           A +  H G    +++D   A++  ++A+    R  + I+   I       ++Y +  D  
Sbjct: 298 ATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAY 355

Query: 388 -KALKLNPNNSSVYYHRGQMNFILQNYDQAGKD-FDKAKELDPENIF 432
            +A++LNP  S V+Y  G +     N      D + +A  LDPENI 
Sbjct: 356 TRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPENIH 402

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 54/126 (42%), Gaps = 21/126 (16%)

Query: 511 KATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIML------ 564
           K  +L R  ++ NF   TN L+ A  ++P S +  IG+++  + Q  ++    L      
Sbjct: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68

Query: 565 ----FEESADLARTMEEKL--------QAITFAEAAKVQQK---IRSDPILAAKIQETLA 609
                  + D+AR+ E+++        +  T   A+KV      + SD +L  K+ +   
Sbjct: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128

Query: 610 KLREQG 615
            +   G
Sbjct: 129 GVHVNG 134

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS-YIYMALIMADRNDSTEYYNYFDK 388
           A +  H G    ++ND   A++  ++A+    R  + +  + ++    +   +  + + +
Sbjct: 308 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 367

Query: 389 ALKLNPNNSSVYYHRGQMNFILQNYDQAGKD-FDKAKELDPENIF 432
           A++LNP  S V+Y  G +     N      D + +A  LDP N+ 
Sbjct: 368 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNVH 412

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 362 RVNSYIYMALIMA--DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKD 419
           R N++ +  + +A  ++ + ++   +F  AL+++PN+   +   GQ        + + K 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 420 FDKAKELDPENIF 432
           FDKA EL P + +
Sbjct: 752 FDKAIELQPSHTY 764

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 362 RVNSYIYMALIMA--DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKD 419
           R N++ +  + +A  ++ + ++   +F  AL+++PN+   +   GQ        + + K 
Sbjct: 699 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 758

Query: 420 FDKAKELDPENIF 432
           FDKA +L P + F
Sbjct: 759 FDKAIQLRPSHTF 771

>SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 908

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 27/169 (15%)

Query: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEA 464
           +M  ILQ+Y ++          DP+    +I  A L  +  KF   ++L  +  ++ P  
Sbjct: 245 KMRTILQSYRRS----------DPKKPHGWIASARLEEKAKKFQLAKSLVDQGCQECPRN 294

Query: 465 PEVP-----------NFFAEILTDKNDF-DKALKQYDLAIELE----NKLDRIYVGIAPL 508
            E+            ++   ++T+   F D++L  +  AIELE    NK+  I   +  L
Sbjct: 295 QEIWLENIRLNSSNLHYCKVLVTNAIKFNDQSLDLWLKAIELESEDFNKIRVIRKALQHL 354

Query: 509 VGKATLLTRNPTVEN-FVEATNLLEKASKLDPRSEQAKIGLAQMKLQQE 556
               TL       EN  +EA  +L KA++L P+S    + L  ++   E
Sbjct: 355 PESETLWKLAVQYENDKIEAVKILVKATELVPKSMDLWMALVSLQSHSE 403

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 16/112 (14%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS-YIYMALIMADRNDSTEYYNYFDK 388
           A +  H G    ++ND   A++  ++A+    R  + +  + ++    +   +  + + +
Sbjct: 378 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 437

Query: 389 ALKLNPNNSSVYYHRG--------QMNFILQNYDQAGKDFDKAKELDPENIF 432
           A++LNP  S V+Y  G        Q+N  L  Y QA +       LDP N+ 
Sbjct: 438 AIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAAR-------LDPNNVH 482

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/112 (19%), Positives = 47/112 (41%)

Query: 366 YIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKE 425
           Y  + +   ++   +E   +F  AL++ P +   +   GQ  +     + + K F+KA E
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 426 LDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477
           + P N + +   A    +   +D+   +F E   + P+         E+L +
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVE 795

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 2/111 (1%)

Query: 348  GAHEDIKKAIELFPRV-NSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQM 406
             A E  KK+IE       ++I   +   D N     +  F KA  LNP  +SV+Y    +
Sbjct: 949  AAIESFKKSIEYQSNTAEAWIGFGIASIDLNVRVAQHC-FIKATALNPRETSVWYDMAIL 1007

Query: 407  NFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEA 457
                 +   A     K++ + P++  P+  LA  + +E    D   LF+ +
Sbjct: 1008 ALRYNDVAFARAVLMKSQSIAPQDSTPWFGLALASEKEGLTQDSARLFAHS 1058

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 354 KKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSV-----YYHRGQMNF 408
           KK IEL  ++  Y+ ++L+M +     E   Y    L++ P  SS+     YY  G  +F
Sbjct: 287 KKFIELKAKL--YLNLSLVMFNLKRYEEAITYTTYLLEI-PEASSIDKAKAYYRSGNCHF 343

Query: 409 ILQNYDQAGKDFDKAKELDPEN 430
             + YD+A  DF   KE +P++
Sbjct: 344 AKKRYDKALSDFKCCKENNPDD 365

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%)

Query: 385 YFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRE 444
           YF KA  L P +  ++   G+  FI+ N D A K + +A +L    +   I L  LA   
Sbjct: 543 YFQKACALKPLDKRMWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILYKLAILY 602

Query: 445 NKFDDCE 451
            K DD E
Sbjct: 603 EKMDDIE 609

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 101 ALKDKGNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKAL 159
            LK KGN +F+   Y+ A+ YY  A+     +P+ YSN +   + +    + V+   K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 160 EI 161
           ++
Sbjct: 66  KM 67

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQYFRNKKYDDAIKYYNWALELK-EDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164
           G  ++ N  YD  +  +  AL ++ +D + ++ L A   +    ++ ++   KAL++KP 
Sbjct: 433 GILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 492

Query: 165 YSKVLLRRASANEGLGNFADAM-FDLSVLSLN 195
           + +     A +   +G + +A  + L+ LS++
Sbjct: 493 FVRARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 6/107 (5%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFD-- 387
           A +  H G    ++ D   A++  ++A+    R  + I+   I       ++Y +  D  
Sbjct: 285 ATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAY 342

Query: 388 -KALKLNPNNSSVYYHRGQMNFILQNYDQAGKD-FDKAKELDPENIF 432
            +A++LNP  S V+Y  G +     N      D + +A  LDPEN+ 
Sbjct: 343 TRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENVH 389

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
            (SKI3) - Contains 8 copies of the TPR domain [contig 8]
            FULL
          Length = 1410

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%)

Query: 386  FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
            F KA  L+P  +SV+Y    +     + D A     K++ + P++  P++ LA  + +E 
Sbjct: 986  FIKATALSPRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEG 1045

Query: 446  KFDDCETLFSEA 457
              ++   LF+ +
Sbjct: 1046 LVEESSRLFAHS 1057

>Smik_2.178 Chr2 complement(326305..329007) [2703 bp, 900 aa] {ON}
           YBR055C (REAL)
          Length = 900

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
            D+ L  NP+++ ++  + QM   L N DQA     +A +  P N   +++   L    N
Sbjct: 725 LDRGLSKNPDDALLHIGKIQMEMRLGNLDQAALLTTQALQKFPNNALLWVEQIKLLKHAN 784

Query: 446 KFDDCETLFSEAKRK 460
           +    +T+F +A +K
Sbjct: 785 RSSSKKTIFHDALKK 799

>KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3.5
           YOL145C
          Length = 1076

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 75/179 (41%), Gaps = 23/179 (12%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDC--ETLFSEAKRKF 461
           G   + L++Y  A   +++A ELDPEN    I L  L    N   D   +T F+E+  K 
Sbjct: 234 GLCFWQLKDYQMAISAWERALELDPENKTASI-LCLLGKFHNSITDSKNDTQFTESFTKV 292

Query: 462 -----------PEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDRIYVGIAP-LV 509
                       E P +            D+ + +K Y+  I     L      I P L+
Sbjct: 293 LTELNDIYTNNKENPVLLILLQSYYYFTGDYSRVIKIYEAKISPNASL------ITPTLM 346

Query: 510 GKATLLTRNP--TVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFE 566
             +T         + N+ EA  + +++ K +  +  A+ G+ Q +++   ++E+I+ FE
Sbjct: 347 SDSTFWCGRAQYALNNYREAFVMFQESLKTNEDNLLARFGVGQSQIKTNLVEESILTFE 405

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 20/123 (16%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFD-- 387
           A +  H G    ++ D   A++  ++A+    R  + I+   I       ++Y +  D  
Sbjct: 305 AATWYHLGRVHMIRADYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAY 362

Query: 388 -KALKLNPNNSSVYYHRG--------QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLA 438
            +A++LNP  S V+Y  G        Q+N  L  Y QA +       LDP+N+    +L 
Sbjct: 363 TRAIRLNPYISEVWYDLGTLYETCNKQLNDALDAYKQAAR-------LDPDNVHIRERLE 415

Query: 439 CLA 441
            LA
Sbjct: 416 SLA 418

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 330 AISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNS-YIYMALIMADRNDSTEYYNYFDK 388
           A +  H G    ++ND   A++  ++A+    R  + +  + ++    +   +  + + +
Sbjct: 312 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 371

Query: 389 ALKLNPNNSSVYYHRGQMNFILQNYDQAGKD-FDKAKELDPENIF 432
           A++LNP  S V+Y  G +     N      D + +A  LDP N+ 
Sbjct: 372 AIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNNVH 416

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 80/182 (43%), Gaps = 29/182 (15%)

Query: 404 GQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCE------------ 451
           G   + L++Y  A + +++A +LDP N    I L  L    N   + E            
Sbjct: 224 GMCFWQLKDYKLAIQAWERALQLDPNNKQASI-LVLLGKFHNSLTEAENDEDFKEKYAAA 282

Query: 452 -----TLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKL--DRIYVG 504
                T+++ +K    E+P +          K D++K +  +D  I   + L  + +Y  
Sbjct: 283 LADLNTVYTNSK----ESPVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPESVYSE 338

Query: 505 IAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIML 564
                G+A+       + ++ +A  + +++ K D  +  A++GL Q +++   ++E+I+ 
Sbjct: 339 SLFWCGRASY-----AMGDYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILT 393

Query: 565 FE 566
           FE
Sbjct: 394 FE 395

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 1/78 (1%)

Query: 394 PNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETL 453
           P N+  ++        +Q   +A K F K+  LDP     +I  +     E + D   + 
Sbjct: 431 PKNAITWFGVATYYMTVQKISEARKYFSKSSILDPNFAPSWIGFSHTFALEGEHDQAISA 490

Query: 454 FSEAKRKFPEAPEVPNFF 471
           +S A R FP    +PN F
Sbjct: 491 YSTASRFFP-GMHLPNLF 507

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 137 NLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLR 171
           N+SA Y  +GDLKK +  +TK +E+ P   K  +R
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIR 112

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 95/254 (37%), Gaps = 20/254 (7%)

Query: 372 IMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431
           ++    D T       + L L+  N   +   G ++ + +++D+A   F KA +LDP   
Sbjct: 467 VLWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFA 526

Query: 432 FPYIQLACLAYREN-KFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDL 490
           + Y  L    Y  N  FD+ ++ F +A                       F++AL    L
Sbjct: 527 YAYT-LQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEAL----L 581

Query: 491 AIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQ 550
             E    L+ + V +    G A    + P       A N  E A++L P S  A    +Q
Sbjct: 582 FFEKARALNPVNVILNCCCGVALERLQQPE-----RALNFYELATELQPNSSLALFKKSQ 636

Query: 551 MKLQQEDIDEAIMLFE-------ESADLARTMEEKLQAITFAEAAKVQQKIRS--DPILA 601
           + L       A+  FE       + A +   +    Q +   + A  Q  I    DP  +
Sbjct: 637 LLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGS 696

Query: 602 AKIQETLAKLREQG 615
             I+E + K  EQG
Sbjct: 697 QLIKEAMEKCHEQG 710

>Skud_12.137 Chr12 (263617..265713) [2097 bp, 698 aa] {ON} YLR072W
           (REAL)
          Length = 698

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 192 LSLNGDFNDAS-IEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQEN 250
           +S   D+N +S I+PM+E N     ++  K+    +D       ELS    KER D  + 
Sbjct: 537 ISFWVDWNASSWIKPMVESNCKNGQITATKDLVKLIDDFVDKHVELS----KERADALKA 592

Query: 251 LPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYK 292
           LPS+ S  S   +   EL     +   +A+ E+     N ++
Sbjct: 593 LPSVASFGSPRKVVAAELAVTQPETKPEAEVEVSQTGGNRWR 634

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 26/121 (21%)

Query: 106 GNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160
           G ++F+   YD A+  Y  +L    ++ P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 161 IKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199
           + P                      + K++LR+A A E +  +  A     +L     FN
Sbjct: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672

Query: 200 D 200
           D
Sbjct: 673 D 673

>CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047c TFC4
          Length = 1062

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 111 RNKKYDDAIKYYNWALELKEDPV--FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKV 168
           +++KY +AI ++   L + E      Y  L+ CY  + D +K  E   K LE+ P     
Sbjct: 492 KSEKYKEAIDFFTPLLSIPEWCTIELYEPLTKCYKEIEDYEKAKEYGDKVLEMDPKSMDA 551

Query: 169 LLRRASANEGLGN 181
            L  A  N  LG+
Sbjct: 552 KLNVAEINYYLGD 564

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 102 LKDKGNQYFRNKKYDDAIKYYNWALE---LKEDP---VFYSNLSACYVSVGDLKKVVEMS 155
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 156 TKALEIKPD---------------------YSKVLLRRASANEGLGNFADAM 186
             AL + P                      + K+++RRA + E L +F +A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>YBR055C Chr2 complement(344602..347301) [2700 bp, 899 aa] {ON}
           PRP6Splicing factor, component of the U4/U6-U5 snRNP
           complex
          Length = 899

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%)

Query: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445
            D+ L  NP++   Y  + QM   L N DQA     +A +  P N   +++   L    N
Sbjct: 726 LDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKLFKHGN 785

Query: 446 KFDDCETLFSEAKRK 460
           K    +T+F +A R+
Sbjct: 786 KSSLKKTIFQDALRR 800

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 97  KYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMS 155
           K A  LK+KGN+  + K+Y  AI  Y+ A++L   +  +Y+N +  Y+   +    +  +
Sbjct: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191

Query: 156 TKALEI 161
            K++EI
Sbjct: 192 NKSIEI 197

>AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL145C (CTR9)
          Length = 1057

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 411 QNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNF 470
           Q++ +A + F K  ++DP NIF    LA +     +F     +  + +    +  +V   
Sbjct: 677 QSFLKAVQLFQKVLQIDPLNIFAAQGLAIIFAESKRFGQSLDILRKVRDSL-DNEDVHMN 735

Query: 471 FAEILTDKNDFDKALKQYDLAI----ELENK 497
            A  L +  DF KA++ Y++ I     +ENK
Sbjct: 736 LAHCLLEMKDFVKAIENYEITITRFENIENK 766

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,243,366
Number of extensions: 3043024
Number of successful extensions: 11747
Number of sequences better than 10.0: 329
Number of HSP's gapped: 11801
Number of HSP's successfully gapped: 524
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)