Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_14.2102.151ON1031035269e-71
YNL122C2.151ON115984514e-59
Suva_14.2182.151ON1121034499e-59
Smik_14.2062.151ON1131024453e-58
NCAS0G024702.151ON88832716e-32
KNAG0I021302.151ON92982646e-31
NDAI0F028202.151ON128762572e-29
CAGL0L04070g2.151ON95662533e-29
KAFR0J020902.151ON92662472e-28
ZYRO0G06490g2.151ON92952431e-27
SAKL0E10978g2.151ON95952371e-26
ABR133W2.151ON96992318e-26
TDEL0B051302.151ON93652292e-25
KLLA0F24068g2.151ON95832292e-25
Kwal_33.147622.151ON91642264e-25
KLTH0B05214g2.151ON91662265e-25
Ecym_82022.151ON98672258e-25
Kpol_505.212.151ON85772124e-23
TPHA0F018802.151ON99652049e-22
TBLA0B012302.151ON97671727e-17
KLLA0A01826g5.524ON146441670.70
Suva_2.137.440ON103858623.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_14.210
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   207   9e-71
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   178   4e-59
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   177   9e-59
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...   176   3e-58
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...   108   6e-32
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   106   6e-31
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   103   2e-29
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...   102   3e-29
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   100   2e-28
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...    98   1e-27
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...    96   1e-26
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    94   8e-26
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...    93   2e-25
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...    93   2e-25
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    92   4e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    92   5e-25
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    91   8e-25
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    86   4e-23
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    83   9e-22
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    71   7e-17
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...    30   0.70 
Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON} ...    28   3.7  

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  207 bits (526), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTF 60
           GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTF
Sbjct: 1   GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTF 60

Query: 61  KRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           KRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH
Sbjct: 61  KRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  178 bits (451), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 88/98 (89%), Positives = 90/98 (91%)

Query: 6   MSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 65
           MS+FNVL PLLKGSNS + K NG LFNNV TITIRTLMKTHKGTAKRWRRTGNTFKRGIA
Sbjct: 18  MSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 77

Query: 66  GRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           GRKHGNIGWSHRSLKALTGRK AHPAY KHLKRLLPYH
Sbjct: 78  GRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  177 bits (449), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%)

Query: 1   GVQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTF 60
           G +  MSLFN+ NPLLKGSNS +P+ N +LFNNV TITIRTLMKTHKGTAKRWRRTGNTF
Sbjct: 10  GDRTNMSLFNLFNPLLKGSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTGNTF 69

Query: 61  KRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           KRGIAGRKHGNIGWSHRSLK LTGRKTA+ +YLKHLKRLLPYH
Sbjct: 70  KRGIAGRKHGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPYH 112

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score =  176 bits (445), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 1/102 (0%)

Query: 2   VQITMSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFK 61
           +QI MS+F++ NPLLKGSN+ + +F+G LFNNV T+TIRTLMKTHKGTAKRWRRTGNTFK
Sbjct: 13  IQI-MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFK 71

Query: 62  RGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           RGIAGRKHGNIGWSHRSLKALTGRKTA+ AYLKHLKRLLPYH
Sbjct: 72  RGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
           Anc_2.151 YNL122C
          Length = 88

 Score =  108 bits (271), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 63/83 (75%), Gaps = 1/83 (1%)

Query: 21  SLRPKFNGILFNNVCTITI-RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSL 79
           S  P F      N+ T+TI R LMKTHKGTAKRWRRT  +FKRGIAGR HGN GWS RSL
Sbjct: 5   SFLPTFYRARCLNLTTLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSL 64

Query: 80  KALTGRKTAHPAYLKHLKRLLPY 102
           K L+GRK A P+YL+HLKRL+PY
Sbjct: 65  KHLSGRKDADPSYLRHLKRLMPY 87

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score =  106 bits (264), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 63/98 (64%), Gaps = 6/98 (6%)

Query: 6   MSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 65
           MS  + L+PL K        F      +   I  R+LMKTHKG AKRWR+  N FKRGI+
Sbjct: 1   MSFLSALSPLFKNG------FAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGIS 54

Query: 66  GRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           GRKHGN GWS R LKALTGR  AH + +K LK+LLPYH
Sbjct: 55  GRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  103 bits (257), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 2/76 (2%)

Query: 28  GILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKT 87
           G  FN++  +  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGRK 
Sbjct: 55  GQSFNSL--VITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKE 112

Query: 88  AHPAYLKHLKRLLPYH 103
           A P ++KHLKR+LPYH
Sbjct: 113 ADPTHVKHLKRMLPYH 128

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
           similar to uniprot|P53921 Saccharomyces cerevisiae
           YNL122c
          Length = 95

 Score =  102 bits (253), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (81%)

Query: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96
           +  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  AHP  +K L
Sbjct: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88

Query: 97  KRLLPY 102
           +RL+PY
Sbjct: 89  RRLMPY 94

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/66 (75%), Positives = 53/66 (80%)

Query: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96
           I  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRKTA P+  K L
Sbjct: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85

Query: 97  KRLLPY 102
           KRLLP+
Sbjct: 86  KRLLPF 91

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
           similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
           ribosomal protein L35 and some similarites with YNL122C
           uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 92

 Score = 98.2 bits (243), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 65/95 (68%), Gaps = 4/95 (4%)

Query: 8   LFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGR 67
            FN +  L  GS S    F G  FN+   +  R LMKTHKGTAKRW++T + FKRG AGR
Sbjct: 2   FFNSIVGL--GSRSAFASFGG--FNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGR 57

Query: 68  KHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPY 102
            HGN+GWS RSLK L+G+  AH ++++ L+RLLPY
Sbjct: 58  NHGNVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score = 95.9 bits (237), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 66/95 (69%), Gaps = 2/95 (2%)

Query: 11  VLNPLLKGSNSLRPKFNGIL--FNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRK 68
           +L+ LL+  +++  KF   L    +   +  R LMKTHKG AKRW++T N++KRG AGR 
Sbjct: 1   MLSSLLRPLSNISVKFGTSLSQIQHPSLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRN 60

Query: 69  HGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           HGN GW+  +LK+L G+  AHP ++KHLKRLLPYH
Sbjct: 61  HGNAGWNKSTLKSLDGKTLAHPTHIKHLKRLLPYH 95

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 93.6 bits (231), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 60/99 (60%), Gaps = 7/99 (7%)

Query: 8   LFNVLNPLLKGSNSLRPKFNGILFNNVCT---ITIRTLMKTHKGTAKRWRRTGNTFKRGI 64
            FN+L PL      L  +F    F        I +RTLMKTHKG AKRWR+T   +KR  
Sbjct: 2   FFNMLRPL----TGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAKRWRKTAGGYKRSK 57

Query: 65  AGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103
           AGR HGN GW  R+LK L+GR  A  A+LK L+RLLPYH
Sbjct: 58  AGRSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH 96

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
           Anc_2.151 YNL122C
          Length = 93

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%)

Query: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96
           I  R+LMKTHKG AKRWR+T  +FKRG AGR HGN GWS RSLK+L+G+  AH  ++KHL
Sbjct: 28  ILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHGNAGWSRRSLKSLSGKTLAHETHIKHL 87

Query: 97  KRLLP 101
           KRL+P
Sbjct: 88  KRLMP 92

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
           to uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 95

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 54/83 (65%)

Query: 21  SLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLK 80
           S R    G   N    I  R LMKTHKG AKRWR+T N+FKRG AGR HGN GWS  SLK
Sbjct: 13  SARTGLLGSKTNVSSLILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLK 72

Query: 81  ALTGRKTAHPAYLKHLKRLLPYH 103
           +L+GR  A   ++  LKRLLPYH
Sbjct: 73  SLSGRSLADSTHMHRLKRLLPYH 95

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
           YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%)

Query: 40  RTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRL 99
           R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LKAL G+  AH  ++KHLKRL
Sbjct: 28  RNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIKHLKRL 87

Query: 100 LPYH 103
           LPYH
Sbjct: 88  LPYH 91

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 91.7 bits (226), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 42/66 (63%), Positives = 51/66 (77%)

Query: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96
           +  R LMKTHKGTAKRWR+T  ++KRG AGR HGN GW   +LK+L G+  AHP ++KHL
Sbjct: 25  MQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKHL 84

Query: 97  KRLLPY 102
           KRLLPY
Sbjct: 85  KRLLPY 90

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
           similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 91.3 bits (225), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%)

Query: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96
           I  R+LMKTHKG AKRWR+T N+FKRG AGR HGN GWS  SLK L+GR  A+ + L  L
Sbjct: 32  IFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNRL 91

Query: 97  KRLLPYH 103
           KRLLPYH
Sbjct: 92  KRLLPYH 98

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..57013)
           [258 nt, 86 aa]
          Length = 85

 Score = 86.3 bits (212), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (76%), Gaps = 4/77 (5%)

Query: 30  LFNNVCTI--TIRTLMKTHKGTAKRWR--RTGNTFKRGIAGRKHGNIGWSHRSLKALTGR 85
           LFN+  +I    R+LMKTHKGTAKRW+  ++ +TFKRG +GR+HGN+GWS RSLK L+GR
Sbjct: 8   LFNSKISILQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGR 67

Query: 86  KTAHPAYLKHLKRLLPY 102
             AH  ++  L++LLPY
Sbjct: 68  TYAHTTHVSRLRKLLPY 84

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
           YNL122C
          Length = 99

 Score = 83.2 bits (204), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (76%), Gaps = 2/65 (3%)

Query: 40  RTLMKTHKGTAKRWRRTG--NTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHLK 97
           RTLMKTHKGTAKRW+     +TFKRG +GR+HGNIGWS RSLK L+GR  A   ++  L+
Sbjct: 34  RTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHVSKLR 93

Query: 98  RLLPY 102
           +LLPY
Sbjct: 94  KLLPY 98

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
           Anc_2.151 YNL122C
          Length = 97

 Score = 70.9 bits (172), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 44/67 (65%), Gaps = 7/67 (10%)

Query: 43  MKTHKGTAKRWRR-------TGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKH 95
           +KTHKGT KRWRR           F R  AGR HGNIGWSHR+L AL+ R  AH  ++K 
Sbjct: 31  LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 96  LKRLLPY 102
           L++LLPY
Sbjct: 91  LRKLLPY 97

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score = 30.4 bits (67), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 24  PKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGI 64
           P  +  +FN +  + +R    T  G A  +RR+ N FK+GI
Sbjct: 787 PLASAQIFNFLPKVLVRPFQLTTTGAAPVYRRSWNIFKKGI 827

>Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON}
           YBL104C (REAL)
          Length = 1038

 Score = 28.5 bits (62), Expect = 3.7,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 3   QITMSLFNVLNPLLK-----GSNSLRPKFNGILFNNVCTITIRTLMKTHKG-TAKRWR 54
           Q+T+S  NV +PLL      GS +   K+    F   C I        H+G T KRWR
Sbjct: 274 QVTLSDLNVASPLLAFEKLVGSGAASRKYMNSCFRWSC-IRNNEFATLHRGDTIKRWR 330

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,830,020
Number of extensions: 391361
Number of successful extensions: 1060
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1057
Number of HSP's successfully gapped: 26
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)