Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4598.851ON83834241e-55
Suva_13.4768.851ON83833901e-50
YMR286W (MRPL33)8.851ON86833832e-49
Smik_13.5028.851ON84833581e-45
ZYRO0C14894g8.851ON84833362e-42
TDEL0B002008.851ON86833321e-41
NDAI0E002508.851ON93833225e-40
SAKL0D01144g8.851ON84833191e-39
NCAS0B002608.851ON88833033e-37
Kwal_27.102098.851ON84832991e-36
CAGL0I02706g8.851ON89832973e-36
KLLA0C06270g8.851ON84832946e-36
TPHA0I003308.851ON88832956e-36
AFR450C8.851ON84832921e-35
Ecym_46248.851ON84832877e-35
KNAG0G034808.851ON84812815e-34
KLTH0C03630g8.851ON84832816e-34
Kpol_237.28.851ON86832817e-34
KAFR0A028708.851ON85832809e-34
TBLA0B029108.851ON85822755e-33
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.459
         (83 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   167   1e-55
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   154   1e-50
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   152   2e-49
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   142   1e-45
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   134   2e-42
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   132   1e-41
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   128   5e-40
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   127   1e-39
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   121   3e-37
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   119   1e-36
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   119   3e-36
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   117   6e-36
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   118   6e-36
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   117   1e-35
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   115   7e-35
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   112   5e-34
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   112   6e-34
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   112   7e-34
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...   112   9e-34
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...   110   5e-33

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  167 bits (424), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          HELTSTQQRELRKSNPGFVVEKR
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  154 bits (390), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL+RSLIGMPHTTKS+VKSLGLGKRGSI YKRVNPAIAGSLAKVKEL+ +EVTE
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          HELT  QQRELRKSNPGFVVEKR
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  152 bits (383), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/83 (86%), Positives = 80/83 (96%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYK+TL+RSLIG+PHTTKSIVKSLGLGKRGSI YK+VNPAIAGSLAKVKEL+ +EVTE
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          HELT +QQRELRKSNPGF+VEKR
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  142 bits (358), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          M FYKI L RSLIG+PHTTKSIVKSLGLGKRGSI YKRVNPAIAGSLAKVKEL+ ++VT+
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          HELT +QQR LR SNPGFVVEKR
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKR 83

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  134 bits (336), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 62/83 (74%), Positives = 72/83 (86%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYK+TL+RSLIG+PHT +++VKSLGLGKRGS  Y+RV P  AGSLAKVKEL+ +EVT+
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          H LT  QQRELRKSNPGF VEKR
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  132 bits (332), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 63/83 (75%), Positives = 73/83 (87%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          M FYKITL RS+IG PHTTKSIVKSLGLGK GSI YK+V PA AG+LAKVKEL+ +EVTE
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          ++L+  +QRELRKSNPGF+VEKR
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKR 83

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  128 bits (322), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (85%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL RSLIG+P  T++IVK++GLGKRGSI Y+RV PA+AGSLAKVKELI +E+TE
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L   +QRELRKSNPGF +EKR
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKR 83

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  127 bits (319), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL RS IG+P  TKSIVKSLGLGKRGS  Y+RV P+IAGS+ K+KEL+ +EVTE
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L+  +QRELRKSNPGFVVEKR
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKR 83

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  121 bits (303), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MV+YKITL RS+IG+P  T+ IVK+LGLGKRGS+ Y++V PAIAGS+ KVKE+I +EVT+
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L   +QR+LRKSNPGFVVEKR
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKR 83

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  119 bits (299), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 68/83 (81%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL RS IG+P   K +V SLGLGK GS+ Y++V+P+IAGS+AK+KE++ ++V E
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L+  QQRELRKSNPGF+VEKR
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKR 83

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  119 bits (297), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 71/83 (85%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          M +YK+TL RSLIG P  T++IVK++GLGKRGS+ Y++V+P++AGSLAK+KELI ++VT+
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            LT  QQRELRK+NPGF VEK+
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQ 83

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  117 bits (294), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFY+ITL RS+IG P  T+++VKSLGLGKRGS+AY+   P+IAG++A++KEL+ +E+ +
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L+  +QRELRKSNPGF VEKR
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKR 83

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  118 bits (295), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL RSLIG P   K++VK++GLGKRGS+ Y+   PA+AG+LA VKE++ +EVTE
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          ++L+  QQRELRKSNPGF V+KR
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKR 83

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  117 bits (292), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (79%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL RS IG+P   K +V SLGLGKRG+  Y++V+P  AGS+AK+KEL+ +EVTE
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          H LT  +QR LRKSNPGF VEKR
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKR 83

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  115 bits (287), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 68/83 (81%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKI L+RS IGMP  T+++VKSLGLGKRGS+ Y  V+P +AG++AKVKEL+ +EVT+
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            L+  +QR+LR SNPG+ VEKR
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKR 83

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  112 bits (281), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 64/81 (79%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYK+TL RSLIGMP  T+ IVK+LGLGKRGS  YKR  PAIAGSL KVKELI +EV+ 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 HELTSTQQRELRKSNPGFVVE 81
           +++  + R  RKSNPG+VVE
Sbjct: 61 QKVSKGEMRLARKSNPGYVVE 81

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  112 bits (281), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (85%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MVFYKITL+RS IG+P  TKS+V SLGLGK GS+ Y++V P+IAGS+AKVKE++ +EVTE
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
          H LT  QQRELRKSNPGF VEKR
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  112 bits (281), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 66/83 (79%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          M FYKITL RSLIG+P  T++IVK++GLGKRGSI Y+ V P+IAGSLAKVKEL+ +E+++
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            LT  +    RKSNPGF VEKR
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKR 83

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  112 bits (280), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 68/83 (81%)

Query: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60
          MV+Y+ TL RSLIG+P TT++IVK+LG  KRGS  Y++V PAI GSL KVKELI +++TE
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 HELTSTQQRELRKSNPGFVVEKR 83
            +T  +QRE+RKSNPG++VEKR
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKR 83

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  110 bits (275), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 69/82 (84%)

Query: 2  VFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTEH 61
          +FYKITL RSLIG+P  ++SIVKSLGLGKRGSIAY++++P+ AG++ +VKEL+ +E+T+ 
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 62 ELTSTQQRELRKSNPGFVVEKR 83
           LT  +  + R+SNPGF++EKR
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKR 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,285,665
Number of extensions: 215872
Number of successful extensions: 558
Number of sequences better than 10.0: 20
Number of HSP's gapped: 558
Number of HSP's successfully gapped: 20
Length of query: 83
Length of database: 53,481,399
Length adjustment: 55
Effective length of query: 28
Effective length of database: 47,174,769
Effective search space: 1320893532
Effective search space used: 1320893532
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)