Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4588.850ON51451424480.0
YMR285C (NGL2)8.850ON51551521050.0
Suva_13.4758.850ON51551520980.0
Smik_13.5018.850ON51551520930.0
CAGL0I02684g8.850ON49345716810.0
TDEL0B001908.850ON49245916730.0
NCAS0C003108.850ON55643716770.0
ZYRO0C14872g8.850ON49646016670.0
TBLA0B029008.850ON52046116640.0
NDAI0K003708.850ON56846016620.0
KAFR0L019608.850ON51146116560.0
Kpol_237.18.850ON50346016530.0
SAKL0D01166g8.850ON50546116470.0
TPHA0I003208.850ON52949215960.0
KLTH0C03608g8.850ON49546315910.0
Kwal_27.102048.850ON49445915190.0
KLLA0C06248g8.850ON51646314680.0
KNAG0K006508.850ON48244714610.0
ABL118W8.850ON50442613950.0
Ecym_46198.850ON48742613271e-180
NDAI0E002608.850ON49847711831e-158
NCAS0B002708.850ON47646411281e-150
TBLA0D033008.850ON48044411031e-146
KAFR0A028608.850ON4784389181e-118
Smik_13.168.850ON5024769181e-118
CAGL0B02387g8.850ON4714469041e-116
YML118W (NGL3)8.850ON5054758931e-114
Suva_13.258.850ON5024698921e-114
KNAG0G034708.850ON4664398791e-112
Skud_13.238.850ON4984728741e-111
ACR288W7.78ON7362271761e-12
Kwal_26.71127.78ON7422261752e-12
KNAG0D048407.78ON7792691733e-12
SAKL0B10032g7.78ON7312261715e-12
KLTH0D02310g7.78ON7392281706e-12
Ecym_73547.78ON7852271706e-12
CAGL0H06149g7.78ON8732271681e-11
KLLA0F15884g7.78ON7902291591e-10
Suva_1.457.78ON8312251591e-10
KAFR0K006707.78ON7952251582e-10
Skud_1.407.78ON8692261582e-10
YAL021C (CCR4)7.78ON8372251572e-10
TDEL0H037307.78ON7972531563e-10
NDAI0H025207.78ON8982251545e-10
Smik_1.457.78ON8392251502e-09
Kpol_1040.147.78ON7842251466e-09
ZYRO0D05302g7.78ON8572261456e-09
TBLA0A046607.78ON8962251431e-08
ACR277C7.90ON3782601356e-08
NCAS0F016407.78ON8552821351e-07
TPHA0H026807.78ON8722251322e-07
KNAG0L005507.90ON3812381242e-06
Kwal_26.71707.90ON3722451222e-06
KAFR0D012507.90ON3562361179e-06
KLLA0F07733g7.90ON3712371152e-05
KLTH0D02574g7.90ON3682451133e-05
CAGL0F01001g7.90ON3592371116e-05
Kpol_1044.67.90ON3722421072e-04
SAKL0B09768g7.90ON3682441062e-04
TPHA0L005307.90ON3912421053e-04
TBLA0E022607.90ON3882531026e-04
ZYRO0D05588g7.90ON3561081010.001
Smik_15.1257.90ON363219990.002
TDEL0H036007.90ON366268970.003
Skud_15.1157.90ON363243940.006
YOL042W (NGL1)7.90ON363246940.007
Suva_15.1277.90ON363243930.009
NCAS0I005007.90ON38978860.061
Ecym_26367.90ON36788820.17
NDAI0A085307.90ON365237810.25
NDAI0K002208.865ON129350707.2
Suva_4.5371.312ON80388689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.458
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   947   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   815   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   812   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   810   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   652   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   649   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      650   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   646   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   645   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   644   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   642   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   641   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   639   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   619   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   617   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   589   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   570   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   567   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   541   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   515   e-180
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   460   e-158
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      439   e-150
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   429   e-146
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   358   e-118
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   358   e-118
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   352   e-116
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   348   e-114
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   348   e-114
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   343   e-112
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   341   e-111
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    72   1e-12
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    72   2e-12
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    71   3e-12
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    70   5e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    70   6e-12
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    70   6e-12
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    69   1e-11
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    66   1e-10
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    66   1e-10
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    65   2e-10
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    65   2e-10
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    65   2e-10
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    65   3e-10
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      64   5e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    62   2e-09
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    61   6e-09
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    60   6e-09
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    60   1e-08
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    57   6e-08
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      57   1e-07
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    55   2e-07
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    52   2e-06
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    52   2e-06
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    50   9e-06
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    49   2e-05
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    48   3e-05
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    47   6e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    46   2e-04
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    45   2e-04
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    45   3e-04
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    44   6e-04
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    44   0.001
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    43   0.002
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    42   0.003
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    41   0.006
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    41   0.007
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    40   0.009
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    38   0.061
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    36   0.17 
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    36   0.25 
NDAI0K00220 Chr11 complement(34357..38238) [3882 bp, 1293 aa] {O...    32   7.2  
Suva_4.537 Chr4 complement(929310..931721) [2412 bp, 803 aa] {ON...    31   9.4  

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/514 (89%), Positives = 459/514 (89%)

Query: 1   MTKDKKVEVTAPNAAFSPEIENIESVNIKQQTGDDSVVQAXXXXXXXXXXXPIVTPEHIA 60
           MTKDKKVEVTAPNAAFSPEIENIESVNIKQQTGDDSVVQA           PIVTPEHIA
Sbjct: 1   MTKDKKVEVTAPNAAFSPEIENIESVNIKQQTGDDSVVQAKRKAKKGKKSKPIVTPEHIA 60

Query: 61  KVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLA 120
           KV               LAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLA
Sbjct: 61  KVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLA 120

Query: 121 QALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGY 180
           QALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGY
Sbjct: 121 QALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGY 180

Query: 181 DGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSK 240
           DGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSK
Sbjct: 181 DGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSK 240

Query: 241 EVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDG 300
           EV                 TTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDG
Sbjct: 241 EVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDG 300

Query: 301 DLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXXX 360
           DLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR        
Sbjct: 301 DLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEEGADD 360

Query: 361 XXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPE 420
               NIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPE
Sbjct: 361 EEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPE 420

Query: 421 NAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFL 480
           NAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFL
Sbjct: 421 NAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFL 480

Query: 481 RMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           RMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL
Sbjct: 481 RMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/515 (75%), Positives = 427/515 (82%), Gaps = 1/515 (0%)

Query: 1   MTKDKKVEVTAPNAAFSPEIENIESV-NIKQQTGDDSVVQAXXXXXXXXXXXPIVTPEHI 59
           MT+DK+V+V AP+ A   E+E  +SV + K QT DDS++Q            PIVTPEHI
Sbjct: 1   MTQDKEVKVVAPDVAPDQEVEINKSVKDAKHQTNDDSLLQHKKKGKKGKKSKPIVTPEHI 60

Query: 60  AKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCL 119
           AKV               LA GVDPDCPPELHFI+RP LSL E EPVTGFRFKLMTYNCL
Sbjct: 61  AKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCL 120

Query: 120 AQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMG 179
           AQALIRRKLFPDSGDALKW+RRSKVLLNEFKYYN+DVICLQE+DHIQFQSFWK +F+K+G
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLG 180

Query: 180 YDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFS 239
           YDGQY+RN TKNHGVAI+WRR +F +VDKMLIDYDKE+S SI TRTTTNNVGLVLALKFS
Sbjct: 181 YDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFS 240

Query: 240 KEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDND 299
           ++V                 TTHLFWHPFGTYERTRQCY+VL+KMKEFMHRVNVLQN+ND
Sbjct: 241 EKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNEND 300

Query: 300 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXX 359
           GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHY++RAKTVI CSTS+KFSKVR       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGAD 360

Query: 360 XXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHP 419
                NIEK+GKDQPESPVPE FHAN+EQ E+VD M QLHNSLDMRAISLYSVGYK+VHP
Sbjct: 361 DEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHP 420

Query: 420 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGF 479
           ENAGLDNDRGEPEISNWANTWRGLLDYLFY+KKWD QSN QEVE L DFEK+N++KCRGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGF 480

Query: 480 LRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           LRMPP +EMTKHGQPHVGEY SDHLSMVCDLELQL
Sbjct: 481 LRMPPGNEMTKHGQPHVGEYASDHLSMVCDLELQL 515

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/515 (74%), Positives = 430/515 (83%), Gaps = 1/515 (0%)

Query: 1   MTKDKKVEVTAPNAAFSPEIENIESV-NIKQQTGDDSVVQAXXXXXXXXXXXPIVTPEHI 59
           MT+DK+V+++AP+A+ + E E  + V ++KQQ GD+S  Q            P+VTPEHI
Sbjct: 1   MTQDKQVKISAPDASSASEAETDKPVKDLKQQVGDNSKNQTKKKGNKGKKSKPVVTPEHI 60

Query: 60  AKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCL 119
           AKV               LA G+DPDCPPELHFI+RP LSL E EPVTGFRFKLMTYNCL
Sbjct: 61  AKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCL 120

Query: 120 AQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMG 179
           AQALIRRKLFPDSGDALKW+RRS+VLLNEF++YNADVICLQE+DHIQFQSFWK +F+K+G
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLG 180

Query: 180 YDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFS 239
           Y+GQYHRN TKNHGVAIIWRR MFQ+VDKMLID+DKE SG+I TRTTTNNVGLVLALKFS
Sbjct: 181 YEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFS 240

Query: 240 KEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDND 299
           ++V                 T+HLFWHPFGTYERTRQCY+VL+KM+EFMHRVNVLQN+ND
Sbjct: 241 EKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNEND 300

Query: 300 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXX 359
           GDLSHWFPFFCGDFNSQPFDTPYLSMT KPVHY+ RAKTVIECSTSFKFSKVR       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEEGAD 360

Query: 360 XXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHP 419
                NIEKFGKDQPESPVP++FHAN+EQIE+VD+M QLHNSLDMRA+SLYSV YK+VHP
Sbjct: 361 EEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHP 420

Query: 420 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGF 479
           ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDL+SN QEV++L DFEK NEIK RGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGF 480

Query: 480 LRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           LRMPP SEMTKHGQPHVGEY SDHLSMVCD+ELQL
Sbjct: 481 LRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/515 (74%), Positives = 424/515 (82%), Gaps = 1/515 (0%)

Query: 1   MTKDKKVEVTAPNAAFSPEIENIESV-NIKQQTGDDSVVQAXXXXXXXXXXXPIVTPEHI 59
           MT++K+++V  P+   +  ++N + V +I+  TGD S+ Q            PIVTPEHI
Sbjct: 1   MTQEKEIKVATPDVPSTSNMQNNKPVKDIRHPTGDGSIPQTKKKGKKGKKSKPIVTPEHI 60

Query: 60  AKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCL 119
           AK+               LA GVDPDCPPELHFI+RP L L E EPVTGFRFKLMTYNCL
Sbjct: 61  AKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCL 120

Query: 120 AQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMG 179
           AQALIRRKLFPDSGDALKW+RRS+VLLNEFKYY ADVICLQE+DHIQFQSFWK +FNK+G
Sbjct: 121 AQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLG 180

Query: 180 YDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFS 239
           YDGQY+RN TKNHGVAI+WRR MFQ+VDKMLIDYDKE S +I TRTTTNNVGLVLALKFS
Sbjct: 181 YDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFS 240

Query: 240 KEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDND 299
           ++V                 TTHLFWHPFGTYERTRQCYVVL+KMKEFMHRVNVLQN+ND
Sbjct: 241 EKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNEND 300

Query: 300 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXX 359
           GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYK+RAKTVIECSTSFKFSK R       
Sbjct: 301 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDESAD 360

Query: 360 XXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHP 419
                NIEK+GKDQPESPVPEN+HAN+EQIE+VD M QLHNSLDMRAISLYSVGY++VHP
Sbjct: 361 DEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHP 420

Query: 420 ENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGF 479
           ENAGLDNDRGEPEISNWANTWRGLLDYLFY+KKWDL+SN QEVENL DFEK NE+KCRGF
Sbjct: 421 ENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGF 480

Query: 480 LRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           LRMPP  EMTKHGQPHVGEY SDHLSMVCDLEL+L
Sbjct: 481 LRMPPGKEMTKHGQPHVGEYASDHLSMVCDLELEL 515

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/457 (65%), Positives = 352/457 (77%), Gaps = 1/457 (0%)

Query: 57  EHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTY 116
           E IA++               L  GVDPDCPPEL FI+R +L L E EPV G + K+M+Y
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSY 97

Query: 117 NCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFN 176
           NCLAQALIRRKLFPDSG+ALKW+RRS+VLLNEFK+Y+ DV+CLQE+D+IQ+QSFWK +F 
Sbjct: 98  NCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ 157

Query: 177 KMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLAL 236
           K+GY  Q+HR P+KNHGV IIW+   F+  D+MLID+D E SG I  RTTTNN  L+LAL
Sbjct: 158 KLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILAL 217

Query: 237 KFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQN 296
           KF+++V                 TTHLFWHPFGTYERTRQCYVVL KMKEFMHRVNVLQN
Sbjct: 218 KFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQN 277

Query: 297 DNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXX 356
           +NDGD+SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y SRAKTVIECSTSFKFSK R    
Sbjct: 278 NNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGE 337

Query: 357 XXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKS 416
                   NIEKFGKDQP++PVPE F ANDEQ ++V  M +LHNSLDMRA+SLYSV Y  
Sbjct: 338 DAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHK 397

Query: 417 VHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKC 476
           VHPEN+GLDN+RGEPEISNWA+TWRGLLDY+F I+ W+   +R E++ L DFE  N IK 
Sbjct: 398 VHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEF-DDRTEIDTLEDFENSNNIKI 456

Query: 477 RGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQ 513
           RG LRMPP SEM+ HGQPHVGEYPSDHL ++ ++EL+
Sbjct: 457 RGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVELR 493

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/459 (65%), Positives = 359/459 (78%), Gaps = 3/459 (0%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113
           ++PEH+AKV               LA G+DPD PPEL FI+RPLL+L E EP+ G  FKL
Sbjct: 35  MSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKL 94

Query: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173
           +TYNCLAQALIRRKLFPDSGD+LKWFRRSKVL  EFK+YNADV+CLQE+D+IQ+Q FWK 
Sbjct: 95  LTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKD 154

Query: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233
           + +K+GYD Q+++ P KNHGV+I W+R +FQ  D+MLIDYDKE+SG I  RT T+N GL+
Sbjct: 155 ELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLI 214

Query: 234 LALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293
           LALKF+                    T+HLFWHPFGTYERTRQCYVVL+KMKEFM RVNV
Sbjct: 215 LALKFTDAAKQSCPHIRKSGILVG--TSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNV 272

Query: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRX 353
           LQN+NDG+LSHW PFFCGDFNSQPFDTPYLSMTSKPV Y  RAKTV+ECSTS+ FSK+R 
Sbjct: 273 LQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRN 332

Query: 354 XXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVG 413
                      NIEKFGKDQP++PVPE F A  EQ ++V++M +LHNS+DMRAISLY+VG
Sbjct: 333 GEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVG 392

Query: 414 YKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNE 473
           Y  VHPEN+G+DNDRGEPE+SNWANTWRGLLDY+  I +WD  S+R++V++L  FEK+N 
Sbjct: 393 YGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWD-SSDRKKVDSLETFEKENS 451

Query: 474 IKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           +K RG LRMPPASEM+ HGQPH GEY SDHLSM+C +EL
Sbjct: 452 LKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/437 (69%), Positives = 351/437 (80%), Gaps = 4/437 (0%)

Query: 78  LAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALK 137
           LA G+DP+  P+L FIQRP+L L E EPVTGF+  +MTYNCLAQALIRRKLFPDSGDALK
Sbjct: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180

Query: 138 WFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAII 197
           WF+RSKVL NEFK+YN DVICLQE+DH+Q+QSFWK +F K+GY+ Q+HR  +KNHGVAII
Sbjct: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240

Query: 198 WRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXX 257
           WR+ +F   DKMLID+DKE SG I  RTTTNN GL L+LKF+ E                
Sbjct: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFT-EKALSKFSNGTSRMGII 299

Query: 258 XXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQP 317
             TTHLFWHPFGTYERTRQCYVVL KMKEFMHR+NVLQN+NDGD SHW+PFFCGDFNSQP
Sbjct: 300 VGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQP 359

Query: 318 FDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKFGKDQPESP 377
           FDTPYLSMTSKP+HYK RAKTVIECSTS+KFSK R            NIEKFGKDQP++P
Sbjct: 360 FDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTP 419

Query: 378 VPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWA 437
           VP++F AN+EQ ++V +M  LHNSLDMRAISLY VGY+ VHPENAGLDND GEPEISNWA
Sbjct: 420 VPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWA 479

Query: 438 NTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTK--HGQPH 495
           +TW GLLDY+ +IK W    + Q V+ L  FEK+N IK RG+LRMPP++EM+K  HGQPH
Sbjct: 480 HTWNGLLDYILFIKHWGF-DDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPH 538

Query: 496 VGEYPSDHLSMVCDLEL 512
            GEYPSDHLSM+C+LEL
Sbjct: 539 TGEYPSDHLSMICELEL 555

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/460 (65%), Positives = 358/460 (77%), Gaps = 5/460 (1%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113
           V+PEHIAKV               +A G+DPD PPEL FI+RP+L L +GE V GF+FKL
Sbjct: 39  VSPEHIAKVRAEREAARAAKKEAMMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98

Query: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173
           MTYNCLAQALIRRKLFP SGDALKW+RRSKVLLNEFKYYNADVICLQE+D+IQ+QSFWK 
Sbjct: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158

Query: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233
           +  K+GYD Q+HR  +KNHGVAI+W+R  F   DKMLID+D+E+SG I  RTTTNN GL+
Sbjct: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218

Query: 234 LALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293
           L+LKFS +V                 TTHLFWHPFGT+ERTRQCYVVL K+KEF HRVNV
Sbjct: 219 LSLKFSDKV---AQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNV 275

Query: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR- 352
           LQN NDGD SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  RAKTVIECSTS+ FSK+R 
Sbjct: 276 LQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRD 335

Query: 353 XXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSV 412
                       NIEKFG DQP+ PVP+++ A D + E+V+ M  LHNSLDMRA+SLYSV
Sbjct: 336 GEEDDAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSV 395

Query: 413 GYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKN 472
            Y+ VHPENAGLDN+RGEPEISNWA+TWRGLLDYLF+I+ WD  S+ +E+++L  FE++N
Sbjct: 396 AYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFEREN 454

Query: 473 EIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
            +K RG LR+PP  EMT+HGQPH GEYPSDHL M+C+LEL
Sbjct: 455 SLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/461 (63%), Positives = 360/461 (78%), Gaps = 3/461 (0%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113
           ++PEHIA+V               LA G+DPDCP EL FI+RP+L + E EPV GF+F L
Sbjct: 63  ISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122

Query: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173
           MTYNCLAQALIRRKLFP+ GDALKW RRSKVLLNEFK+YN D+ICLQE+DH+Q+QSFWK 
Sbjct: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182

Query: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233
           +F+K+GY+ Q+++ P+KNHGV+++W++ +F+  D+ML+DYDKE SG I  RTTTNN+ L+
Sbjct: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242

Query: 234 LALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293
           L+LKFSK+V                 TTHLFWHPFGTYERTRQCY++L KMKEF+ RVN+
Sbjct: 243 LSLKFSKKV-TERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301

Query: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRX 353
           LQN+ D D SHW+PFFCGDFNSQPFD+PYLSMTSKP+ Y  R+KTVIECSTSFKFSK R 
Sbjct: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360

Query: 354 XXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVG 413
                      NIEKFGKDQP+ PVP+++ ANDEQ  +V  M +LHNSLDMRAISLYS G
Sbjct: 361 DGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420

Query: 414 YKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNE 473
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFYIK WD   N+ E+++L DFE++N+
Sbjct: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNK-EIDSLEDFEREND 479

Query: 474 IKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           IK RG+LRMPPA E+  HGQP  GEYPSDHL M+C++EL L
Sbjct: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/460 (65%), Positives = 350/460 (76%), Gaps = 8/460 (1%)

Query: 53  IVTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFK 112
           I +PE IAK+               +        PPEL FI+RP+L L E EPV GF+F 
Sbjct: 116 IPSPEEIAKLRAERKLLKEAKKEVSV-------IPPELQFIKRPILYLHEEEPVQGFKFS 168

Query: 113 LMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWK 172
           +MTYNCLAQALIRRKLFPDSGDALKW+RRSKVLLNEF YY+ D+ICLQEVDHIQ+QSFWK
Sbjct: 169 MMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWK 228

Query: 173 GKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGL 232
            +F K+GY  QYHR   KNHGV+IIWRRS+F   DKMLI++DKE+SG++  RTTTNNVGL
Sbjct: 229 TEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNVPPRTTTNNVGL 288

Query: 233 VLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVN 292
           +L+LKF+ E                  TTHLFWHPFGTYERTRQCYVVL KMKEFMHRVN
Sbjct: 289 ILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVN 348

Query: 293 VLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR 352
           VLQN+ND DLSHW+PFFCGDFNSQPFD+PYLSM  KPV Y  RAKTVIECSTS+KFSK R
Sbjct: 349 VLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKR 408

Query: 353 XXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSV 412
                       NIEKFG DQP++PVPE F AN EQ  +V DM +LHNSL+MRAISLY V
Sbjct: 409 DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGV 468

Query: 413 GYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKN 472
           GYK+VHPENA +DN+ GEPEISNWA+TW GLLDYL ++K+W   S+  + E L  FE+ N
Sbjct: 469 GYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTF-SDCTKTETLKQFEESN 527

Query: 473 EIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
            ++ RGFLRMPPA+EMTKHGQPHVGEYPSDHLSM+C +EL
Sbjct: 528 SMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCSIEL 567

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/461 (66%), Positives = 354/461 (76%), Gaps = 5/461 (1%)

Query: 56  PEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMT 115
           PEHIAKV               LA G+DPD PPEL FI+RPLL+L + E   GF FK+MT
Sbjct: 54  PEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMT 113

Query: 116 YNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKF 175
           YNCLAQALIRRKLFPDSG+A+KWFRRSKVLLNEFKYY++DVICLQEVD IQFQ+FWK +F
Sbjct: 114 YNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEF 173

Query: 176 NKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLA 235
           +K+GYD Q+H  P+KNHG++I+W+RS+F   DKMLIDYDKE SG+I  RTTTNNVGLVLA
Sbjct: 174 DKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLA 233

Query: 236 LKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQ 295
           LKFS +V                 TTHLFWHPFGTYERTRQCY+VL K KEFMHRVNVLQ
Sbjct: 234 LKFSPKVLERFPNTRKSGIIVG--TTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQ 291

Query: 296 NDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXX 355
           N+ND    HW+ FF GDFNSQPFDTPYLSMTSKPV Y +RAKTVIECSTS+ FSK R   
Sbjct: 292 NNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGE 351

Query: 356 XXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYK 415
                    NIEKFGKDQP +PVP  F A+ EQ  +V +M +LHNSLDMRAISLYSVGY 
Sbjct: 352 EDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYG 411

Query: 416 SVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIK 475
           +VH ENAGLDN RGEPEISNWA+ W GLLDYLF IK WD  S++ +V++L  FE +NE+K
Sbjct: 412 TVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDF-SDKIQVDSLKKFEDENELK 470

Query: 476 CRGFLRMPPASEMTK--HGQPHVGEYPSDHLSMVCDLELQL 514
            + FL+MP  +EM K  HGQPHVGEYPSDHLSM+C LEL+L
Sbjct: 471 VKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLELKL 511

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/460 (65%), Positives = 351/460 (76%), Gaps = 2/460 (0%)

Query: 55  TPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLM 114
           +PE I +                LA G+DPD PPEL FI+RP+L L + EPVTGF F LM
Sbjct: 46  SPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLM 105

Query: 115 TYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGK 174
           TYNCLAQALIRRKLFPDSG+A+KWFRRSKVLL EF++YN+DVICLQE+DHIQ+Q+FWK +
Sbjct: 106 TYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVE 165

Query: 175 FNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVL 234
           F K+GY+ Q+HR  +KNHGVAI+W+R MF+  D+MLID+DKE S  I  RT TNN GL+L
Sbjct: 166 FEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLIL 225

Query: 235 ALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVL 294
           +LKFS ++                 TTHLFWHPFGTYERTRQCYV+L KMKEFMHRVNVL
Sbjct: 226 SLKFSDKILSTLPKNTKTTGIIIG-TTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVL 284

Query: 295 QNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXX 354
           QN NDGDLSHW PFFCGDFNSQPFD+PYLSMTSKP+ Y  RAKTVI+CSTS+KFSK+R  
Sbjct: 285 QNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNG 344

Query: 355 XXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGY 414
                     NIEKFGKDQP++PVPE F AN+EQ  +V+ M  +HN L MRA SLYSVGY
Sbjct: 345 EEDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGY 404

Query: 415 KSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEI 474
           K VH ENAG+DN RGEP ISNWANTWRGLLDY+F++  WD   NRQ V++L  FE +N I
Sbjct: 405 KHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSI 463

Query: 475 KCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           + RGFLRMP  SEM KHGQPH GEY SDHLSM+C++EL L
Sbjct: 464 RLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELLL 503

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/461 (65%), Positives = 353/461 (76%), Gaps = 4/461 (0%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113
           ++PEHIA+                LAHG+DP+ PP+L FI+RPLL L E EPV GF+FK+
Sbjct: 49  ISPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKI 108

Query: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173
           MTYN LAQALIRRKLFP SG+A+KWF+RSKVLLNEFK+Y+ADV CLQE+DHIQ+Q+FWK 
Sbjct: 109 MTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKE 168

Query: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233
           +F K+GY  Q+HR  TKNHGVAI+WR S+F  VD ML+DYDKE SG I  RTTT N GL+
Sbjct: 169 EFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLI 228

Query: 234 LALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293
           LALKF+ +V                 TTHLFWHPFGT+ERTRQCYVVL KMKE +HRVNV
Sbjct: 229 LALKFTDKV--LNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNV 286

Query: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRX 353
           LQN+ D D SHW+PF CGDFNSQPFDTPYLSMTSKPV Y+ RAKTVIECSTSF FSK+R 
Sbjct: 287 LQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR- 345

Query: 354 XXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVG 413
                      NIEKFGK QPE PVP+ FHA +EQ  +V  M  LHNSLDMRAISLY+VG
Sbjct: 346 DGEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVG 405

Query: 414 YKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNE 473
           YK VHPENAGLDND GEPEISNWA TWRGLLDY+F++K W+  ++R  V+ +  FE++N 
Sbjct: 406 YKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWN-GTDRSSVDKIDVFERENG 464

Query: 474 IKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           IK RG LRMPP  EMTKHGQPH GEYPSDHLSM+C++EL +
Sbjct: 465 IKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIELNV 505

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/492 (60%), Positives = 365/492 (74%), Gaps = 3/492 (0%)

Query: 23  IESVNIKQQTGDDSVVQAXXXXXXXXXXXPIVTPEHIAKVXXXXXXXXXXXXXXXLAHGV 82
           IE V +K+  GD S  +             I +PE IA++               LA+G+
Sbjct: 37  IEKVVVKEPFGDASAKKQKSKGKGKGKGKSIPSPEEIARIRAERAAAREEKQKKMLANGL 96

Query: 83  DPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRS 142
           DPDCPPEL FI+RPLL+L + EP   F F LMTYNCLAQALIRRKLFPDSG+A+KW+RRS
Sbjct: 97  DPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRS 156

Query: 143 KVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSM 202
           +VLLNEFKYYN D+ICLQE+DHIQFQSFW+ +F KMGY  Q+HR  +KNHGVAI+W+ ++
Sbjct: 157 RVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNL 216

Query: 203 FQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXX-XXXXXXXXXXXXXTT 261
           F+  D+MLID+DKE SG IL RT TNN GL+L+LK+S  V                  TT
Sbjct: 217 FRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTT 276

Query: 262 HLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTP 321
           HLFWHPFGTYERTRQC+V+L K+KEF  RVNVLQN+NDG++ HW  FFCGDFNSQPFDTP
Sbjct: 277 HLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTP 336

Query: 322 YLSMTSKPVHYKSRAKTVIECSTSFKFSKVRX-XXXXXXXXXXXNIEKFGKDQPESPVPE 380
           YLS+TSKPV YK RAK VIECSTS+ +SK+R             NIEKFGKDQP++PVP+
Sbjct: 337 YLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPVPD 396

Query: 381 NFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTW 440
           ++    EQ ++V  M  LHNSL+M+A SLY+VGYK VHPEN+GLDN +GEPEISNWA++W
Sbjct: 397 SYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSW 456

Query: 441 RGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYP 500
           RGLLDY+FY+  WD  S+ +EVE+   FEKKN +K RG+LRMPPA+EM+K+GQPH GEYP
Sbjct: 457 RGLLDYIFYVDHWDF-SDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEYP 515

Query: 501 SDHLSMVCDLEL 512
           SDHLSM+C +EL
Sbjct: 516 SDHLSMMCKIEL 527

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/463 (63%), Positives = 346/463 (74%), Gaps = 4/463 (0%)

Query: 52  PIVTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRF 111
           P V+PEHIA+V               +A G+DPD PP+L FI RP+LSL   E   GF F
Sbjct: 37  PKVSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVF 96

Query: 112 KLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFW 171
           KLMTYNCLAQALIRRKLFP SG+ALKWF+RS+VLLNEF +YN+DV+CLQEVD+IQ+QSFW
Sbjct: 97  KLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFW 156

Query: 172 KGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVG 231
           K +F K+GY+ Q+HR+ TKNHG+AI+W+R MF  VDKMLIDYDKE SG++  RTTT NVG
Sbjct: 157 KEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVG 216

Query: 232 LVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRV 291
           L +AL F+K+V                 TTHLFWHPFGT+ERTRQCYV+L KMKEFMHR+
Sbjct: 217 LAIALGFTKKV--LAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRI 274

Query: 292 NVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKV 351
           NVLQ+      + W+PFFCGDFNSQPFDTPYLS++SKPV YK RAKTVIECSTS+ FSK 
Sbjct: 275 NVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKA 334

Query: 352 RXXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYS 411
           R            NIEKFG  QPE PVPE F A +EQ  +V+ M  LHNSLDMR IS+YS
Sbjct: 335 R-DGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYS 393

Query: 412 VGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKK 471
           VGYK VH ENAGLDN+  EPEISNWA TWRGLLDY+F+IKKWD  S++   E L  F+ +
Sbjct: 394 VGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDE 452

Query: 472 NEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
           N IK RG LRMPPA EM  HGQPH GEY SDHLSM+C+LEL++
Sbjct: 453 NGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELELKI 495

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/459 (62%), Positives = 337/459 (73%), Gaps = 5/459 (1%)

Query: 56  PEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMT 115
           PEHIA+V               LA G+DP+ PP+L FI RP+L L       GF FK+MT
Sbjct: 41  PEHIAEVRAKREAAKKAKREEMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100

Query: 116 YNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKF 175
           YNCLAQALIRRKLFP SG+ALKWF+RS+VLLNEF +Y ADV CLQE+D+IQ+QSFWK +F
Sbjct: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160

Query: 176 NKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLA 235
            K+GYD Q+HR+ TKNHG+AI+W+R +F  VDKML+DYDKE SGS+  RTTT NVGLVLA
Sbjct: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220

Query: 236 LKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQ 295
           L FSK+V                 TTHLFWHPFGT+ERTRQCYV+L KMK+F+HRVNVLQ
Sbjct: 221 LAFSKKV--LDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ 278

Query: 296 NDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXX 355
            D       W+PFFCGDFN+QPFDTPYLSM+SKPV YK RAKTVIECSTS+ FSK R   
Sbjct: 279 -DGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-DG 336

Query: 356 XXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYK 415
                    NIEKFG  QPE PVP+ + A  EQ E+V  M +LHNSLDMRAIS+YSV YK
Sbjct: 337 EECDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYK 396

Query: 416 SVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIK 475
            VHPENAG DN   EPEISNWA TWRGLLDY+F+IK+W+   N++  E L  FEK+N++K
Sbjct: 397 HVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRP-EELQTFEKENDVK 455

Query: 476 CRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514
               LRMPP+ EM  HGQPH GEY SDHLS++C++EL L
Sbjct: 456 ILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/463 (57%), Positives = 332/463 (71%), Gaps = 8/463 (1%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFR--- 110
           +TPE+IA++               +A G+DP  P +L FI+RP+L++         R   
Sbjct: 56  ITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115

Query: 111 -FKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
              +MTYNCLAQALIRR LFP SG+A+KWF+RS+VLLNEFKYYN DV+CLQE+D +Q++S
Sbjct: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175

Query: 170 FWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNN 229
           FWK +F K+GY  Q+H NPTKNHGV I W+  +F   DKMLIDYDKE +G+I  RTTT N
Sbjct: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235

Query: 230 VGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMH 289
           VG++L+LKF K+V                 TTHLFWHPFGTYERTRQCY+VL+K+KEF +
Sbjct: 236 VGMLLSLKFKKKV--LEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293

Query: 290 RVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFS 349
           R+NVLQN+ DGD SHW  FFCGDFNSQPFD PYLS+TSKPV Y  RAKTVIECSTSF FS
Sbjct: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353

Query: 350 KVRXXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISL 409
           K+R            NIEKFGK QPE+PVPE+F  N+EQ ++ ++M  LHN +DMRAISL
Sbjct: 354 KLR-DGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISL 412

Query: 410 YSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFE 469
           YS+ Y  VHPEN+GLDN R EPEISNWA+ WRGLLDYL+Y+  WD   +  +++ LS FE
Sbjct: 413 YSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD-GCDCTKIDELSTFE 471

Query: 470 KKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           +   ++    LR+PPA EMT+HGQPH GEYPSDHL M+  L +
Sbjct: 472 QNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/447 (62%), Positives = 324/447 (72%), Gaps = 21/447 (4%)

Query: 81  GVDPDCPPELHFIQRPLLSL---------GEGEPVTGFRFKLMTYNCLAQALIRRKLFPD 131
           G   D P EL FI+RP+LS+         G   PVT     LMTYNCLAQALIRRKLFPD
Sbjct: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVT-----LMTYNCLAQALIRRKLFPD 98

Query: 132 SGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKN 191
           SG ALKW+RRS+VLLN+FK+Y  DV+CLQEVD +Q+ SFW+G+F K+GY  Q+H+  TKN
Sbjct: 99  SGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKN 158

Query: 192 HGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXXXXXXX 251
           HGVA++WR  +F   DKMLID+DKE SG +  RTTTNN GLV+ALKF+++          
Sbjct: 159 HGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQA--LTGHRDT 216

Query: 252 XXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCG 311
                   TTHLFWHPFGT+ERTRQCYVVL KMKEFMHRVNVLQN+NDG+  HWFPFFCG
Sbjct: 217 PRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCG 276

Query: 312 DFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR--XXXXXXXXXXXXNIEKF 369
           DFNSQP+D PYLSMTSKPV Y  RA+TVIECSTS+ FSK R              NIE F
Sbjct: 277 DFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIF 336

Query: 370 GKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRG 429
           GKDQP  PVP  F  N EQ  +V  M  LHNSLDMRA+SLYSVGY++VHPENAG DN RG
Sbjct: 337 GKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARG 396

Query: 430 EPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMT 489
           EPEISNWA+TW GLLDYLFY+  WD + +R  V+ L +FE+ + +  +  LRMP   EM 
Sbjct: 397 EPEISNWAHTWNGLLDYLFYVGHWDFK-DRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQ 455

Query: 490 K--HGQPHVGEYPSDHLSMVCDLELQL 514
           +  HGQPH GEYPSDHL+MVCDLEL L
Sbjct: 456 QFGHGQPHTGEYPSDHLAMVCDLELAL 482

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 315/426 (73%), Gaps = 5/426 (1%)

Query: 89  ELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNE 148
           ++ FI+RPLL +  G+   GF F++MTYNCLAQALIRRKLFP SG+ALKWF+RSKVLL+E
Sbjct: 84  DVGFIKRPLL-VCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 149 FKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDK 208
            +YYN DVICLQE+DH Q++SFW       GY  ++HR+  KNHG+AI+WRRS+F KVD+
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 209 MLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPF 268
            LID+D+E SG I  RTTT NVGL++AL+++ E+                 T+HLFWHPF
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEI--KRRYPGSAQSGIVVGTSHLFWHPF 260

Query: 269 GTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSK 328
           GTYER RQCY++L +MK F+ R+ +L+  + G  S W PFFCGDFNSQPFD PYLSM SK
Sbjct: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320

Query: 329 PVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQ 388
           P+ Y+ RA+TVIECSTS+KFS +R            NIEKFG  QPE+PVP++F    EQ
Sbjct: 321 PIIYEGRARTVIECSTSYKFSSLR-DGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379

Query: 389 IEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 448
             +VD M  LHN+LDMRAISLYS+ Y+ VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ 
Sbjct: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439

Query: 449 YIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVC 508
           Y+  WD   N  EV+++ +F+K   +  R  LR+PPASEM  HGQPH GEYPSDHLS++C
Sbjct: 440 YVMPWDFSDN-TEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498

Query: 509 DLELQL 514
           +LEL +
Sbjct: 499 ELELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  515 bits (1327), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/426 (57%), Positives = 305/426 (71%), Gaps = 8/426 (1%)

Query: 90  LHFIQRPLLSLGEGEPV-TGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNE 148
           L FI RP+L L   + V  GF F LMTYNCLAQ+LIRR LFP SG ALKW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 149 FKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDK 208
           FK+YNADV+CLQE+D+ Q+ SFW  + + +GY  ++HR   K+HGVAI W++ +F  +D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 209 MLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPF 268
           MLI++D E SG I  R TTNNVG++LAL FS +V                 T+HLFWHPF
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKV--KQSFPGTVKSGIIVGTSHLFWHPF 246

Query: 269 GTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSK 328
           GTYERTRQCYV+L KMKEF+HRV++ QN++  DL+ W+PFFCGDFNSQPFD PYLS+TSK
Sbjct: 247 GTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSK 306

Query: 329 PVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQ 388
           PV Y  RAKTVIECS ++KF  +             +    G+D+P  PVPE+F    E 
Sbjct: 307 PVLYSGRAKTVIECSAAYKFPDL----GAGARGANEDGGTVGEDRPVDPVPESFQPTAEV 362

Query: 389 IEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 448
             +V  M +LHNSLDMRAISLY+V YK VHP+NAGLDN+RGEPEISNWA TWRGLLDY+ 
Sbjct: 363 SSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIM 422

Query: 449 YIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVC 508
           YI  W   SN  EV++L  FEK + I  +  LRMPPA EM+ HGQPH GEYPSDHL+M+C
Sbjct: 423 YITPWQ-ASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMC 481

Query: 509 DLELQL 514
            LE+++
Sbjct: 482 KLEVEM 487

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  460 bits (1183), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 221/477 (46%), Positives = 303/477 (63%), Gaps = 30/477 (6%)

Query: 53  IVTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFK 112
           ++  E+I K+               + HG +PD P EL FI+RPLL+L + +PV G   K
Sbjct: 33  MLNTEYITKIRAEREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLK 92

Query: 113 LMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWK 172
           +MTYNCLAQ+LI+R LFP SG ALKW RRSKVLLNE KYY++D++ LQE+D +QF+ +WK
Sbjct: 93  IMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWK 152

Query: 173 GKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGL 232
               K+GYD ++++   K HGV I W+R++F KV  + ID+D+  SG+I  RT T NVGL
Sbjct: 153 IVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGL 212

Query: 233 VLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVN 292
           V+AL+F                     TTHLFWH FGT+ERTRQCYV++ +M +FM ++ 
Sbjct: 213 VIALEF-----LNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL- 266

Query: 293 VLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR 352
                  G +  W+PFF GDFNSQP D PY+S+TSKPV +++  K VIECS ++K+SK R
Sbjct: 267 -------GGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKR 319

Query: 353 X-----------------XXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDM 395
                                          E+   +QP +  P +F    EQ E+V  +
Sbjct: 320 NGEEEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQL 379

Query: 396 VQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDL 455
             LHNSL++RAISLYSVGY+ V PENA ++NDRGEPE+S WA  W GLLDY+F+++ WD 
Sbjct: 380 AALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDG 439

Query: 456 QSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           ++N ++V++L  FE++N +K RG L+MP + EM +H  P+ GEYPSDHL M+  LEL
Sbjct: 440 KTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  439 bits (1128), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 291/464 (62%), Gaps = 14/464 (3%)

Query: 55  TPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCPPELHFIQRPLLSLGEGEPVTG---FRF 111
           +PE+I+++               +  G+DPD PPEL F +RP L+L + EP  G     F
Sbjct: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78

Query: 112 KLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFW 171
            ++TYNCLAQ LI R +FP+SG+ALKW RRSK ++NE KYYN D++CLQE+D    + FW
Sbjct: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138

Query: 172 KGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVG 231
             +F  +GY  ++ +   K HGV I WR S+F+  D+  +D+D+  +G I  RT T N+G
Sbjct: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198

Query: 232 LVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRV 291
           L++AL+F   +                 TTHLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 199 LIVALQF---LDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255

Query: 292 NVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKV 351
           N         +++W+PF  GDFNSQP D PY+SMT+KP+ Y    +TVIECSTS+ +SK 
Sbjct: 256 N-----EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310

Query: 352 R---XXXXXXXXXXXXNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAIS 408
           R                 E+F K QP  P P  F    EQ  +V+ + QLHNSL  RAIS
Sbjct: 311 RNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370

Query: 409 LYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDF 468
           LYSVGY++VHPEN+ ++N RGEPE S+W   W GLLDY+FYIK W+L+    +VE L  F
Sbjct: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430

Query: 469 EKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           EK N +K  GFL++P   EM  H QP+ GEYPSDHL+++C L+L
Sbjct: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  429 bits (1103), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 287/444 (64%), Gaps = 16/444 (3%)

Query: 78  LAHGVDPDCPPELHFIQRPLLSLGEG--EPVTGFRFKLMTYNCLAQALIRRKLFPDSGDA 135
           L  G DPD P EL FI+RP+L L         GF+F LMTYNCLAQA+IRR++F DSG A
Sbjct: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97

Query: 136 LKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKF-NKMGYDGQYHRNPTKNHGV 194
           LKWFRRSKVL+NE  YYN D++CLQE+D  Q+++FWK +  + +  +  Y++   K+HGV
Sbjct: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157

Query: 195 AIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXX-----XXXX 249
            I W++S+F++VD M++D+D   + +I  RT T N+ + +ALKF+ E             
Sbjct: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217

Query: 250 XXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFF 309
                     TTHLFWHPFGT+ERTRQCY++L KMK+F+  +NV     D   +HW+PF 
Sbjct: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFI 273

Query: 310 CGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKF 369
           CGDFNS P D PYLSMTSKP+ Y  R K VIECST++KFSK R              EK 
Sbjct: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE---EKK 330

Query: 370 GKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRG 429
             +QP+  VP++F    EQ ++V  +  LHN L +RA SLY + YK V P N  ++NDRG
Sbjct: 331 LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRG 390

Query: 430 EPEISNWANTWRGLLDYLFYIKKWDLQSNRQEV-ENLSDFEKKNEIKCRGFLRMPPASEM 488
           EPE ++WA +W G+LDY+ Y+  WD+     E+ E+L +FEK N++  +G L+MP   +M
Sbjct: 391 EPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDM 450

Query: 489 TKHGQPHVGEYPSDHLSMVCDLEL 512
             H QP   EYPSDH+S++C++E+
Sbjct: 451 PFHTQPFEREYPSDHISILCEMEI 474

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/438 (42%), Positives = 275/438 (62%), Gaps = 27/438 (6%)

Query: 92  FIQRPLLSLGEGEPV-TGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFK 150
           FI+R +L L   E +      K+MTYN L+Q+LIRR+++PD+ DA+KW  RSKV+LNE K
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 151 YYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYH---RNPTKNHGVAIIWRRSMFQKVD 207
           YYN D++C QEVD IQ+  FW  + +K+GY+G+++   R P K HGVAI WR ++F++ D
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGP-KVHGVAIFWRSNLFEQFD 171

Query: 208 KMLIDYDKEASGSILTRTT-TNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWH 266
            + I++D   +G+ +++TT T NVGL++ALKF                     TTHLFWH
Sbjct: 172 VIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSS-------NAKFRSGIVIGTTHLFWH 224

Query: 267 PFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMT 326
           PFGT+ERTRQ  ++L+K ++ +  +N      +   + W P   GDFNSQP D PYLS+T
Sbjct: 225 PFGTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSIT 284

Query: 327 SKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIE----------KFGKDQPES 376
           SKPV     AKTVIECST++KFS+ R            N E          +  +  P  
Sbjct: 285 SKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPID 344

Query: 377 PVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNW 436
           P P +F A  EQ +++  + ++HNS++++A SL+ + YK VH  + GL N + EPE+S+ 
Sbjct: 345 PRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHT 401

Query: 437 ANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHV 496
           +  W GLLDY+F ++ W+ +  + +  +L DFEK+  ++ +G L+MP   E+ K+ QPH 
Sbjct: 402 SIFWTGLLDYIFILEPWN-EVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQ 460

Query: 497 GEYPSDHLSMVCDLELQL 514
           G+YPSDHLSM+CDL +++
Sbjct: 461 GQYPSDHLSMICDLNVRI 478

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/476 (39%), Positives = 278/476 (58%), Gaps = 39/476 (8%)

Query: 55  TPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCP-PELHFIQRPLLSLGEGEPVTGFR--- 110
           T +HI K+               ++ G DPD P P+L FI+RPLL +   +    F+   
Sbjct: 41  TIDHIKKIREERAERRQRCRNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100

Query: 111 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQE 161
                     K+MTYN LAQ LIRR  FP SG ALKW +RSKVL++E K Y  D++ LQE
Sbjct: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160

Query: 162 VDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSI 221
           VD+ + + FW+  F+K+G+D  + RN  K HG+ + W    FQ  ++ ++DYD+  +G++
Sbjct: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219

Query: 222 LT-RTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVV 280
           ++ RT T N+ L+++L+F                      THLFWHPFG +ER RQ Y+V
Sbjct: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272

Query: 281 LRKMKEFMHRVNVLQNDNDGDLSH-WFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTV 339
           L+K++E            D    H W     GDFN++P + PYL++TSKP+      + +
Sbjct: 273 LQKIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAM 322

Query: 340 IECSTSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPENFHANDEQIEIVDDMV 396
           +ECS ++++SK R            +    G+   +QP++P P++F A  E+ ++V+ ++
Sbjct: 323 VECSLAYRYSKKRNGEESDQDDEDYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLI 382

Query: 397 QLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQ 456
            LHNSL ++ ISLY +GY  VHPENA  +   GEPE+SNWANTW GLLDY+FYI+  D  
Sbjct: 383 TLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNN 440

Query: 457 SNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           S +QE ++L+ FE+ N +   G+LRMP   EM KH QP  GEY SDH+S++C + L
Sbjct: 441 SAQQE-KSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  352 bits (904), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/446 (41%), Positives = 255/446 (57%), Gaps = 32/446 (7%)

Query: 78  LAHGVDPDCPPELHFIQRPLLSLGEGEPVT-GFRFKLMTYNCLAQALIRRKLFPDSGDAL 136
           L+ G+DPD P E  FI+RP+L +  G+    G    +MTYNCLAQ LIRR++FP+SG AL
Sbjct: 46  LSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPAL 105

Query: 137 KWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAI 196
           KWF RSKVLL+E K+YNAD+ CLQE+D +Q+  FW  +  K GY   Y    +K+HGV I
Sbjct: 106 KWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMI 165

Query: 197 IWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXX 256
            W+  +FQ    M I++DKEA   I  RT TNNVGL++AL F+                 
Sbjct: 166 AWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGV 225

Query: 257 XXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316
              T HLFWHPFGTY+RTRQC V+ +K+ EF   V        GD   +   F GDFNSQ
Sbjct: 226 IIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-------GD---YCKMFTGDFNSQ 275

Query: 317 PFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRXXXXXXXXXXXXNIEKF------- 369
           P   PYL +T       ++ +T IE ST++++S+ R              E+        
Sbjct: 276 PNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYE 335

Query: 370 ---GKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDN 426
              G D   +P P+ F + +EQ ++V++++   N + + A SLYS+GY +V P +     
Sbjct: 336 YDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA--- 392

Query: 427 DRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPAS 486
           D  EPE+S+W+  W GLLDY+FY+         Q     + FE  N I   G+L+MP  +
Sbjct: 393 DHHEPELSSWSTKWAGLLDYIFYVN--------QRPSTPATFETANNIAIAGYLQMPTHA 444

Query: 487 EMTKHGQPHVGEYPSDHLSMVCDLEL 512
           +M  H QP+ GEYPSDH+SM+C LE+
Sbjct: 445 QMHNHSQPYTGEYPSDHISMMCALEI 470

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/475 (39%), Positives = 272/475 (57%), Gaps = 36/475 (7%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCP-PELHFIQRPLLSLGEGE-----PVT 107
           ++ + I K+               ++ G DPD P P+L FI+RP L +         P T
Sbjct: 40  LSVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPAT 99

Query: 108 ------GFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQE 161
                     K+MTYN LAQ LIRR  FP+SG ALKW +RSKVL++E K Y  DV+ LQE
Sbjct: 100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQE 159

Query: 162 VDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSI 221
           VD+ +  +FW+  F+K+G+D  + R+  K HG+ + W    FQ  +  ++DYD   +G++
Sbjct: 160 VDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNV 218

Query: 222 LT-RTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVV 280
           ++ RT T N+ L+++L F                      THLFWHPFG +ER RQ Y+V
Sbjct: 219 ISARTRTKNIALIISLYFK-------GITDSSSRGIIVANTHLFWHPFGVFERLRQSYLV 271

Query: 281 LRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVI 340
           L+K++E    +      N      W     GDFN++P + PYL++T +P+  K   + ++
Sbjct: 272 LQKIQE----IKACSKYNG-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMV 322

Query: 341 ECSTSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPENFHANDEQIEIVDDMVQ 397
           ECS ++++SK R            + +  G+   DQP++P PE+F A  E+  +V+ +V 
Sbjct: 323 ECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVA 382

Query: 398 LHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQS 457
           LHNSL ++ +SLY +GY  VHPENA  +   GEP +SNWANTW GLLDY+FYI+    Q 
Sbjct: 383 LHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQD 440

Query: 458 NRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
            RQ+ E L+ FE  N +K  G+LRMP A EM KH QP  GEY SDH+S++C + L
Sbjct: 441 TRQK-EPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  348 bits (892), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 264/469 (56%), Gaps = 32/469 (6%)

Query: 54  VTPEHIAKVXXXXXXXXXXXXXXXLAHGVDPDCP-PELHFIQRPLLSL------GEGEPV 106
           +T E + K+               ++ G DPD P P+L FI+RP L L      G  E  
Sbjct: 42  LTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTEST 101

Query: 107 -TGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHI 165
                 K+MTYN LAQ LIRR  FP SG ALKW +RSKVL++E K Y  D++ LQEVD+ 
Sbjct: 102 PNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYN 161

Query: 166 QFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASG-SILTR 224
           + + FW+  F K+G+D  + R+  K HG+ I W    FQ  ++ ++DYD   +G +I  R
Sbjct: 162 ELK-FWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPAR 220

Query: 225 TTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKM 284
           T T N+ L+ +L+                       THLFWHPFG +ER RQ Y+VL K+
Sbjct: 221 TRTKNIALIASLRLKN-------ISDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKI 273

Query: 285 KEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECST 344
           +E    +      N      W     GDFN++P + PYL++T KPV     A+ + ECS 
Sbjct: 274 QE----IKACPKYNG-----WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSL 324

Query: 345 SFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPENFHANDEQIEIVDDMVQLHNS 401
           ++++SK R            + +  G+   +QP++P P++F A  EQ  +VD +V LHNS
Sbjct: 325 AYRYSKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNS 384

Query: 402 LDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQE 461
           L +R +SLY +GY  V PEN+   N  GEPE+SNWAN+W GLLDY+FYI+  D  S   +
Sbjct: 385 LHVRGVSLYGLGYGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQ 442

Query: 462 VENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDL 510
              + DFE KN ++  G+L+MP A EM KH QP  GEY SDH+S++C L
Sbjct: 443 -NPVDDFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQL 490

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  343 bits (879), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/439 (42%), Positives = 258/439 (58%), Gaps = 31/439 (7%)

Query: 92  FIQRPLLSLG--EGEPVT-GF-RFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLN 147
           FI+RPLL +    G P   G+ R K+MTYN LAQ LIRR  FPD+ DA+KW RRS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 148 EFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQK-- 205
           E +YY+ADV+CLQE D IQ+  FW  +F+++GY G +   P K HGVAI+W+ SMF+   
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 206 VDKMLIDYDKEASGSILTRTT-TNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLF 264
           +DK+ +  D   +G  +  TT T  V L +AL+                      TTHLF
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHH---------KTSRPIIFSTTHLF 213

Query: 265 WHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLS 324
           WH FGT+ERTRQ +V+L ++ +F+ +V              + FF GDFNSQP D PYLS
Sbjct: 214 WHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRG---QRCYTFFTGDFNSQPCDAPYLS 270

Query: 325 MTSKPVHYKSRAKTVIECSTSFKFSKVRXX-------XXXXXXXXXXNIEKFGKDQPESP 377
           +T KPV  K RAK++IECS S+++SK R                   ++E    ++P+ P
Sbjct: 271 LTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDP 329

Query: 378 VPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAG--LDNDRGEPEISN 435
            P  + A  EQ+E V  +  LHN + ++ +SLY +GY  VHPEN+     +   EP++S+
Sbjct: 330 RPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSH 389

Query: 436 WANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPH 495
            A  W GLLDY+F I +W    N  ++ +L   E++  IK  G+LRMP   EM  H +PH
Sbjct: 390 RALHWSGLLDYIFLITEW--SENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPH 447

Query: 496 VGEYPSDHLSMVCDLELQL 514
             EYPSDHL+M+CD+ L L
Sbjct: 448 ENEYPSDHLAMMCDISLPL 466

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  341 bits (874), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 182/472 (38%), Positives = 266/472 (56%), Gaps = 37/472 (7%)

Query: 57  EHIAKVXXXXXXXXXXXXXXXLAHGVDPDCP-PELHFIQRPLLSL-----------GEGE 104
           +HI K+               ++ G DPD P P+L FI+RP L +           G   
Sbjct: 45  DHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQV 104

Query: 105 PVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDH 164
           P +    ++MTYN LAQ LIRR  FP SG ALKW +RSKVL++E K Y  D++ LQEVD+
Sbjct: 105 PPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDY 164

Query: 165 IQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASG-SILT 223
            +   FW   F+K+G+   + R+  K HG+ + W    FQ+ ++ ++DYD   +G +I  
Sbjct: 165 NEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISA 223

Query: 224 RTTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRK 283
           RT T N+ L+++L                        THLFWHPFG +ER RQ ++VL+K
Sbjct: 224 RTRTKNIALIVSLSVKN-------MTNLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKK 276

Query: 284 MKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECS 343
           ++E                  W     GDFN++P + PY+++T +P+     A+ + ECS
Sbjct: 277 IEEI---------KTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECS 327

Query: 344 TSFKFSKVRXXXXXXXXXXXXNIEKFGK---DQPESPVPENFHANDEQIEIVDDMVQLHN 400
            ++++SK+R              E  G+   DQP++P P+ F A  EQ  +V+ +V LHN
Sbjct: 328 LAYRYSKMRNGEESDQDEECDE-ESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHN 386

Query: 401 SLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQ 460
           SL ++ ISLY + Y  VHP+N+    + GEPE+SNWANTW GLLDY+FYI++ D  S+ +
Sbjct: 387 SLHVKGISLYGLSYGKVHPDNS--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSK 444

Query: 461 EVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512
           + E + +FE +N +K  G+LRMP A EM KH QP  GEY SDH+S++C L L
Sbjct: 445 D-EPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 94/227 (41%), Gaps = 35/227 (15%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F L++YN L Q     K++      AL W  R + L +E   Y  D+ICLQEV+   ++ 
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE 457

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G +H          ++  K  G  I ++ S F  V K  ID+      
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L++ L+  +                   TTHL W P   
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALIIKLRHER-----------TGEHVWVVTTHLHWDPHFN 566

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPF-FCGDFNSQ 316
             +T Q  V+L  +++ + +   + +  D       P   CGDFNSQ
Sbjct: 567 DVKTFQVAVMLDYIEKLLKQHGGVGSPQD---KKKIPLVICGDFNSQ 610

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 97/226 (42%), Gaps = 33/226 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F L++YN L Q     K++  +   AL W  R + L  +  YY+ D+ICLQEV+   ++ 
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     + GY G +H          ++  K  G  + +R S F+ + K  +D+      
Sbjct: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L++ L+  K                   TTHL W P   
Sbjct: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHLKS-----------GEHVWAATTHLHWDPQFN 578

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316
             +T Q  V+L  M++ +   +    +N  +L       CGDFNSQ
Sbjct: 579 DVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQ 622

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 107/269 (39%), Gaps = 36/269 (13%)

Query: 82  VDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGD-ALKWFR 140
           +D D  P+  +      S G    +T   F +++YN L Q     K++  +   AL W  
Sbjct: 406 LDIDGEPKHEYESLQESSQGVDHELTKKSFTVLSYNTLCQHYATPKMYRYTPSWALSWEY 465

Query: 141 RSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQY----------HRNPTK 190
           R   L ++   Y+ D++CLQEV+   F+ FW     K GY G +          HR+  K
Sbjct: 466 RRAKLRDQILSYSCDIMCLQEVEARTFEDFWLPLLEKHGYSGSFHAKTRAKLLQHRDSKK 525

Query: 191 NHGVAIIWRRSMFQKVDKMLIDYDK--------EASGSILTRTTT-NNVGLVLALKFSKE 241
             G  + ++R+ F+ + K  +D+          + +   L R    +N+ L   L+    
Sbjct: 526 VDGCCVFFKRTKFRLIKKEEVDFSSTWMKHEKFQRTEDFLNRAMNKDNIALYFKLQ---- 581

Query: 242 VXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGD 301
                             TTHL W P     +T Q  V+L  ++  + + N  Q     D
Sbjct: 582 -------HIASGEHIWVATTHLHWDPKFNDVKTFQVGVLLDHLQTLIRQDNPRQ-----D 629

Query: 302 LSHWFPFFCGDFNSQPFDTPYLSMTSKPV 330
           +       CGDFNS      Y  ++S  V
Sbjct: 630 VKKAPVIICGDFNSYIDSAVYELLSSGSV 658

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 95/226 (42%), Gaps = 33/226 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F L++YN L Q     K++  +   AL W  R   L  +   + ADV+CLQEV+   F+ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G +H          ++  K  G  + ++ S F+ V K  +D+      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L + L+  K                   TTHL W P   
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHLK-----------TNEQIWVTTTHLHWDPQFN 567

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316
             +T Q  V+L  M++ +   N + N+   ++       CGDFNSQ
Sbjct: 568 DVKTFQVGVLLDYMEKLLRDQNGVGNNQ--EMKKVPLVICGDFNSQ 611

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 97/228 (42%), Gaps = 37/228 (16%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R + L  +   YN D++CLQEV+   ++ 
Sbjct: 408 FTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYED 467

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     + GY G +H          ++  K  G    ++ S F+ + K  +D+      
Sbjct: 468 FWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMK 527

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV LV+ L+  K                   TTHL W P   
Sbjct: 528 HKKFQRTEDYLNRAMNKDNVALVVKLQHIKS-----------GEHVWAATTHLHWDPQFN 576

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQN--DNDGDLSHWFPFFCGDFNSQ 316
             +T Q  V+L    ++M +V   QN  +N  +L       CGDFNSQ
Sbjct: 577 DVKTFQVGVLL----DYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQ 620

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 93/227 (40%), Gaps = 35/227 (15%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F L++YN L Q     K++      AL W  R + L  E   Y  DVICLQEV+   ++ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G +H          ++  K  G  I ++ S F  + K  ID+      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +N+ L++ LK                      TTHL W P   
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKLKHE-----------LSGEHVWVVTTHLHWDPHFN 613

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPF-FCGDFNSQ 316
             +T Q  V+L  +++ + + + + N  +       P   CGDFNSQ
Sbjct: 614 DVKTFQVGVLLDYIEKLLKQQSNIGNPQE---KKKVPLIICGDFNSQ 657

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 95/227 (41%), Gaps = 40/227 (17%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R + L  +   +N D+ICLQEV+   F+ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW+    K GY G +H          ++  K  G    ++ S F+ + K  +D+      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 216 ----EASGSILTRTTT-NNVGLVLALKF--SKEVXXXXXXXXXXXXXXXXXTTHLFWHPF 268
               + +   L R    +NV +V+ L+   S E+                 TTHL W P 
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEI-------------MWLVTTHLHWDPK 704

Query: 269 GTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
               +T Q  V+L  M+  +   N  Q     D+  +    CGD NS
Sbjct: 705 FNDVKTFQVGVLLDHMETLLKEQNPKQ-----DVKKYPLVICGDLNS 746

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 93/229 (40%), Gaps = 39/229 (17%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F L++YN L       K++  +   AL W  R + L  +   ++ DVICLQEV+ + ++ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           +W     K  Y   +H          ++  K  G AI +++  FQ V +  ID+      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
                 +   L R    +NV L+  LK                      TTHL W P   
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAELK-----------HLNTNENVWVVTTHLHWDPQFN 622

Query: 271 YERTRQCYVVLRKMKEFM---HRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316
             +T Q  V+L  ++  +   H VN     N+ D+       CGDFNSQ
Sbjct: 623 DVKTFQVGVMLDYLETLIKQHHHVN-----NNNDIKKIPMVICGDFNSQ 666

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 93/225 (41%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R   L  +   Y++DV+CLQEV+   F+ 
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           +W     K GY G +H          ++  K  G  I ++R  F+ V++  +D+      
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMK 618

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L L L+                      TTHL W P   
Sbjct: 619 HKKFQRTEDYLNRAMNKDNVALFLKLQ-----------HVSSGDTIWVVTTHLHWDPKFN 667

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  ++  +       +++  D+       CGDFNS
Sbjct: 668 DVKTFQVGVLLDHLETLLKEDTT--HNSRQDIKKSPVLICGDFNS 710

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 93/225 (41%), Gaps = 36/225 (16%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL+W  R + L  +   Y  D++CLQEV+   ++ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G +H          ++  K  G  + +++S F+ + K  +D+      
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQK 585

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV + + L+  +                   TTHL W P   
Sbjct: 586 HKRFQRTEDYLNRAMNKDNVAIYMKLQHVQS-----------GEYLWVVTTHLHWDPKFN 634

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  M+  +   N  Q     D+  +     GDFNS
Sbjct: 635 DVKTFQVGVLLDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 97/226 (42%), Gaps = 35/226 (15%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-FRRSKVLLNEFKYYNADVICLQEVDHIQFQ 168
           F +++YN L Q     K++  +   AL W +RRSK L  +   Y++DV+CLQEV+   F+
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTFE 595

Query: 169 SFWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK--- 215
            +W    +K GY G ++          ++  K  G  I ++R  F+ V K  +D+     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 216 -----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFG 269
                + +   L R    +NV L L L+                      TTHL W P  
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQ-----------HVSSGDTIWVVTTHLHWDPKF 704

Query: 270 TYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
              +T Q  V+L  ++  +       +++  D+       CGDFNS
Sbjct: 705 NDVKTFQVGVLLDHLESLLKEDTT--HNSRQDIKKSPVLICGDFNS 748

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 93/225 (41%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R   L  +   Y++D++CLQEV+   F+ 
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEE 564

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           +W    +K GY G +H          ++  K  G  I ++R  F+ + K  +D+      
Sbjct: 565 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMK 624

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L L L+                      TTHL W P   
Sbjct: 625 HKKFQRTEDYLNRAMNKDNVALFLKLQ-----------HIPSGDTIWAVTTHLHWDPKFN 673

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  ++  +       ++   D+  +    CGDFNS
Sbjct: 674 DVKTFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 97/253 (38%), Gaps = 50/253 (19%)

Query: 101 GEGEPVTGFR-----------------FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRS 142
            EGEPV  +R                 F +++YN L Q     K++  +   AL W  R 
Sbjct: 437 AEGEPVEKYRSLHEADEHLSSELSKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRR 496

Query: 143 KVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYH----------RNPTKNH 192
           + L  +   Y  DVICLQEV+   F+ +W     K GY G +H          ++  K  
Sbjct: 497 EKLTEQILSYMTDVICLQEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVD 556

Query: 193 GVAIIWRRSMFQKVDKMLIDYDK--------EASGSILTRTTT-NNVGLVLALKFSKEVX 243
           G  + +R + F+   K  +D+          + +   L R    +NV + L L+  K   
Sbjct: 557 GCCVFYRENEFKLAYKDAVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQHIKS-- 614

Query: 244 XXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLS 303
                           TTHL W P     +T Q  V++  ++  +   +  Q+  +    
Sbjct: 615 ---------GESVWIVTTHLHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKC 665

Query: 304 HWFPFFCGDFNSQ 316
                 CGD NS+
Sbjct: 666 PV--ILCGDLNSE 676

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 90/225 (40%), Gaps = 36/225 (16%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R + L  +   Y +D++CLQEV+   F+ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K  Y G +H          +   K  G  I +++S F+ + K  +D+      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L + L+                      TTHL W P   
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKLQ-----------SITSGETVWVVTTHLHWDPKFN 737

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  ++L  M+  +   N  Q+    ++       CGD NS
Sbjct: 738 DVKTFQVGILLDHMETLLKEENPKQDVKKANV-----VICGDLNS 777

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R   L  +   Y++D++CLQEV+   F+ 
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFED 566

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           +W    +K GY G +H          ++  K  G  I +++  F+ + K  +D+      
Sbjct: 567 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMK 626

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L L L+                      TTHL W P   
Sbjct: 627 HKKFQRTEDYLNRAMNKDNVALFLKLQ-----------HIPSGDTIWAVTTHLHWDPKFN 675

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  ++  +       ++   D+       CGDFNS
Sbjct: 676 DVKTFQVGVLLDHLETLLREETT--HNFRQDIKKSPVLICGDFNS 718

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R + L ++   + +DVICLQEV+   ++ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G ++          ++  K  G  I ++ S F  + K  +D+      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L + L+  K                   TTHL W P   
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHIKS-----------GESVWVVTTHLHWDPQFN 620

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  ++L  ++E +   N     +  ++       CGD NS
Sbjct: 621 DVKTFQVGILLDHLEELLKDNN--NASSKQEIRKCPVIICGDLNS 663

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 89/226 (39%), Gaps = 33/226 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +M+YN L Q     K++  +   AL W  R + L  E   Y  D++CLQEV+   ++ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
            W     K GY G +H          ++  K  G  + ++ S F+   K  +D+      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV + + L   K                   TTHL W P   
Sbjct: 644 HKKFQRTEDYLNRAMNKDNVVIYIKLNHLKS-----------GESVWIATTHLHWDPQFN 692

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316
             +T Q  +++  ++E +       +  D   S      CGDFNSQ
Sbjct: 693 DVKTFQVGILMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQ 736

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +   AL W  R   L ++   + +D++CLQEV+   +  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW+    K GY G +H          ++  K  G  I ++ S F+ + K  +D+      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV + + L+  K                   TTHL W P   
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHIKS-----------GEVTWIVTTHLHWDPQFN 732

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  ++  +   + + +    D+       CGD NS
Sbjct: 733 DVKTFQVGVLLDHLESLLKEHSNIHSKQ--DVKKCPIIICGDLNS 775

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 106/260 (40%), Gaps = 46/260 (17%)

Query: 93  IQRPLLSLGEGEPVTGFR----FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLN 147
           I R LL +  G    G R    F L+TYN L+   +  +++    +  K W  R K+L  
Sbjct: 20  INRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEY 79

Query: 148 E-FKYYNADVICLQEVDHIQFQSFWKGKFN-KMGYDGQYHRNPTKNH---------GVAI 196
           E F  Y+AD++CLQE+    ++ FW+ +   +M ++ QY + P   +         GV  
Sbjct: 80  ELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGT 139

Query: 197 IWRRSMFQKVDKMLIDYDKEASGSILTRT-----------TTNNVGLVLALKFSKEVXXX 245
            +    F+ V   L +Y  +  G +LT T            T+  G V+  +  K V   
Sbjct: 140 FYNADKFEHVATDL-EYLSDTLG-VLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQ 197

Query: 246 XXXXXXXXXXXXXXT--------THLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQ 295
                         T        T L+W     Y+  +  QC++++R++K  + R   L 
Sbjct: 198 RNQVCLFVTLLHKPTGSLFVVVNTQLYWK----YDEVKLAQCFIIMRRLKAIVKR---LL 250

Query: 296 NDNDGDLSHWFPFFCGDFNS 315
              D   S+      GD NS
Sbjct: 251 TRKDTSYSNIKVLLSGDLNS 270

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 112/282 (39%), Gaps = 56/282 (19%)

Query: 85  DCPPELHFIQ-RPLLSL-GEGEPVTGF-----------------RFKLMTYNCLAQALIR 125
           D  PE+  I+ R  + +  EGEPV  +                  F L++YN L Q    
Sbjct: 481 DNRPEIPLIKDRKFIEIDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYAT 540

Query: 126 RKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQY 184
            K++  +   AL W  R + L ++   Y +D++CLQEV+   F+ FW     K  Y G +
Sbjct: 541 PKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIF 600

Query: 185 H----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK--------EASGSILTRTT 226
           H          ++  K  G  I +++S F+ + K  +D+          + +   L R  
Sbjct: 601 HIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHKKFQRTEDYLNRAM 660

Query: 227 T-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTRQCYVVLRKMK 285
             +NV L L L+                      TTHL W P     +T Q  ++L  M+
Sbjct: 661 NKDNVALYLKLQ-----------SLTSGESVWVVTTHLHWDPKFNDVKTFQVGILLDHME 709

Query: 286 EFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTS 327
             +   N  Q+    ++       CGD NS  FD+    + S
Sbjct: 710 ALLKEENPKQDVKKANV-----VICGDLNSY-FDSAVYELLS 745

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 88/225 (39%), Gaps = 33/225 (14%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGD-ALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQS 169
           F +++YN L Q     K++  +    L W  R + L N+     +DVICLQEV+   ++ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 170 FWKGKFNKMGYDGQYH----------RNPTKNHGVAIIWRRSMFQKVDKMLIDYDK---- 215
           FW     K GY G +H          ++  K  G  I ++ S F+   +  +D+      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 216 ----EASGSILTRTTT-NNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGT 270
               + +   L R    +NV L + L+                      TTHL W P   
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKLE-----------HINSGESVWVVTTHLHWDPQFN 708

Query: 271 YERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
             +T Q  V+L  ++  +   N     +  ++       CGD NS
Sbjct: 709 DVKTFQVGVLLDHLESLLKDYN--NASSKQEIRKCPVIICGDLNS 751

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 99/238 (41%), Gaps = 39/238 (16%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVDHIQF 167
           RF L+TYN L+ A +  +++    +  K W  R  +L  E    Y AD++C+QE+    +
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 168 QSFW----KGKFNKMGYD-------GQYHRNPTKNHGVAIIWRRSMFQKVDKMLI----- 211
           Q FW     GK + MG +         + R P +  GVAI + R MF  V    I     
Sbjct: 98  QQFWSPIASGKCD-MGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQM 156

Query: 212 -----DYDKEASGSI---LTRTTTNNVG---LVLALKFSKEVXX-XXXXXXXXXXXXXXX 259
                D++ E  G     LT    N  G   L+  LK   +V                  
Sbjct: 157 LDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVVI 216

Query: 260 TTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
            THL+W     Y+  +  QC V++R++ + +   ++L++  D         F GD NS
Sbjct: 217 NTHLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 94/245 (38%), Gaps = 44/245 (17%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FKYYNADVICLQEVDHIQFQ 168
           F  MTYN L+   +  +++    +  K W  R ++L  E    Y AD++C+QE+    + 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 169 SFWKGKF-NKMGYDGQY---------HRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEAS 218
            FWKG F +KM Y   +          R P +  GV I +    F+ +    I Y  +  
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSI-YLNDLI 152

Query: 219 GSI----------LTRTTTNNVG-------LVLALKFSKEVXX-XXXXXXXXXXXXXXXT 260
           G               T TN  G       L+  L    +V                   
Sbjct: 153 GLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVIN 212

Query: 261 THLFWHPFGTYERTR--QCYVVLRKMKEFMHRV--NVLQNDNDGDLSHWFPFFCGDFNSQ 316
           THL+W     Y+  +  QC  ++RK    +HRV  ++L        S     F GD NS 
Sbjct: 213 THLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGREGVTYSKVKILFAGDLNSA 264

Query: 317 PFDTP 321
           P D+P
Sbjct: 265 P-DSP 268

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 98/236 (41%), Gaps = 40/236 (16%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FKYYNADVICLQEVDHIQFQ 168
           F L+TYN L+Q+ +  +++       K W  R K+L  E  K YNAD+ICLQE+    ++
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 169 SFWKGKFNKMGYDGQY-HRNPTKN--------HGVAIIWRRSMFQKVDK--------MLI 211
            +W+ K +K      +  + P K          GV I +   MF+ +D         ++ 
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 212 DYDKEASGSILTR--TTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXT--------T 261
           D+++     + +R    T+  G  + +    +V                 T        T
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTT 201

Query: 262 HLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
           HL+W     Y+  +  QC +++R++ + M      Q   DG  S     F GD NS
Sbjct: 202 HLYWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 98/237 (41%), Gaps = 37/237 (15%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEFKY-YNADVICLQEVDHIQF 167
           RF ++TYN L+   +  +++    D  K W  R ++L +E  Y Y +D+ICLQE+    +
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 168 QSFWKGK-FNKMGYDGQY-HRNPTKN--------HGVAIIWRRSMFQ-------KVDKML 210
             FWK +  N+M Y   +  + P K          GV I +    F+        ++ ++
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 211 IDYDKEASGSILTR--TTTNNVGLVL--------ALKFSKEVXXXXXXXXXXXXXXXXXT 260
             +D++    +     T TN  G V+        A   ++                    
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVIN 212

Query: 261 THLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
           THL+W     Y+  +  QC +++RK++  +    +L        S+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 95/245 (38%), Gaps = 44/245 (17%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FKYYNADVICLQEVDHIQFQ 168
           F LMTYN L+   +  +++    +  K W  R ++L  E    Y AD++C+QE+    ++
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 169 SFWKGKF-NKMGYDGQY-HRNPTKN--------HGVAIIWRRSMFQKVDKMLIDYDKEAS 218
            FWK  F  KM Y   Y  + P K          GV I +  + F+ +    I Y  +  
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSI-YLNDLI 148

Query: 219 GSI----------LTRTTTNNVG-------LVLALKFSKEVXX-XXXXXXXXXXXXXXXT 260
           G               T TN  G       L+  L    +V                   
Sbjct: 149 GLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVN 208

Query: 261 THLFWHPFGTYERTR--QCYVVLRKMKEFMHRV--NVLQNDNDGDLSHWFPFFCGDFNSQ 316
           THL+W     Y+  +  QC  ++RK    +HRV  ++L        S     F GD NS 
Sbjct: 209 THLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGMEGVTYSKVKILFAGDLNSA 260

Query: 317 PFDTP 321
           P D+P
Sbjct: 261 P-DSP 264

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 95/237 (40%), Gaps = 39/237 (16%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVDHIQFQ 168
           F L++YN L+ + +  +++    +  K W  R K+L  E    Y AD++CLQE+    + 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 169 SFWKGKF-NKMGYDG--------QYHRNPTKNH-GVAIIWRRSMFQKVDKMLIDYDK--- 215
           +FWK      M Y          QY + P +   GV I +    F+ + +  I  ++   
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 216 ----------EASGSILTRTTTNNVG---LVLALKFSKEVXX-XXXXXXXXXXXXXXXTT 261
                     E     LT    N VG   L+  LK   +V                   T
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINT 201

Query: 262 HLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNV-LQNDNDGDLSHWFPFFCGDFNS 315
           HL+W     Y+  +  QC +++R++   + +  V L+N  D  +      F GD NS
Sbjct: 202 HLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 98/242 (40%), Gaps = 40/242 (16%)

Query: 106 VTGFRFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVD 163
           + G +F L+TYN L+   +  +++    D  K W  R  +L +E  + Y ADV+CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 164 HIQFQSFWKGKFNK-MGYDGQY-HRNPTKN--------HGVAIIWRRSMFQKV------- 206
              + S+WK  F K + Y  ++  + P K          G  I +    F+ +       
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 207 -------DKMLIDYDKEASGSILTRTTTNNVG---LVLALKFSKEV-XXXXXXXXXXXXX 255
                  ++  ++Y K      LT    N VG   L   LK   +V              
Sbjct: 152 NDVVNTFEEHELNYMKRKIVK-LTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNV 210

Query: 256 XXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDF 313
                THL+W     Y+  +  QC +++RK+ +    +N L    D  LS    F  GD 
Sbjct: 211 FVVINTHLYW----KYDEVKLTQCMIIMRKLSQI---INELLIGADPSLSKDVIFITGDL 263

Query: 314 NS 315
           NS
Sbjct: 264 NS 265

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 97/244 (39%), Gaps = 39/244 (15%)

Query: 104 EPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FKYYNADVICLQE 161
           +P    +F L+TYN L+   +  +++    +  K W  R ++L +E FK Y AD++CLQE
Sbjct: 23  KPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQE 82

Query: 162 VDHIQFQSFWKGKFNKMGYDG---------QYHRNPT-KNHGVAIIWRRSMFQKVDKMLI 211
           +    + +FW  +  +    G         +Y + PT +  GV I +    F+ +    I
Sbjct: 83  LTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI 142

Query: 212 DYDKEASGSILTR----------TTTNNVG-------LVLALKFSKEV-XXXXXXXXXXX 253
            Y  +  G    R          T TN  G       L+  L+   +V            
Sbjct: 143 -YLNDVLGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTN 201

Query: 254 XXXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCG 311
                  THL+W     Y+  +  QC  ++RK++  +   ++L        S     F G
Sbjct: 202 TVFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFSG 255

Query: 312 DFNS 315
           D NS
Sbjct: 256 DLNS 259

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 99/242 (40%), Gaps = 41/242 (16%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVDHIQF 167
           +F ++TYN L+   +  +++    D  K W  R K+L  E  + Y AD++CLQE+    +
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 168 QSFWKGKFN-KMGYDGQY---------HRNPTKNHGVAIIWRRSMFQKV----------- 206
            S+WK K N KM Y  ++          +   +  G  I + +  F+ +           
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 207 ---DKMLIDYDKEASGSILTR----TTTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXX 259
              ++  I+Y K+   ++       T TNN+   +A   ++                   
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKPTGTNNL-FTVATTRNQVCLFVSLRHKATNTVFVVI 225

Query: 260 TTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQN----DNDGDLSHWFPFFCGDF 313
            THL+W     Y+  +  QC +++RK+   ++ + +  N    DN          F GD 
Sbjct: 226 NTHLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDL 281

Query: 314 NS 315
           NS
Sbjct: 282 NS 283

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 99/253 (39%), Gaps = 38/253 (15%)

Query: 93  IQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FK 150
           IQ+P  +L   +  T   F  ++YN L+   +  +++       K W  R  +L  E   
Sbjct: 29  IQQPHQTLPAAKNPT---FTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILD 85

Query: 151 YYNADVICLQEVDHIQFQSFWKGKFNK-MGYDGQY-HRNP----TKN----HGVAIIWRR 200
            Y +D++C+QE+  I + SFW+    K   Y  ++  +NP    TK+     GV I +  
Sbjct: 86  KYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNL 145

Query: 201 SMFQKV--------------DKMLIDYDKEASGSILT---RTTTNNVGLVLALKFSKEVX 243
            MF  +              D+  +DY      +IL      T       LAL  ++   
Sbjct: 146 DMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCL 205

Query: 244 XXXXXXXXXXXXXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGD 301
                            THL+W     YE  +  QC +++RK+ + ++ +       D +
Sbjct: 206 FVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMN 261

Query: 302 LSHWFPFFCGDFN 314
            +     F GD N
Sbjct: 262 YNKVKILFSGDLN 274

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE-FKYYNADVICLQEVDHIQF 167
           +  ++TYN L+   +  +++    D  K W  R K+L  E    Y AD++CLQE+  + +
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 168 QSFW-KGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYD 214
           Q +W K    K  Y  +Y   P   +     W RS+  ++D + + YD
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKY-----WERSL-SEMDGVGVFYD 122

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 97/219 (44%), Gaps = 47/219 (21%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVL----LNEFKYYNADVICLQEVDH 164
           RF L+TYN L+ + +  +++    +  K W  R K+L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQEMTA 82

Query: 165 IQFQSFWKGKFNKMGYD------------GQYHRNPTKNH-GVAIIWRRSMFQKV----- 206
             ++ +W+   + +G D             +Y +NP K+  GV+I +    F  +     
Sbjct: 83  RDYEDYWR---DYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGI 139

Query: 207 --DKMLIDYDKEASGSI------LTRTTTNNVG---LVLALKFSKEV-XXXXXXXXXXXX 254
             +++L  +++     +      LT   +N VG   L+  LK   +V             
Sbjct: 140 YLNQLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGT 199

Query: 255 XXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRV 291
                 THL+W     Y+  +  QC +++R++ + + ++
Sbjct: 200 VFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQL 234

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 104/268 (38%), Gaps = 65/268 (24%)

Query: 96  PLLSLGEGEPVTGFR------FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNE 148
           P+ S+    P +G +      F  MTYN L+   +  +++    D  K W  R K+L  E
Sbjct: 8   PIKSITNSLPKSGSKRLIDDKFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKE 67

Query: 149 -FKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDG---------QYHRNPTKN-HGVAII 197
               Y AD++CLQE+    +  +W+   ++  + G         QY +   K+  GV I 
Sbjct: 68  ILNSYRADIMCLQELTASDYHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIF 127

Query: 198 WRRSMFQKVDKMLI---------DYDK------------EASGS-------ILTRTTTNN 229
           +  + F  +    I         D D+            + +G+       +    + N 
Sbjct: 128 YNLNKFDYISSTSIHLNDLIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQ 187

Query: 230 VGLVLALKFSKEVXXXXXXXXXXXXXXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEF 287
           VGL +ALK                       THL+W     Y+  +  QC +++RK+ + 
Sbjct: 188 VGLFVALKHKD-----------TNTIFVVINTHLYW----KYDEVKLTQCLIIMRKLAKI 232

Query: 288 MHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
           +   ++L  ++    +     F GD NS
Sbjct: 233 IR--DLLVGEHGTTYNKMKVVFAGDLNS 258

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 98/243 (40%), Gaps = 50/243 (20%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVL----LNEFKYYNADVICLQEVDH 164
           RF L+TYN L+ + +  +++    +  K W  R K+L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFK---ADIMCLQEMTR 82

Query: 165 IQFQSFWKGKFN-KMGYDG--------QYHRNPTKNH-GVAIIWRRSMFQKVDKMLID-- 212
             ++ +W       + Y          +Y + P ++  GV+I +    F  +    I   
Sbjct: 83  RDYEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLN 142

Query: 213 --------------YDKEASGSILTRTTTNNVG---LVLALKFSKEV-XXXXXXXXXXXX 254
                         Y+K     ILT   +N VG   L+  LK   +V             
Sbjct: 143 QLLNVFNERELKYLYNKRV---ILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDT 199

Query: 255 XXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGD 312
                 THL+W     Y+  +  QC +++R++ + + +  +L  D  G        F GD
Sbjct: 200 IFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIEQ--LLPGDAKGR-GKVKILFTGD 252

Query: 313 FNS 315
            NS
Sbjct: 253 LNS 255

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 102/246 (41%), Gaps = 56/246 (22%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVL----LNEFKYYNADVICLQEVDH 164
           RF L+TYN L+ + +  +++    +  K W  R ++L    LN FK   AD++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFK---ADIMCLQEMTA 82

Query: 165 IQFQSFWKGKFNKMGYD------------GQYHRNPTKNH-GVAIIWRRSMFQKVDKMLI 211
             ++ +W    + +G D             +Y + P K+  GV+I +  + F  +    I
Sbjct: 83  RDYEDYWH---DSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGI 139

Query: 212 D----------------YDKEASGSILTRTTTNNVG---LVLALKFSKEV-XXXXXXXXX 251
                            Y+K+ +   LT   +N +G   L+  LK   +V          
Sbjct: 140 YLNQLLNVFNQRELKYLYNKKVT---LTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKE 196

Query: 252 XXXXXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFF 309
                    THL+W     Y+  +  QC +++R++ + + +  +L  D  G        F
Sbjct: 197 TGTIFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQ--LLPGDVKGQ-ERVKILF 249

Query: 310 CGDFNS 315
            GD NS
Sbjct: 250 TGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 99/243 (40%), Gaps = 50/243 (20%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVDHIQF 167
           RF L+TYN L+ + +  +++    +  K W  R K+L  E    + AD++CLQE+    +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDY 85

Query: 168 QSFWKGKFNKMGYD------------GQYHRNPTKNH-GVAIIWRRSMFQKVDKMLID-- 212
           +++W    N +G D             +Y   P K+  GV+I +    F  +    I   
Sbjct: 86  ENYWH---NSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLN 142

Query: 213 --------------YDKEASGSILTRTTTNNVG---LVLALKFSKEV-XXXXXXXXXXXX 254
                         Y+K+ +   LT   +N +G   L+  LK   +V             
Sbjct: 143 QLLNVFNERELKYLYNKKVT---LTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNT 199

Query: 255 XXXXXTTHLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGD 312
                 THL+W     Y+  +  QC +++R++ + + +  +L  D +         F GD
Sbjct: 200 IFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQ--LLPGDANAQ-EKVKILFTGD 252

Query: 313 FNS 315
            NS
Sbjct: 253 LNS 255

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEF-KYYNADVICLQEVDHIQF 167
           +F L+TYN L+ + +  +++    D  K W  R K+L +E    Y AD++CLQE+    +
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 168 QSFWKGKFNK-MGYDGQY 184
              WK      +GY  ++
Sbjct: 89  NENWKRLLGSGIGYGSKF 106

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 111 FKLMTYNCLAQALIRRKLFPDSGDALK-WFRRSKVLLNEFKY-YNADVICLQEVDHIQFQ 168
             ++TYN L+   +  +++    D  K W  R K+L  E  Y + AD++CLQE+    + 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 169 SFWKGKFN-KMGYDGQYHRNPTKNHGVA 195
            FW+ +   ++ Y   +   P   +  A
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTA 117

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 97/237 (40%), Gaps = 40/237 (16%)

Query: 110 RFKLMTYNCLAQALIRRKLFPDSGDALK-W-FRRSKVLLNEFKYYNADVICLQEVDHIQF 167
           +F +++YN L+ + +  +++    D  K W +R + + L     Y AD++C+QE+    +
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 168 QSFWKGKF-NKMGYDGQY---------HRNPTKNHGVAIIWRRSMFQKV-------DKML 210
             +W+ K    +GY  ++          R+     GVAI +    F  +       ++ L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 211 IDYDKEASGSILTRT--TTNNVGLVLALKFSKEVXXXXXXXXXXXXXXXXXT-------- 260
             ++ E    +  +T   T+  G+ +  K   E+                 T        
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN 208

Query: 261 THLFWHPFGTYERTR--QCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNS 315
           THL+W     Y+  +  QC +++R++ + +    +LQ+     +      F GD NS
Sbjct: 209 THLYW----KYDEVKLSQCIIIMRELSKIIDE--LLQDVRHSKVK---IIFAGDLNS 256

>NDAI0K00220 Chr11 complement(34357..38238) [3882 bp, 1293 aa] {ON}
           Anc_8.865 YML091C
          Length = 1293

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 424 LDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNE 473
           L NDR    ++   N W  L D+L +IK  D  +N + ++N   F++  E
Sbjct: 930 LVNDRSLKRLTTTTNIWETLPDFLNFIKSIDFPNNFKNIQNQITFKETIE 979

>Suva_4.537 Chr4 complement(929310..931721) [2412 bp, 803 aa] {ON}
           YBR276C (REAL)
          Length = 803

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 398 LHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYL-FYIKKWDLQ 456
           L  SL++  I L    + S+H +  G + + GE    ++ N+ + LL+ L F +++ DLQ
Sbjct: 65  LRGSLEVNDIFLPWKVHTSLHVQGGGSERE-GEVNGFHYPNSDKELLNLLKFQVRQLDLQ 123

Query: 457 SNRQEVENLSDFEKKNEIKCRGFLRMPP 484
            +  ++EN++ F  K+ I    FL++ P
Sbjct: 124 VDDIDLENVTAFCHKHSI--LPFLKVDP 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,612,128
Number of extensions: 2246984
Number of successful extensions: 4911
Number of sequences better than 10.0: 72
Number of HSP's gapped: 4861
Number of HSP's successfully gapped: 72
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)