Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4548.847ON58058029570.0
Smik_13.4958.847ON57658022250.0
YMR282C (AEP2)8.847ON58058021970.0
Suva_13.4718.847ON58158321420.0
SAKL0D01298g8.847ON5514195241e-58
ZYRO0G14322g8.847ON5504505213e-58
TDEL0B005108.847ON5504214979e-55
Kpol_1068.38.847ON5664654847e-53
Kwal_27.102248.847ON5464594723e-51
KLTH0C03718g8.847ON5514234706e-51
TPHA0I002908.847ON5694634136e-43
NCAS0C003708.847ON4954523224e-31
NDAI0K003408.847ON6244493184e-30
KNAG0J002308.847ON4744113135e-30
Ecym_46188.847ON5273563031e-28
CAGL0M03069g8.847ON5484132971e-27
KAFR0B039708.847ON4744472932e-27
KLLA0D01408g8.847ON5184102836e-26
TBLA0B033108.847ON6134022775e-25
ABL119C8.847ON5373541279e-07
TPHA0L003304.354ON71775770.89
KNAG0A033808.601ON404136705.4
KLTH0B10318gsingletonON154840707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.454
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...  1143   0.0  
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   861   0.0  
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   850   0.0  
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   829   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   206   1e-58
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   205   3e-58
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   196   9e-55
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   191   7e-53
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   186   3e-51
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   185   6e-51
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   163   6e-43
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   128   4e-31
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   127   4e-30
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   125   5e-30
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   121   1e-28
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   119   1e-27
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   117   2e-27
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   113   6e-26
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   111   5e-25
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    54   9e-07
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    34   0.89 
KNAG0A03380 Chr1 complement(427889..429103) [1215 bp, 404 aa] {O...    32   5.4  
KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no si...    32   7.7  

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/580 (97%), Positives = 568/580 (97%)

Query: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60
           MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN
Sbjct: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60

Query: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120
           IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV
Sbjct: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120

Query: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180
           NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK
Sbjct: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180

Query: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240
           VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA
Sbjct: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240

Query: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL
Sbjct: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360
           LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR
Sbjct: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360

Query: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420
           GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP
Sbjct: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420

Query: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480
           VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG
Sbjct: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480

Query: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540
           IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR
Sbjct: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540

Query: 541 IFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           IFSRS            RDGLAPGNYDDDEDDGMIIGSLW
Sbjct: 541 IFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/580 (71%), Positives = 475/580 (81%), Gaps = 4/580 (0%)

Query: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60
           MWMNKL K    ++ GLY KR C ES  S+++ D+LPN  IFH T SR+T VT    + +
Sbjct: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVT----IND 56

Query: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120
              +K +STH +         N  R YDKFE+KGIPID +TLRRII+SSG+ E +FSK +
Sbjct: 57  TSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGI 116

Query: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180
           +YLF K V+SG R  L L +LS LLNKLYS RF+IR IC++I VKYSEFWFK+FSLYAEK
Sbjct: 117 SYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAEK 176

Query: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240
           VD +R+ +NLRNT LD+CEIFD+NLLI+NFIELGQL KAQKIL+FI+DRNPDILLSP NA
Sbjct: 177 VDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNA 236

Query: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DIGT+VHFL+LRCGAL AYWKIPDNSG+ Q QLR++VRLGAKNTSIRLSSTYK MDHQTL
Sbjct: 237 DIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTL 296

Query: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360
           LKIADLVL +KRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIW I++QEFPSHVAIKPR
Sbjct: 297 LKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR 356

Query: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420
           GCYPSSKILISILVSFH ND DLHRGLSILDSFIKHYPEVKLDALFWRRL QLS+FAWTP
Sbjct: 357 GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTP 416

Query: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480
             DK+A S+++CWHLMK W+ SK LS SVDYETLRQLY++MKKTGNF LGIDVLKSFKSG
Sbjct: 417 AKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSG 476

Query: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540
           IE++R  N +KL  +LIKYQK IIKQLV+RG+ISA R+FI DFGF+R   K+LNIFC+NR
Sbjct: 477 IERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNR 536

Query: 541 IFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           +  RS            R+ L P  +DDDEDDGMIIGSLW
Sbjct: 537 LLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/580 (71%), Positives = 480/580 (82%)

Query: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRN 60
           MW+N+LVK+   +V   Y KRLC  S+ S+++F +LPNSTI HS   R+TYV  R ++ +
Sbjct: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIND 60

Query: 61  IVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKSV 120
           I+I+K YSTH +   ++S   N   AYDKFE KGIPID HTL+RII+SSG +E EFSKS+
Sbjct: 61  ILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKSI 120

Query: 121 NYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEK 180
           +YLF K V+   +++L L DLS LL+KLY+QRF+IR IC++IN KYSEFWFKLFSLYAEK
Sbjct: 121 SYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAEK 180

Query: 181 VDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNA 240
           VD +R+QVNLRNT LD+CEIFD NL+IKNFIELGQL KAQKILSFILDRNPDILLSP+NA
Sbjct: 181 VDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNA 240

Query: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTL 300
           DI TIVHFLQLRCGAL  YWKIPDNS +KQ  LR+MVRLGAKNTSIRLSSTYKAMDHQTL
Sbjct: 241 DISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTL 300

Query: 301 LKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR 360
           LKIADL LQ+K+ LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSHV IK R
Sbjct: 301 LKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR 360

Query: 361 GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTP 420
           GCYPSSKIL+SILVSF+ ND DLHRGLSILDSFIKHYP+VKLDALFWRRL QLSHFAWTP
Sbjct: 361 GCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTP 420

Query: 421 VNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSG 480
            NDK+A S+V+CWHLMK WY SK L PSVDYETLRQLY++MKKTGNF LGIDVL+SFK G
Sbjct: 421 ANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPG 480

Query: 481 IEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNR 540
           IE+ R  N  K+  I+IKYQKCIIK+LVNRG+ SA R+FI  +GF+R+  KDLNIFC+NR
Sbjct: 481 IERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANR 540

Query: 541 IFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           +F RS            R+ +   ++DDDEDDGMIIGSLW
Sbjct: 541 MFLRSKKMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/583 (71%), Positives = 477/583 (81%), Gaps = 5/583 (0%)

Query: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVR- 59
           MWMNKL KY   ++ GLY +RLC+ES  S+++ DILPN  I ++  SR+T VT+RTL+  
Sbjct: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60

Query: 60  NIVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKS 119
           +I  QKFYSTHKL   +Q T  NA R +D F++K IPID  TLRRII+SS  NE +FSKS
Sbjct: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120

Query: 120 VNYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAE 179
           + YLF+K +NS  RE L L DLS LLN LYSQRFEI+ ICK+INV+YSEFWFKLFSLYAE
Sbjct: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180

Query: 180 KVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRN 239
           KVD +R+Q+NLRNTALDS EIFD+NL+IKNFIELGQL KAQK+LSFILDRN DILLSP+N
Sbjct: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240

Query: 240 ADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQT 299
           ADIGTI+HFLQLRCGAL AYWK+PDNS +K +  R+MVRLGAKNTSIR++S+YKAMDHQT
Sbjct: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQKYS--RKMVRLGAKNTSIRITSSYKAMDHQT 298

Query: 300 LLKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKP 359
           LLKIADLVLQ +R LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSH  IKP
Sbjct: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358

Query: 360 --RGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFA 417
             RGC PSSKILISILVSFHLND DLHRGLSILDSFIKHYPEVK+D LFWRRL QLSHFA
Sbjct: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418

Query: 418 WTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSF 477
           WTP +DKRA SIV+CWHLMK W+ESK  S SVDYETLRQLY++ KKTGN+SLGIDVL++F
Sbjct: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478

Query: 478 KSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFC 537
           K GI +      EK+  I+IK+QK IIKQLVNRGK SAAR+FI DF F+  A K+LN+FC
Sbjct: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538

Query: 538 SNRIFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           +NRI  RS            R+    GN+DDD+DDGM+IGSLW
Sbjct: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  206 bits (524), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 222/419 (52%), Gaps = 31/419 (7%)

Query: 166 YSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSF 225
           ++E  FKL+ +Y       RD V + N  L   +++DLN  IK F    QL+KAQ++L F
Sbjct: 160 HTEVLFKLYEIY-------RDSV-VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211

Query: 226 ILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTS 285
           +L+    I   PR  D  T++++L+L+CGA+   W IP      + +L +   LG+++  
Sbjct: 212 VLENYGSI---PR--DPQTLINYLELKCGAMPRNWSIP----LSRPELGKT--LGSQSFM 260

Query: 286 IRLSSTYKAMDHQTLLKIADLVLQDK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHI 343
             L+ +YK ++ + LL + D +++D+   +  + DL + +I S G++GQ  +LER I+H 
Sbjct: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320

Query: 344 WQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLD 403
           W +S     S     P+  YP+S +LISI VS +    +LH+ L I+DSF+  +P+++L+
Sbjct: 321 WGVSVSSNTSTEVEVPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379

Query: 404 ALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKK 463
            LFWRRL Q S   W    D +      CW +MK W+  ++ S  +D   L + Y V+K+
Sbjct: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439

Query: 464 TGNFSLGIDVLKSFKSGIEKMRT-ANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGD 522
           T NF+  + +     +G+   R   +PE    ++ K+QK I+K++  RG      K+I +
Sbjct: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEV--DVIKKFQKLILKKMAGRGYYHKPLKYISE 497

Query: 523 FGFNRRAAKDLNIFCSNRIFSRSXXXX-XXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           +  N+R   ++  +     F R              +   A   +D +E+D M++G LW
Sbjct: 498 WCLNKRNELEMREY-----FDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 145/450 (32%), Positives = 237/450 (52%), Gaps = 37/450 (8%)

Query: 139 GDLSLLLNKLYSQR-FEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDS 197
            + SL +NKL S+   +++L     +  ++E  +KL+  Y + +    DQ NL  T L  
Sbjct: 130 SEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHI---VDQHNL--TPL-- 182

Query: 198 CEIFDLNLLIKNFIELGQLSKAQKILSFILDRNP--DILLSPRNADIGTIVHFLQLRCGA 255
            +++DLNL +K FI   QLSKA  +L FIL R P  D+L    N D+  ++ FL+L+CGA
Sbjct: 183 -QLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLA---NTDVEILIQFLRLKCGA 238

Query: 256 LTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRFLN 315
           L+ +WKI   S R        + LG K +   L+ +YK  + + LL+I + VL +  + N
Sbjct: 239 LSKFWKIQPASQRNST----AITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKN 294

Query: 316 --SEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISIL 373
             S  L + +I S G+LGQT ++E+ +   W  S  E      +K     P+S +L+++L
Sbjct: 295 RRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDE-----GVKTN---PNSDLLVAVL 346

Query: 374 VSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCW 433
            S+ + + ++ +GL +LD FI+ YPEV+LD LFWRRLLQLS   W    D++A     CW
Sbjct: 347 TSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCW 406

Query: 434 HLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKS--FKSGIEKMRTANPEK 491
            +MK W+  ++     DY  +++LY +  +T N +  ++V+    F + I+   T  P +
Sbjct: 407 TIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNE 466

Query: 492 LEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRSXXXXXX 551
           L ++L KYQ+ I+K +  +G      +F  ++ F+       N F     F +       
Sbjct: 467 L-SLLCKYQRFILKMIALKGNYHKGFEFCQEWSFS-----STNKFELQSYFMKWRGIHEQ 520

Query: 552 XXXXXXRDGLA-PGNYDDDEDDGMIIGSLW 580
                 +   A    YD+ E+D M++G LW
Sbjct: 521 RRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  196 bits (497), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 130/421 (30%), Positives = 216/421 (51%), Gaps = 33/421 (7%)

Query: 166 YSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSF 225
           ++E  F L+ +Y   V      +      L   ++ D+N  IK FI+  QL KAQ+ L F
Sbjct: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210

Query: 226 ILDRNP--DILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKN 283
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +          LG  +
Sbjct: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV---------LGEDS 258

Query: 284 TSIRLSSTYKAMDHQTLLKIADLVLQDK--RFLNSEDLLSTLIQSFGHLGQTQILERCIE 341
              +   +Y  +  Q  L+I + +L+DK  R  +S  + S ++ S  +LGQT+++++ I+
Sbjct: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318

Query: 342 HIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVK 401
             W IS      HVA+K     P  ++LI+I+ ++ L + D  +GL ILD F+K YP+ +
Sbjct: 319 LKWGISED---GHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374

Query: 402 LDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVM 461
           L+ LFWRRLLQLS   W    DK+A     CW++MK W+E K +S + D  TLR LY++ 
Sbjct: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434

Query: 462 KKTGNFSLGIDVLKSFKSGIEKMRTANPEKLEA-ILIKYQKCIIKQLVNRGKISAARKFI 520
           K T N     +V+++  S +   +     K E  +L+ +QK  +K +  +G+ +   + I
Sbjct: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494

Query: 521 GDFGFNR-RAAKDLNIFCSNRIFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSL 579
            ++  ++      L+ F  +R                 +       YD+ E++ M++G L
Sbjct: 495 KEWNVDKINQHYLLDYFMRHR-----RKYDLTRDKARAKQQQQQAQYDNMEEEDMLLGRL 549

Query: 580 W 580
           W
Sbjct: 550 W 550

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  191 bits (484), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 136/465 (29%), Positives = 234/465 (50%), Gaps = 38/465 (8%)

Query: 136 LPLGDLSLLLNKLY-SQRFEI-RLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNT 193
           L   +LS+ +N++Y S   +I R+I    ++ Y+E  +++F LY   +      +     
Sbjct: 120 LTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII----- 174

Query: 194 ALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRC 253
            L++  + DLNL I  FI+  QLSKAQ +L +I+D    I    +  D  T+V+FL+LRC
Sbjct: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRC 231

Query: 254 GALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLL-KIADLVLQDK- 311
           G L  +W +P  S     Q ++  RL + + + R  S+YK+    T+L ++ +++L  K 
Sbjct: 232 GGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKV 291

Query: 312 -RFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPR--GCYPSSKI 368
            +  +S  L ST++ S  H  Q Q+++  I+  W ISS   P  + IK +     PS++I
Sbjct: 292 WKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEI 351

Query: 369 LISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAAS 428
           LI+I+ S+   D+++   + ILD FI+ YP++ LD +FWRRL+Q  +  W P  D++   
Sbjct: 352 LIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTF 411

Query: 429 IVKCWHLMKHWYES---KELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMR 485
              CW++MK+W  +   K++    D++   + Y + K+T N  +  +++ +        +
Sbjct: 412 GYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEK 471

Query: 486 TANPEKLEAILI-KYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSR 544
               +K E  L+ KYQ   +  L+ R +   A  FI ++  +R          +NRI  R
Sbjct: 472 NVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDR----------NNRIQLR 521

Query: 545 SXXXXXXXXXX---XXRDGLAPGN------YDDDEDDGMIIGSLW 580
                           RD  +         YD+ E++ MIIG LW
Sbjct: 522 EAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDEMEEEDMIIGRLW 566

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  186 bits (472), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 143/459 (31%), Positives = 226/459 (49%), Gaps = 48/459 (10%)

Query: 135 ILPLGDLSLLLNKLYSQR-FEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNT 193
           +L   + S LLN L ++R    +L     +V+ +E  F L+  Y          + +   
Sbjct: 123 LLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL---------MTIPAG 173

Query: 194 ALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRC 253
           +L+  ++ DLN  ++ FIE  QL KAQ +L  IL  N D L      D  T +H+LQLRC
Sbjct: 174 SLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLRC 229

Query: 254 GALTAYWKIPDNSGRKQNQLRRMVRLGA-KNTSIRLSSTYKAMDHQTLLKIADLVLQDKR 312
           GAL   WK+ D+      ++    RLG+ +N S  +S TYKA+D  ++L+  + VL D+ 
Sbjct: 230 GALPRNWKVFDS------RVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDE- 281

Query: 313 FLNSE-------DLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPS 365
             NSE        L + +I S G +GQ  +L+  I   W I+  E  + +A +     PS
Sbjct: 282 --NSEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT--ELGASLATEVNEVPPS 337

Query: 366 SKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKR 425
            ++LI+I  SF  + +++  GL ++D+FI  Y E+ LD +FWRRL Q ++  W    D R
Sbjct: 338 PEVLIAIFTSF-ASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPR 396

Query: 426 AASIVKCWHLMKHWYE--SKELSPSVDYETLRQLYEVMKKTGNFSLGIDVL-KSFKSGIE 482
                 CW +M  W+E  SK+L P  D   L + Y V+ +T N+   + V+ +SF    E
Sbjct: 397 GDLSRGCWRVMTEWHEKGSKKLQP--DTTLLNERYFVLAQTNNYKEALTVISQSFPQLYE 454

Query: 483 KMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIF 542
           K   ++ E   AI+ KY K ++K +   G       FI ++  N+     L ++     F
Sbjct: 455 KPTLSSKEM--AIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVY-----F 507

Query: 543 SRSXXXXXXXXXXXXRDGLAPGN-YDDDEDDGMIIGSLW 580
            +              +     N YDD+E+D M++G LW
Sbjct: 508 KKHRDGFTKRKERLREESRRKQNTYDDEEEDNMLLGRLW 546

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  185 bits (470), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 130/423 (30%), Positives = 201/423 (47%), Gaps = 33/423 (7%)

Query: 163 NVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKI 222
           NV  +E  F L+ LY + V             L   ++ D N  I+ FI   QL KAQ +
Sbjct: 157 NVSGTEMVFSLYQLYLKTVTP---------GPLSPLQLHDFNKFIRFFIRSAQLRKAQTV 207

Query: 223 LSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAK 282
           L  IL  N + L      D  T  H+LQLRCGAL   WK+ D +      L R  RLGA+
Sbjct: 208 LDCILKSNNNQL----PCDSATATHYLQLRCGALPRNWKVLDEN------LGRSTRLGAR 257

Query: 283 NTSIRL-SSTYKAMDHQTLLKIADLVLQDKRFL---NSEDLLSTLIQSFGHLGQTQILER 338
               +L S +YKA+DH+++L    L+   K       S  L S ++ S G +GQ ++LE 
Sbjct: 258 KNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEE 317

Query: 339 CIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYP 398
            +   W IS QE   +         PSS++L+++L S+  N K++   L ++D F+  YP
Sbjct: 318 HVWRNWGISLQEH--NQVTDASFTSPSSEVLVAVLTSYASN-KNISSALHLIDGFMAKYP 374

Query: 399 EVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLY 458
            ++LD +FWRRL Q S   W+   D R      CW +M+ W+ ++      D   L + +
Sbjct: 375 TLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERF 434

Query: 459 EVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLEAILI-KYQKCIIKQLVNRGKISAAR 517
            V+ +T N+   I+V++   S     + AN  + EA+L  K+ K I+K + + G      
Sbjct: 435 VVLSRTNNYRDAIEVVEQCYSSF--FQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPL 492

Query: 518 KFIGDFGFNRRAAKDLNIFCSNRIFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIG 577
           KFI ++  N+     L  +      + S                A   +DD+E+D M++G
Sbjct: 493 KFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQK----AQKRFDDEEEDSMLLG 548

Query: 578 SLW 580
            LW
Sbjct: 549 RLW 551

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  163 bits (413), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 127/463 (27%), Positives = 229/463 (49%), Gaps = 34/463 (7%)

Query: 136 LPLGDLSLLLNKLYSQRFEI--RLICKEI-NVKYSEFWFKLFSLYAEKVDTRRDQVNLRN 192
           L   + S+ LN+L  ++  I   ++ KE  N K+SE  FKLF LY   + +  D+++L  
Sbjct: 123 LTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIGS--DKLSL-- 178

Query: 193 TALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLR 252
                  + D+NL I+ FI  G L +A+ +L+F+L++   IL      D+ T+ H+LQLR
Sbjct: 179 -----LSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSIL---DLYDVDTVTHYLQLR 230

Query: 253 CGALTAYWKIPDNSG------RKQNQLRRM-VRLGAKNTSIRLSSTYKAMDHQTLLKIAD 305
           CGAL  YW   + S       +  N+L +   RLG KN +++L++ YK +D   +LKIA+
Sbjct: 231 CGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIAN 290

Query: 306 LVLQDKRFL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQ--ISSQEFPSHVA--IKP 359
            ++ D ++   +S  L +T++ S  + GQ   +   I   W   IS  +  S V   I  
Sbjct: 291 KIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISN 350

Query: 360 RGCYP-SSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAW 418
               P  S+++ +IL S+  +DK + R ++I+D  +  YP ++L+  FWRRL+Q S   W
Sbjct: 351 EASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCW 410

Query: 419 TPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFK 478
               D++ + +  C+  +K ++E + +  + D   L++LY ++  T N  +  +V+  F 
Sbjct: 411 DHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFM 470

Query: 479 SGIEKMRTANPEKLE-AILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFC 537
                 R+      E  +L  +QK  I  ++ +     A  FI  +  + +  ++L  + 
Sbjct: 471 PQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYY 530

Query: 538 SNRIFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
            + I  +             ++ L     D  ++D  ++G LW
Sbjct: 531 KDSIAKKLQKVRRNSLQQKIKEKLE----DHSDEDDTLLGRLW 569

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 129/452 (28%), Positives = 209/452 (46%), Gaps = 59/452 (13%)

Query: 134 EILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNT 193
           E   L + SL L K+ S +        ++NV      F+LF +YA        ++     
Sbjct: 98  EHFTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYA--------RMYCGEG 140

Query: 194 ALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRC 253
           +L++ +I+DLN LIK FI+  QL + Q +L FI+ +   I     + D+ ++ + L+L+ 
Sbjct: 141 SLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKN 200

Query: 254 GALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRF 313
           G+L   WK     G+    L+   R G  N        YK +D  +LLKIADLVL D   
Sbjct: 201 GSLVKDWKF---EGKNLRYLQS--RQGRLN--------YKFLDGWSLLKIADLVLNDP-- 245

Query: 314 LNSEDLLS-TLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRG--CYPSSKILI 370
           +  +++L+ ++I S GHL Q ++L+  I+ +W    QE       +PR    YP +  +I
Sbjct: 246 MKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWM---QE------TRPRNGLLYPDTNNII 296

Query: 371 SILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIV 430
           +I+ S+  N  ++ +   +LD  ++ Y  +K D  FWRRL Q      T  N  +   + 
Sbjct: 297 AIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILG 354

Query: 431 KCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPE 490
           +CW LM+     K+     D   L  L E + K  +  L + VLK     ++K+   N  
Sbjct: 355 QCWSLME-----KQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINEL 409

Query: 491 KLEAILIKYQKCIIKQLVNRGKISAARKFIG--DFGFNRRAAKDLNIFCSNRIFSRSXXX 548
            +E +L+KYQK +  +L    K   A + +   D+  N    K+   F     F      
Sbjct: 410 DME-LLLKYQKFVFSKLGEINKTVKAMELLSCDDYTIN----KENKAFMRAYYFENKREK 464

Query: 549 XXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
                     D L    YD+ +++ MIIG LW
Sbjct: 465 RKKNKRSNQYDDLQR-KYDEMDEEDMIIGKLW 495

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  127 bits (318), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 202/449 (44%), Gaps = 54/449 (12%)

Query: 168 EFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFIL 227
           E  F LF++  ++     +Q+N          ++DLN  IK F+  GQL KAQ +L +I+
Sbjct: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246

Query: 228 DRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIR 287
           DR   I    ++ D+ T+ + L+L+ GA+   WK P         L+  + L  K+ + +
Sbjct: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFK 305

Query: 288 LSSTYKAMDHQTLLKIADLVLQDKRF-LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI 346
               YK +D  +LLKI D+VL DK   LN   L  +++ S G L Q + +E  I+ IW +
Sbjct: 306 GFKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDV 363

Query: 347 SSQEFPSHVAIKPR-------GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPE 399
              +     A++ R          P +  LI+IL S+    K + R   +LD  I+ YPE
Sbjct: 364 HPDD-----AVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPE 418

Query: 400 VKL----DALFWRRLLQLS-HFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSV----- 449
                  D  FW ++LQ     A    N+    +I  C  +M+ W+   +   ++     
Sbjct: 419 PMKSRLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKI 478

Query: 450 --DYET--LRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEK-----LEAILIKYQ 500
             DY +  +  L+ +MK+  N  +G+  +++F   ++K++  +  K     L  +L   Q
Sbjct: 479 DDDYGSILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQ 535

Query: 501 KCIIKQLVNRGKISAARKFIGDFGFNRRAA-----KDLNIFCSNRIFSRSXXXXXXXXXX 555
           KCI +++   G  +     I +  + + +      ++  I     I S+           
Sbjct: 536 KCIFRKIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNI 595

Query: 556 XXRDGLA----PGNYDDDEDDGMIIGSLW 580
             R+          YD+ E++GMIIG LW
Sbjct: 596 QDREQDEFEKLQQKYDEIEEEGMIIGKLW 624

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 188/411 (45%), Gaps = 58/411 (14%)

Query: 141 LSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEI 200
            S+LLN++ + +    L  KE NV   E +F +F  Y       +  + L++  L   ++
Sbjct: 90  FSVLLNRVLASQNYRHLDSKE-NV---EKFFAIFMRY-------KGAIALQSNKLTQIQL 138

Query: 201 FDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYW 260
            D NL+   FI   QL KAQ I+ F+L ++          D+  I ++ +LRCG+     
Sbjct: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFMIKNYTKLRCGS----- 186

Query: 261 KIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRFL--NSED 318
                              G +  +   +  YK  D  T+ ++   V  D++F   N+E 
Sbjct: 187 -----------------SFGKQTLN---NKAYKVFDQNTVFQLIGKVEADRKFAFWNNE- 225

Query: 319 LLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPS-HVAI----KPRGCYPSSKILISIL 373
               ++ S G+     ++E  I  +W+IS  +  + ++ I    +    YPSSK+L +I+
Sbjct: 226 ----IVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIV 281

Query: 374 VSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCW 433
            S+  +D+ + R + I++ F K YP++ L+  FW  LL     A      K  +  + CW
Sbjct: 282 SSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC---AIKCGGSKDPSQFLACW 338

Query: 434 HLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLE 493
           +LMK W+  +          L  +   M++T N    +D+L+ +   +   R   PE   
Sbjct: 339 NLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFER 398

Query: 494 AILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSR 544
            +LIKYQK I+++LV++ K +    FI  +  +    +DL  F  +R+  R
Sbjct: 399 DVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVR 449

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 167/356 (46%), Gaps = 33/356 (9%)

Query: 191 RNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQ 250
           + T     E+ DLN     F+   +L  A+K+L  IL +     L PR  D  T+V + Q
Sbjct: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203

Query: 251 LRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQD 310
           L  G+L + W  P       ++L   VR   +   +  +S  + + +  L K+  L   D
Sbjct: 204 LYLGSLASLWPTPKVQSACYDKL---VRGSRRPKYVVYNSLPEGIMYDVLQKL--LENDD 258

Query: 311 KRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS------SQEFPSHVAIKPRGCYP 364
            + L S +L + ++ S  H  +  + E  +E  W I        +E P  ++    G YP
Sbjct: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDIS---SGTYP 315

Query: 365 SSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDK 424
            S++LI+I+ SF   + DL + + ++D+F+  YP++ L   FW +L     F WT V   
Sbjct: 316 GSEVLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKL-----FLWTRVMFD 369

Query: 425 RA----ASIVK-CWHLMKHWYESKELSPSVDYETLRQ--LYEVMKKTGNFSLGIDVLKSF 477
           R      S+ K CW  M  WY+S+    SV Y +      YE++K+T N+   + +   +
Sbjct: 370 RKLDPLGSLQKACWLRMLSWYKSR--GESVPYSSYLASCRYEILKQTSNYKDAMAMFPDY 427

Query: 478 KSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDL 533
            S +     A    L  ++ KYQK +I++L  RGK  A  +FI  + FN    K+L
Sbjct: 428 MSAVYAKSAAAKHNL-TVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKEL 482

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  119 bits (297), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 110/413 (26%), Positives = 180/413 (43%), Gaps = 51/413 (12%)

Query: 194 ALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILD----RNPDILLSPRNADIGTIVHFL 249
           ++D+    D+N  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL
Sbjct: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFL 218

Query: 250 QLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQ 309
            LR GAL   WKI  ++G  + Q    +    +N    + STY  +D   L +I   +L+
Sbjct: 219 MLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILR 274

Query: 310 -------DKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGC 362
                   +     E +L  +I   G++GQT ++E  I  IW++ S   P    I     
Sbjct: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT---- 330

Query: 363 YPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVN 422
             +S +L +I+ ++    K +  GL I D F    P + +   FW  L +     W  + 
Sbjct: 331 -VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNIIL 384

Query: 423 DKRAASIV----KCWHLMKHWYESKELSP--SVDYETLRQLYEVMK----KTGNFSLGID 472
             +  S +    + W LMK W  S       + + E L  +Y+V+     K  +     D
Sbjct: 385 PNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYD 444

Query: 473 VLKSFKSGIEKMRTANPEKLEAI--LIKYQKCIIKQLVNRGKISAARKFIGDFGF---NR 527
           +   F+  +  + + N   ++ I  L K+Q   IK++V  G  S   +FI ++ +   N+
Sbjct: 445 I---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANK 501

Query: 528 RAAKDLNIFCSNRIFSRSXXXXXXXXXXXXRDGLAPGNYDDDEDDGMIIGSLW 580
           +   +L +   NR   +             +       YD++E + M++G LW
Sbjct: 502 QQLTNLFVVLRNRYLQKRGYNQEKEMTKVQK------KYDEEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  117 bits (293), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/447 (23%), Positives = 179/447 (40%), Gaps = 60/447 (13%)

Query: 136 LPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTAL 195
           + L   + L+N   S+++ I    + I  +  E  F+LF  Y + + +  +        L
Sbjct: 86  IDLNRFARLINIALSEKYNI----QRIKERRPEIIFQLFETYVKLISSHEE--------L 133

Query: 196 DSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGA 255
              ++ D+N  I  F+E  QL KAQ ++ +++ ++P +L      D+ T  ++L+L CGA
Sbjct: 134 TILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVL---EKYDVSTTRNYLKLNCGA 190

Query: 256 LTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMD--HQTLLKIADLVLQDKRF 313
               W                             + YK  D  + TL K+    L +K  
Sbjct: 191 CHELW----------------------------YTNYKIFDFNNTTLDKLVKYSLDNK-- 220

Query: 314 LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISIL 373
           +   D+   +I S G+ G+ + LE  I   W IS         +      P S++L +I+
Sbjct: 221 IGYWDV--EIIHSLGYSGRIRSLEDYILKKWGIS---LCDRAQVNTTNEAPESEVLEAII 275

Query: 374 VSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCW 433
             F   DK + R + IL+ F+  YP++ L   FW+  +      W    D++   IV+ W
Sbjct: 276 NGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYW 335

Query: 434 HLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLE 493
             MK WY         +   L+ +    KK  N  L  D+ ++         T   +   
Sbjct: 336 ETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSEL 395

Query: 494 AILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRSXXXXXXXX 553
            ++ +YQ  I+ +L+ +   S A  FI D  F+    + L  +   R             
Sbjct: 396 NVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYHGR--------KEHKL 447

Query: 554 XXXXRDGLAPGNYDDDEDDGMIIGSLW 580
               R+      YDD  ++  IIG LW
Sbjct: 448 KKMTRNENLEKTYDDMVEEDFIIGKLW 474

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  113 bits (283), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 194/410 (47%), Gaps = 38/410 (9%)

Query: 126 KIVNSGNREILPLGDLSLLLNKL---YSQRFEIRLICKEINVKYSEFWFKLFSLYAEKVD 182
           +++   N ++ P  D S+ +N+L   YS+  +I L+ K      +E W  L+ +Y   V 
Sbjct: 88  RLLKYSNEKLTP-EDYSVFVNQLMDVYSK--DIELLNK------TEVWKSLYHIYRVFVV 138

Query: 183 TRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFIL--DRNPDILLSPRNA 240
              D  N       +  ++DLN  ++ FI L  L  A+ +   IL   +N +I   P+  
Sbjct: 139 NAVDDGN-------AMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI---PK-- 186

Query: 241 DIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSS--TYKAMDHQ 298
           D+ TI  +L+L CGAL+  W    +    Q+ +  +   G+  +SIR+ S   Y  +   
Sbjct: 187 DVQTICMYLRLYCGALSELWTTQTSRNFYQDLIGSLS--GSNASSIRIPSHIAYPTIGVP 244

Query: 299 TLLKIADLVLQDKRF--LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVA 356
               +   +++D  +  L + ++ S +IQ+ GH  +   L++ I   + I      +   
Sbjct: 245 QFQLLLRKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETH 304

Query: 357 IKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHF 416
              +   P S++L S++ ++  N+ ++  G++++ SF++ YPE+ LD  FWR  +  S  
Sbjct: 305 PGIKKLTPDSQLLKSVISAYGHNN-NITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLR 363

Query: 417 AWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEV--MKKTGNFSLGI-DV 473
            W    D + +   K W+LM +WY +  +  +V ++    LY +  +K   + +  I DV
Sbjct: 364 EWNKYKDSKGSQPKKAWNLMLNWYAT--IGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDV 421

Query: 474 LKSFKSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDF 523
            + FK    K           +L  YQ+ IIK LVN+ + +    FI ++
Sbjct: 422 QQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEW 471

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 107/402 (26%), Positives = 191/402 (47%), Gaps = 47/402 (11%)

Query: 166 YSEFWFKLFSLYAEKVD----TRRDQVNLRN------TALDSCEIFDLNLLIKNFIELGQ 215
           +SE  FK++ +Y E+++       +  ++++      T L+  +++DLN +I  FI+ GQ
Sbjct: 182 HSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQ 241

Query: 216 LSKAQKILSFILDR-NPDILLSPRNADIGTIVHFLQLRCGALTAYWKI-PDNSGRKQNQL 273
           L KA   L +IL R N +I   P   D  TI++FL+L CG L   W+I P N    +NQ 
Sbjct: 242 LKKATTALMYILKRYNAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQG 298

Query: 274 RRMVRLGAKNTSIRLSSTYKAMDHQTLLKIA--------DLVLQDK--RFLNSEDLLSTL 323
           +R  +LG  ++  RL S+YKA+  +  ++I         D+ L  K   F+ + +  STL
Sbjct: 299 KRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTL 358

Query: 324 IQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSF-HLNDKD 382
           I S   LG+  + E+  +  W   S +    V +       +S I+I+I  S+ + N  +
Sbjct: 359 IYSLTSLGRFDLAEQYFKDNWLSDSCD---DVEL-------TSDIVIAIFSSYVYNNSNN 408

Query: 383 LHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWY-- 440
           + +   ++   IK YP++ L+   W R+++ +   W    D         ++ M  +Y  
Sbjct: 409 IEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSN 468

Query: 441 ----ESKELSPSVDYET--LRQLYEVMKKTGNFSLGIDVLKS-FKSGIEKMRTANPEKLE 493
                S   S  + Y    L  LY +     + +  + ++ + FK  + K  +    K  
Sbjct: 469 YCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDY 528

Query: 494 AILIKYQKCIIKQLVNRGKISAARK--FIGDFGFNRRAAKDL 533
            IL+KYQK I+K L+N  K+++ +   FI  +  +    + L
Sbjct: 529 QILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQL 570

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/354 (20%), Positives = 140/354 (39%), Gaps = 30/354 (8%)

Query: 200 IFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAY 259
           + D N   + F+   +L  A+ + + ++    ++   PR  D  TI+  LQL  GA   +
Sbjct: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244

Query: 260 WKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRF--LNSE 317
           W+ P NS  +  QL     +        + + Y ++  +TLL++  L+  D ++  + S 
Sbjct: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETLLRLLRLLQSDPQWKSVCSP 297

Query: 318 DLLSTLIQSFGHLGQTQILE--RCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVS 375
           DL   +I +     +  ++       +         PS   + P G       L+  +V+
Sbjct: 298 DLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPS-TPLLPDGA------LVGAVVT 350

Query: 376 FHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWT----PVNDKRAASIVK 431
                  L +GL+I   F+  +  +  +   W+ +     F W     P   + AA   +
Sbjct: 351 AFAFKHQLAQGLAIAYQFLDRFTHLPNEHELWKII-----FTWLARRHPTGSQGAALYDE 405

Query: 432 CWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEK 491
            W  M+  Y         DY   R  Y ++++  +      +L  + S + +     P  
Sbjct: 406 AWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRD 465

Query: 492 LEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRIFSRS 545
              +L+K Q  I+ +LV   + SAA  F+  +  +  A   L    + R  SR+
Sbjct: 466 -RLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHIAARASSRT 518

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 11  FSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVRNIVI---QKFY 67
            +N++G Y   + DE+LG     D+LP + I  S+ S+     +  +  ++V+   +K Y
Sbjct: 477 LANIYGFYI--VIDETLGGFVNIDVLPFADIVCSSLSQSFGGDSNVMAGSMVLNPQEKLY 534

Query: 68  STHKLYLNNQSTYAN 82
              +L+LN    Y N
Sbjct: 535 QFAQLFLNQLGEYEN 549

>KNAG0A03380 Chr1 complement(427889..429103) [1215 bp, 404 aa] {ON}
           Anc_8.601 YPL112C
          Length = 404

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 414 SHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDV 473
           ++F++TP  D    +        K +Y+ ++ +    Y       E ++  G      D 
Sbjct: 22  AYFSFTPSRDTTVNAFPALTDEFKSFYQKEDTTKDHAYPGNN---ETVQAKGT----EDA 74

Query: 474 LKSFKSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGD---FGFNR--R 528
           LK      EK+R A+PE++    I   K I+  L  + K++   K++ D   FG  +  +
Sbjct: 75  LK------EKLRRAHPERVYVKRINILKVIVNSLNGKDKVAKILKYVFDLLNFGLTKLTQ 128

Query: 529 AAKDLNIFCSNRIFSR 544
           + K L+   +N+  SR
Sbjct: 129 SNKLLDRIFANKTLSR 144

>KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no
            similarity
          Length = 1548

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 212  ELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQL 251
            EL +  KA K+ SF+LD+N  +L+ P+ A  G  V  L++
Sbjct: 1051 ELDKTEKAMKMQSFLLDKNVQVLMGPKLAVEGIDVAELRM 1090

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,117,121
Number of extensions: 2624323
Number of successful extensions: 7886
Number of sequences better than 10.0: 48
Number of HSP's gapped: 8048
Number of HSP's successfully gapped: 49
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)