Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4538.846ON30030015010.0
Suva_13.4708.846ON30330312291e-171
YMR281W (GPI12)8.846ON30430212291e-171
Smik_13.4948.846ON30430212181e-169
TDEL0B005208.846ON2682925968e-76
KNAG0J002408.846ON2862965952e-75
ZYRO0G14300g8.846ON2802845901e-74
Kpol_1068.48.846ON2912975841e-73
KAFR0B039608.846ON2782985641e-70
SAKL0D01320g8.846ON2602855523e-69
NDAI0K003308.846ON3133125417e-67
NCAS0C003808.846ON2762955326e-66
TPHA0I002808.846ON3013045015e-61
CAGL0M03047g8.846ON3042964963e-60
KLTH0C03740g8.846ON2542794636e-56
Kwal_27.102278.846ON2542834506e-54
ABL120W8.846ON2492824427e-53
Ecym_46178.846ON2492824383e-52
KLLA0D01430g8.846ON2632424394e-52
TBLA0B033008.846ON3193274356e-51
KNAG0B020707.456ON19044664.8
CAGL0E01463g3.20ON20988657.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.453
         (300 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   582   0.0  
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   478   e-171
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   478   e-171
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   473   e-169
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   234   8e-76
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   233   2e-75
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   231   1e-74
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   229   1e-73
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   221   1e-70
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   217   3e-69
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   213   7e-67
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   209   6e-66
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   197   5e-61
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   195   3e-60
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   182   6e-56
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   177   6e-54
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   174   7e-53
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   173   3e-52
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   173   4e-52
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   172   6e-51
KNAG0B02070 Chr2 (394203..394775) [573 bp, 190 aa] {ON} Anc_7.45...    30   4.8  
CAGL0E01463g Chr5 complement(138109..138738) [630 bp, 209 aa] {O...    30   7.5  

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/300 (95%), Positives = 287/300 (95%)

Query: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60
           MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA
Sbjct: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60

Query: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120
           HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP
Sbjct: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120

Query: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180
           VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA
Sbjct: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180

Query: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXX 240
           VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIV      
Sbjct: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTI 240

Query: 241 XXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY 300
                  QRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY
Sbjct: 241 QPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY 300

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 225/303 (74%), Positives = 263/303 (86%), Gaps = 3/303 (0%)

Query: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60
           MS+RVKV FSKL++KITKLAIVLT+LYI+FTPKI+SRN + LQHVFPH++R+SQINLVIA
Sbjct: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60

Query: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120
           HPDDEVMFFSPVISQLH+YFP TVPFNI+CLSKG+A+GLGE+R KELN SA LLL+NERP
Sbjct: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120

Query: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180
           VSVQVMDFEDGMDEVWDI+SI ST+SQTID++NE+++QIIVTFDSYGVS+HINHKSCH A
Sbjct: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180

Query: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIV---XXX 237
           V++ ID Y  SK +   E  HITALYL+SYKNNI LKYNSFIWEILK+LY  +       
Sbjct: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240

Query: 238 XXXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297
                     +++ LLLMNTH+QY+LA+AAMLNAHKSQVVWFRYGWWILSRFVFVNEFD+
Sbjct: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

Query: 298 YTY 300
           +TY
Sbjct: 301 FTY 303

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 259/302 (85%), Gaps = 2/302 (0%)

Query: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60
           M RR KVNFSKL+YKITKLAIVLTILYI+FTPKI+SRN+  LQH+FPHK  D +INLVIA
Sbjct: 3   MLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIA 62

Query: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120
           HPDDEVMFFSP+ISQL+SYFP TVPFNIICLSKGNA+GLGE+RV+ELN SAALLL NER 
Sbjct: 63  HPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERA 122

Query: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180
           VSVQVMDF+DGMDE+WDI+SI S++SQ ID+ N  LNQIIVTFDSYGVS+HINHKSC+ A
Sbjct: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAA 182

Query: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVI--VXXXX 238
           VK+L+D YA+ K + NE+ PH+TALYL+SYKNNIVLKYNSFIWEILKILY +I       
Sbjct: 183 VKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRII 242

Query: 239 XXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298
                    ++ KL LMNTHAQYVLA+A MLNAH+SQVVWFRYGWWI SRFVFVNEFDVY
Sbjct: 243 QALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302

Query: 299 TY 300
           TY
Sbjct: 303 TY 304

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  473 bits (1218), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 259/302 (85%), Gaps = 2/302 (0%)

Query: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60
           M RRV+VNFSKL+YKITKL+IVLTILYI+FTPKIISRN+E LQHVFP+K  D QINL+IA
Sbjct: 3   MPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIA 62

Query: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120
           HPDDEVMFFSP+ISQLHSYFP TVPFNIICLSKGNA+GLG++RV+ELN SAALLL NER 
Sbjct: 63  HPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERA 122

Query: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180
           VSVQVMDF+DGM+EVWDI+SI ST+SQTI ++N +LNQIIVTFDSYGVS HINHKSCHTA
Sbjct: 123 VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTA 182

Query: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVI--VXXXX 238
           V++LI  Y  S      +TP ITALYL+SYKNNIVLKYNSFIWEIL++LY +I       
Sbjct: 183 VRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTT 242

Query: 239 XXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298
                    +++ LLLMNTHAQY+LA+AAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY
Sbjct: 243 QALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 302

Query: 299 TY 300
            Y
Sbjct: 303 IY 304

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  234 bits (596), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 175/292 (59%), Gaps = 27/292 (9%)

Query: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEV 66
           +N S    K+ KL   L+ILY+  T +I  RN+   Q           + L+IAHPDDEV
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60

Query: 67  MFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQN-ERPVSVQV 125
           MFFSP + QL    P +V FN +CLSKG+AD LGE+R  EL  S  LL  N +R   +  
Sbjct: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120

Query: 126 MDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLI 185
            D+ DG DE W+I S+VS +   + + +     +++TFD++GVS+H NH +CH AV RLI
Sbjct: 121 FDYPDGFDEKWEIESVVSIVESKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI 178

Query: 186 DRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXX 245
           ++  +             ALYL S+  N+ LKY+ FIWE++++L   ++           
Sbjct: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVM----------- 214

Query: 246 XXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297
             +R+ L  MN+  QY+LA+AAM NAH+SQ+VWFRYGWW LSRFVFVN+ ++
Sbjct: 215 KLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  233 bits (595), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 187/296 (63%), Gaps = 19/296 (6%)

Query: 6   KVNFSKLVYKITKLAIVLTILYIFF-TPKIISRNDELLQHVFPHKNRDSQINLVIAHPDD 64
           + NFS+ +YK+TKL+++L ILYI+  T KI S N   L+ +  H    + +NLVIAHPDD
Sbjct: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHD--INSVNLVIAHPDD 60

Query: 65  EVMFFSPVISQLHSYF--PITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVS 122
           EVMFF+P +  L+     P TV FNIIC S G ADGLG  R +EL+ S A+LL   R  S
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118

Query: 123 VQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVK 182
           + V+DF+DGM E WD+  +++ +   +    +  + +++TFD  GVS H+NH +C+ A  
Sbjct: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVP---KLGHNVLLTFDGKGVSGHLNHIACYRAA- 174

Query: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXX 242
             +  Y E K++       +T L L+SY  NIV KY+S+IWE++K+LYS  V        
Sbjct: 175 --LGYYNEFKSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVL 227

Query: 243 XXXXXQRS-KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297
                  + K+ + +T+ QYVL+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ DV
Sbjct: 228 PKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  231 bits (590), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 173/284 (60%), Gaps = 13/284 (4%)

Query: 15  KITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVIS 74
           K  K+  +L +L+I F+ +I SRN  +        +    ++LV+AHPDDEVMFF+P I 
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65

Query: 75  QLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQN-ERPVSVQVMDFEDGMD 133
           +L S  P  V FN++CLSKG AD LG++RV+EL  S  LLL N +R   +Q  D+ DG +
Sbjct: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125

Query: 134 EVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKA 193
           E WD  S+ STI  ++     + + +++TFD  GVS H+NH +CH AV  L+   +  KA
Sbjct: 126 ETWDQESVQSTIKDSV--LQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183

Query: 194 ETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRSKLL 253
                     ALYL SY +NIVLKY++F WEI K+     +               +++ 
Sbjct: 184 ----------ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEIT 233

Query: 254 LMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297
           LM+ ++ Y+L++A+ML++HKSQ+VWFRYGWW  SRFVFVN+  V
Sbjct: 234 LMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  229 bits (584), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 179/297 (60%), Gaps = 17/297 (5%)

Query: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEV 66
           +++   V+K  KL  +L   Y++F   I   N   ++    + +  S +NLVIAHPDDEV
Sbjct: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGP-GYFSGSSSVNLVIAHPDDEV 59

Query: 67  MFFSPVISQLHSYFPITVPFNIICLSKG-NADG--LGESRVKELNGSAALLLQNERPVSV 123
           MFFSP + QL ++ P  V  N+IC SKG N DG   GESR +EL  S ++L++++RPV+V
Sbjct: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTV 119

Query: 124 QVMDFEDGMDEVWDINSIVSTISQTIDLSNE-QLNQIIVTFDSYGVSDHINHKSCHTAVK 182
             +D++DG D++WD++S+V  +   I+ S + +   +++TFD +GVSDH NH +CH AV 
Sbjct: 120 HQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVH 179

Query: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXX 242
           RLI           EE P   A  L+S+  N++LKY+ F  EI+K  Y+           
Sbjct: 180 RLI-----------EEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTS 228

Query: 243 XXXXXQRS-KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298
                    + +L NTH++Y++AYA MLNAH+SQVVWFRYGWW  SR  + NE  ++
Sbjct: 229 LNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  221 bits (564), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/298 (41%), Positives = 179/298 (60%), Gaps = 25/298 (8%)

Query: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPH----KNRDSQINLVIAHP 62
           ++ SKL++KITKL ++   LYI  +PKI   ND++L    P     ++ D  + LV+AHP
Sbjct: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61

Query: 63  DDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVS 122
           DDEVMFFSP + QL S+ P    FNII  S G+A+GLG  R  EL  S  +L+   R   
Sbjct: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKE 120

Query: 123 VQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVK 182
           + + +  DGM+EVWD N ++    ++I LS+ Q N I++TFD +GVS+HINHK+CH    
Sbjct: 121 IFIFNHTDGMNEVWD-NKLMLHQLESI-LSDSQTN-ILLTFDQFGVSNHINHKACH---- 173

Query: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXX 242
           +++  Y +S A+ N       AL L SY +N++ KY  F W+++ +  +  +        
Sbjct: 174 QVVTSYIQSHAKNN------FALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLP-- 225

Query: 243 XXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYTY 300
                    L L N ++ Y+ AYA ML AHKSQ+VWFRYGWW  SRFV+VN+  +YT+
Sbjct: 226 -----NLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  217 bits (552), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 120/285 (42%), Positives = 171/285 (60%), Gaps = 31/285 (10%)

Query: 11  KLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFS 70
           ++V K+ K   +L++LYI  + +I + N ++ ++VFP +   S +NL++AHPDDE MFFS
Sbjct: 5   EVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRTPTS-VNLIVAHPDDETMFFS 63

Query: 71  PVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFED 130
           P + QLH  +P +VP  +ICL+ G+ADGLG  R +EL  S  LLL   R  SV V  FED
Sbjct: 64  PTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLP-ARNTSVIVEGFED 122

Query: 131 GMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAE 190
           GM   WD   +V+TI++ +       + +++TFD +GVS H+NH SC+TAV  L++    
Sbjct: 123 GMGVEWDTRQVVATINRHVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVE---- 174

Query: 191 SKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRS 250
            + E  E+    TALYL S K     KY SF  ++ +I+                   R 
Sbjct: 175 -QREQREQ--RFTALYLNS-KRYFPPKYGSFAVDLARIITG-----------------RQ 213

Query: 251 KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295
             + M+T  QY+L+ AAM NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 214 PPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  213 bits (541), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 186/312 (59%), Gaps = 31/312 (9%)

Query: 5   VKVNFSKLVYKITKLAIVLTILYIFFTPKIISRN-----DELLQHVF--PHKNRD----- 52
           + + FSK  YK  KL ++L + Y+  T KI S N     + +L  +    H + D     
Sbjct: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60

Query: 53  SQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAA 112
           +Q++LVIAHPDDE+MFF+P + QL+ + P ++PFNIIC S G+A+GLG  R KEL+ S  
Sbjct: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSIN 120

Query: 113 LLL--QNERPVSVQVMDFEDGMDEVWDINSIVSTISQT--IDLSNEQLNQIIVTFDSYGV 168
           LLL   N R +++ ++DF DGMD+VWD   ++S++     +++     N I++TFD+ G+
Sbjct: 121 LLLSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180

Query: 169 SDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYL--KSYKNNIVL----KYNSFI 222
           S+H NH +C+ AV  LI        E N     I  L L  KS + NIV+    KY  F+
Sbjct: 181 SNHPNHIACNKAVHDLISYDGGKDKEMN-----IIGLMLSSKSDEYNIVMNLLSKYTFFV 235

Query: 223 WEILKILYSVIVXXXXXXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYG 282
            +++K+ +++                  +L  +NT++QY+L+YA+MLN HKSQ+VWFRYG
Sbjct: 236 IDLVKVYWNLATGTFNTIPNSASL----ELSFINTYSQYILSYASMLNTHKSQMVWFRYG 291

Query: 283 WWILSRFVFVNE 294
           WW  SRFVF N+
Sbjct: 292 WWWFSRFVFSND 303

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  209 bits (532), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 174/295 (58%), Gaps = 30/295 (10%)

Query: 9   FSKLVYKITKLAIVLTILYIFFTPKIISRN----DELLQHVFPHKNRDSQINLVIAHPDD 64
           FSKL++K+TKL +VL +LY+  + +I   N     +L   +F   +  + +NLVIAHPDD
Sbjct: 8   FSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIF---HEGTTLNLVIAHPDD 64

Query: 65  EVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQ 124
           EVMFF+P + QL +  P+++P N+IC S G+A GLGE R  EL  S   L+QN+R  +V 
Sbjct: 65  EVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVT 124

Query: 125 VMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRL 184
           V+ F+DG D++WDI+ +   + Q         +Q  +TFDS+GVS H NH +CH AV  L
Sbjct: 125 VLHFQDGNDQIWDIDQMTQYLPQND-------HQAFLTFDSHGVSGHKNHIACHNAVWNL 177

Query: 185 IDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXX 244
                     TN     +T L L S  ++++ KY  FI +++K+ +++            
Sbjct: 178 --------KNTNNN---VTILTLDSIHHSLLAKYTFFIIDLVKLYWNL-----WKDQQQP 221

Query: 245 XXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYT 299
                 K+   N ++QY+LAY+ MLNAHKSQVVWFRYGWW  SRFVF N   + T
Sbjct: 222 QWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  197 bits (501), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/304 (37%), Positives = 180/304 (59%), Gaps = 26/304 (8%)

Query: 12  LVYKITKLAIVLTILYIFFTPKIISRN-DELLQHVFPHKNRDS--QINLVIAHPDDEVMF 68
           +++K+ K   +L+ILYI+ TP I   N      +V  + ++ S   +NL+IAHPDDEVMF
Sbjct: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62

Query: 69  FSPVISQLHSYFPITVPFNIICLSKG-NADG--LGESRVKELNGSAALLLQNERP----- 120
           F+P + QL    P  VPFN+ICLSKG + DG  +G+ R  E+  S  +LL + R      
Sbjct: 63  FTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNRE 122

Query: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSN--EQLNQIIVTFDSYGVSDHINHKSCH 178
           V +   ++EDGMD+ WDI+ +V+ I  TI + +  + L   ++TFD+ GVS+H NH +C+
Sbjct: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182

Query: 179 TAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVI----- 233
            A+  L       K +++    ++  + L SY +NI+LKY+SF+  + K+L ++I     
Sbjct: 183 DAMMTL-------KQKSSNPGDYL-LMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFR 234

Query: 234 VXXXXXXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVN 293
           +             +  ++  +NT   Y++A ++MLN+H SQ+VWFRYGWW  SRFVFVN
Sbjct: 235 IFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVN 294

Query: 294 EFDV 297
           +  +
Sbjct: 295 DLHI 298

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  195 bits (496), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 168/296 (56%), Gaps = 23/296 (7%)

Query: 9   FSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMF 68
           FSKL++K+TKL I+  +LYI+FTPK+   N E L  + P  +    +NLVIAHPDDE+MF
Sbjct: 18  FSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMF 77

Query: 69  FSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLL--QNERPVSVQVM 126
           FSP I QL  +       N++CLS G+ADGLGE R KEL  +   L   +N R VS+ ++
Sbjct: 78  FSPTILQLIDHVQ---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNIL 134

Query: 127 DFEDGMDEVWDINSIVSTISQTIDLSNEQLNQ--IIVTFDSYGVSDHINHKSCHTAVKRL 184
           D+ DG +EVW  + + + + + I  S   + Q  II+TFD  G+S H NH +C+  V   
Sbjct: 135 DYTDGQNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGV--- 189

Query: 185 IDRYAESKAETNEETPHITALYLKSYKN-NIVLKYNSFIWEILKILYSVIVXXXXXXXX- 242
           I      K+ +         L LKS     I+ KY+  + ++L+I+Y+ I          
Sbjct: 190 ISYLKTIKSNS------FVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSY 243

Query: 243 ---XXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295
                     S +  ++T  QY L++AAM  AHKSQ+VWFRY WW  SR+VFVN+ 
Sbjct: 244 LPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  182 bits (463), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 152/279 (54%), Gaps = 35/279 (12%)

Query: 16  ITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQ 75
           + KL  VL ILY   + +I + N++    +F   N  S INLVIAHPDDEVMFF+P + Q
Sbjct: 7   VCKLLAVLCILYFASSARIKASNEQAFTTLFSVLNPTS-INLVIAHPDDEVMFFAPTLLQ 65

Query: 76  LHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEV 135
           L  YF   +P ++  L+ G ADGLG+ R +EL  S  LL +  R   V V++FEDGM   
Sbjct: 66  LDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFR-RRKAEVTVLNFEDGMKVE 124

Query: 136 WDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAET 195
           WD+      + + + + ++ L    +TFD +GVS HINH SC+  V+ L   + ES++  
Sbjct: 125 WDLQKTSEALRKQV-VGDQPL---FLTFDDHGVSSHINHISCYETVRNLRAAHPESRS-- 178

Query: 196 NEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRSKLLLM 255
                     +  + K +I  KY +F+  ++ +L                     + + M
Sbjct: 179 ----------FSLTSKRSIFQKYTAFVPSLITVLRG-----------------SRQAVFM 211

Query: 256 NTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNE 294
           +T  QY+LA + M+NAH SQ+VWFRYGWW  S +VF NE
Sbjct: 212 STFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  177 bits (450), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 158/283 (55%), Gaps = 35/283 (12%)

Query: 16  ITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQ 75
           + K++ +L ++YI  + +I   N   L  +F   +  + INLVIAHPDDEVMFF+P + Q
Sbjct: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLF-RGSAPTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 76  LHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEV 135
           +  + P ++  N+I L+ G ADGLG+ R KEL     LLL+ +R  SV+V+DF DGMD  
Sbjct: 66  IDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLR-KRKASVEVLDFLDGMDVE 124

Query: 136 WDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAET 195
           WD+   V  + + I L    L    +TFD  G+S H+NH SC+ AV+++   Y++S    
Sbjct: 125 WDLERAVKALQERI-LDESPL---FLTFDENGISGHVNHISCYKAVQKVRKHYSKS---- 176

Query: 196 NEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRSKLLLM 255
                  +   L S K  +  KY+ F   I  + +S I                S   L+
Sbjct: 177 -------SCFKLVS-KRYLFEKYSGF---IPALFHSFI--------------SSSPSTLI 211

Query: 256 NTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298
           N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   +
Sbjct: 212 NSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  174 bits (442), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 155/282 (54%), Gaps = 38/282 (13%)

Query: 14  YKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVI 73
           + + KL ++L  +Y +   ++   N ++ + +    ++ + + LVIAHPDDEVMFF+P +
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTL 65

Query: 74  SQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMD 133
            QL +  P  +PF ++CL+ G A+GLG+ R  EL   A  LL  E  V+++V DF DGM 
Sbjct: 66  LQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQ-KALRLLVLEHDVTLEVADFTDGMK 124

Query: 134 EVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKA 193
           E WD+  + + + + +         +++TFD  GVS H NH  C  A  RL         
Sbjct: 125 EDWDLAEVRTRLGELV----TDAKPLVLTFDERGVSGHRNHIGCALAAARL--------- 171

Query: 194 ETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRSKLL 253
                  H T L+L+S + N++ KY+ F+ ++ ++++                      +
Sbjct: 172 ------GHKT-LFLRS-ERNLLRKYSFFVLDVFRVVFGTP----------------PPTV 207

Query: 254 LMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295
            ++T AQY+ A  AM+ AH+SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 208 FVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY 249

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 153/282 (54%), Gaps = 38/282 (13%)

Query: 14  YKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVI 73
           + + KL +VL  +Y      + + N ++ +++       + + L+IAHPDDEVMFF+P +
Sbjct: 6   FAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTL 65

Query: 74  SQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMD 133
            QL +    +VPF ++CL+ G+ADGLGE R +EL+  A  LL  ER V +Q+  F+DGMD
Sbjct: 66  LQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELH-KALRLLVLERDVEIQMGGFKDGMD 124

Query: 134 EVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKA 193
           E W +  +   ++Q +         +++TFD  GVS H NH +C           A + A
Sbjct: 125 EEWKMEVVREELAQVV----TDRRPLVLTFDERGVSGHRNHIAC-----------AHAAA 169

Query: 194 ETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVXXXXXXXXXXXXXQRSKLL 253
           +    T H+ +       +N++ KY+ F  ++ ++L+   +                  +
Sbjct: 170 KLGHHTLHLDS------GHNLIRKYSFFFVDLFRLLFGYPM----------------PTV 207

Query: 254 LMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295
            ++T +QY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 208 FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  173 bits (439), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 32/242 (13%)

Query: 53  SQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAA 112
           + + LV+AHPDDEVMFFSP ++Q +   PI++P N++C++ G+ADGLG  R +EL  S  
Sbjct: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108

Query: 113 LLLQNERPVSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHI 172
           ++    R     V+DFEDGMD VWD   +   +  +I  SN     +++TFD +GVS HI
Sbjct: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNP----LVLTFDQFGVSGHI 163

Query: 173 NHKSCHTAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSV 232
           NH SC   V++L               P+   L+L+S    I +KY++FI  I ++  S 
Sbjct: 164 NHISCGRLVEKL---------------PYSHKLHLRS-DQPIYVKYSAFIAGIFQLGIST 207

Query: 233 IVXXXXXXXXXXXXXQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFV 292
           +                     ++T  QY+LA +AM  AH SQ+VWFR GWW+ SRF F+
Sbjct: 208 V-----------YPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFI 256

Query: 293 NE 294
           NE
Sbjct: 257 NE 258

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  172 bits (435), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 176/327 (53%), Gaps = 46/327 (14%)

Query: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPH----KNRD----SQINLV 58
           +NFS    +  KL ++  ++YIF +  I   ND+   +   H     N+     + ++L+
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60

Query: 59  IAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGE----SRVKELNGSAALL 114
           IAHPDDE+MFFSP + QL++Y    + FN++CLS+G  D  G      RV ELN S  LL
Sbjct: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119

Query: 115 L------QNERPVSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGV 168
                  ++ R   +  +D+ DGM E+W+++ IV  + Q ++ ++  +N +++TFD  GV
Sbjct: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSGV 178

Query: 169 SDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKI 228
           S+H NH +C+ AV +L+ +Y+   +       ++  ++L S+  N  LKY+ F+ ++  I
Sbjct: 179 SNHKNHLACNEAVTKLL-KYSNPDS-------NLIGIFLNSHSKNFFLKYSFFVSKLFTI 230

Query: 229 L----YSVIVXXXXXXXXXXXXXQRSKLL--------------LMNTHAQYVLAYAAMLN 270
           +    +  I              Q  +++                N  A+Y+L+Y+ MLN
Sbjct: 231 IKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLN 290

Query: 271 AHKSQVVWFRYGWWILSRFVFVNEFDV 297
           AH+SQ+VWFRY WWI SRF F+N+  +
Sbjct: 291 AHESQMVWFRYLWWIFSRFAFINDLTI 317

>KNAG0B02070 Chr2 (394203..394775) [573 bp, 190 aa] {ON} Anc_7.456
           YPR037C
          Length = 190

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 150 DLSNEQLNQII-VTFDSY--GVSDHINHKSCHTAVKRLIDRYAE 190
           D  + QL Q   + F SY  G  DH+N K CH  VKR +  +AE
Sbjct: 66  DKRSSQLGQSAWLLFHSYLNGTEDHLNEKECHR-VKRFVRIFAE 108

>CAGL0E01463g Chr5 complement(138109..138738) [630 bp, 209 aa] {ON}
           highly similar to uniprot|P07260 Saccharomyces
           cerevisiae YOL139c CDC33 translation initiation factor
           eIF4E
          Length = 209

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 122 SVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSC-HTA 180
           S QV      +DE+W + ++++ I +TID  + Q+N +++     G    +  KSC    
Sbjct: 112 SFQVRGRGAEIDELW-LRTLLAVIGETIDEEDSQINGVVLNVRKGGNRFALWTKSCDKEP 170

Query: 181 VKRLIDRYAESKAETNEET----PHITA 204
           +  +  R+ +     +E+T    PH TA
Sbjct: 171 LSNIGARFKQVLKLADEDTLEFFPHSTA 198

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,861,795
Number of extensions: 1292051
Number of successful extensions: 4051
Number of sequences better than 10.0: 30
Number of HSP's gapped: 4116
Number of HSP's successfully gapped: 31
Length of query: 300
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 191
Effective length of database: 40,982,805
Effective search space: 7827715755
Effective search space used: 7827715755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)