Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4518.843ON53953925980.0
Smik_13.4928.843ON54354022910.0
YMR279C8.843ON54054022450.0
Suva_13.4678.843ON54353821680.0
NCAS0A02540singletonON53953016190.0
KNAG0J002608.843ON55050816160.0
NDAI0K004008.843ON55353315880.0
CAGL0M03003g8.843ON55848515490.0
NCAS0B002908.843ON54251015460.0
NDAI0E002808.843ON54953315450.0
NCAS0C004008.843ON51750615310.0
KAFR0B039408.843ON54752015300.0
YML116W (ATR1)8.843ON54247515270.0
Smik_13.188.843ON54547515250.0
KAFR0B03930singletonON55547715250.0
KNAG0G034308.843ON54248415240.0
Skud_13.258.843ON53750015210.0
Suva_13.278.843ON55351515140.0
TPHA0C047908.843ON55647814560.0
TBLA0D032708.843ON55047414490.0
TDEL0B005508.843ON53751814450.0
SAKL0D01386g8.843ON52148114270.0
Kpol_541.168.843ON52848213990.0
KLTH0C03806g8.843ON52547513920.0
Kwal_27.102458.843ON51547513850.0
CAGL0B02343g8.843ON53748313720.0
KAFR0A028408.843ON52048213400.0
TBLA0D03280singletonON58048613301e-178
TBLA0C01160singletonON60048010701e-139
Skud_15.545na 1ON5164788521e-107
Smik_15.560na 1ON5164758421e-106
YOR378Wna 1ON5154758231e-103
Suva_8.435na 1ON5154758161e-102
KLTH0C10560gna 1ON5154747947e-99
Kwal_23.6547na 1ON5114817782e-96
KLLA0B00352gna 1ON4984867581e-93
TDEL0G04950singletonON5125026981e-84
KNAG0D00130na 1ON5654744905e-54
KAFR0C04860na 1ON5344834325e-46
SAKL0C06116gsingletonON1851903444e-37
NCAS0A05720na 1ON5635573667e-37
NDAI0K02730singletonON6045513473e-34
CAGL0L02519gna 1ON5294843436e-34
Suva_10.11singletonON5405291501e-09
Skud_6.16na 2ON5494841492e-09
Smik_6.24na 2ON5444841465e-09
SAKL0F00440gsingletonON5444451205e-06
KLLA0C18931gna 3ON5535041108e-05
YKR105C (VBA5)singletonON582150870.054
Smik_18.10singletonON53192860.074
YMR088C (VBA1)2.473ON56298850.098
Skud_13.2442.473ON56298850.10
Smik_13.2722.473ON56198840.13
NCAS0C03460na 4ON630197830.16
KLLA0E24113g8.570ON57589830.17
NDAI0D010202.242ON592177830.19
YPR198W (SGE1)singletonON543136820.20
Suva_13.2652.473ON56198810.30
KLLA0F13684g2.473ON571158810.31
KLTH0H16214gsingletonON551124810.33
KLTH0D16962gsingletonON571154780.65
AGR076C8.272ON686424780.69
CAGL0B02079gna 4ON624223780.77
NCAS0A078102.473ON56898761.1
Kpol_467.242.473ON37063751.2
Ecym_73992.473ON563238761.3
TDEL0A024902.473ON55448761.3
TPHA0G031502.473ON60059751.5
TPHA0F012902.242ON562209751.6
SAKL0B02112gna 5ON52764741.8
KLTH0C10120gsingletonON651142742.0
Kwal_34.15746na 3ON518239742.1
KLTH0B00132gsingletonON568158732.4
Smik_17.11singletonON544136732.4
SAKL0E02992g2.473ON57048732.6
NDAI0H022002.473ON57144732.7
Skud_16.503singletonON543136732.7
SAKL0A00726gsingletonON598170723.1
ZYRO0G03234g2.473ON56248723.1
KLTH0C10142gsingletonON573169723.9
SAKL0C05588gsingletonON677149723.9
CAGL0J01375g2.473ON56498714.9
KLLA0F17776gna 6ON55351705.5
YGR224W (AZR1)na 4ON613150706.9
YBR293W (VBA2)na 7ON474220689.1
ZYRO0C01430g8.272ON590291689.4
KNAG0E025602.473ON57844689.6
Skud_18.3singletonON590144689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.451
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...  1005   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   887   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   869   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   839   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   628   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   627   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               616   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   601   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      600   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      599   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      594   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   593   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   592   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   592   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   592   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   591   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   590   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   587   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   565   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   562   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   561   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   554   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   543   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   540   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   538   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   533   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   520   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   516   e-178
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   416   e-139
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   332   e-107
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   328   e-106
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   321   e-103
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   318   e-102
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   310   7e-99
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   304   2e-96
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   296   1e-93
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   273   1e-84
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   193   5e-54
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     171   5e-46
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   137   4e-37
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            145   7e-37
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   138   3e-34
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   136   6e-34
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    62   1e-09
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    62   2e-09
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    61   5e-09
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    51   5e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    47   8e-05
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    38   0.054
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    38   0.074
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    37   0.098
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    37   0.10 
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    37   0.13 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    37   0.16 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    37   0.17 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.19 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    36   0.20 
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    36   0.30 
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    36   0.31 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    36   0.33 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    35   0.65 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    35   0.69 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    35   0.77 
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    34   1.1  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    33   1.2  
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    34   1.3  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    34   1.3  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    33   1.5  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    33   1.6  
SAKL0B02112g Chr2 complement(202102..203685) [1584 bp, 527 aa] {...    33   1.8  
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    33   2.0  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    33   2.1  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    33   2.4  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    33   2.4  
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    33   2.6  
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    33   2.7  
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    33   2.7  
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    32   3.1  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    32   3.1  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    32   3.9  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    32   3.9  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    32   4.9  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   5.5  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    32   6.9  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    31   9.1  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    31   9.4  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    31   9.6  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    31   9.8  

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/539 (92%), Positives = 498/539 (92%)

Query: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPT 60
           MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVA            PWQDPT
Sbjct: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPT 60

Query: 61  YFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGS 120
           YFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGS
Sbjct: 61  YFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGS 120

Query: 121 FILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILP 180
           FILISGRLGDIYGLKKMLM              LSKYSNNDSFFITCRAFQGVGIAFILP
Sbjct: 121 FILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILP 180

Query: 181 NIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIA 240
           NIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIA
Sbjct: 181 NIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIA 240

Query: 241 TFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
           TFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYII  
Sbjct: 241 TFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVL 300

Query: 301 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360
                        YEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL
Sbjct: 301 LVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360

Query: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420
           NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV
Sbjct: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
           EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM
Sbjct: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480

Query: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539
           GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA
Sbjct: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/540 (82%), Positives = 472/540 (87%), Gaps = 1/540 (0%)

Query: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVST-DEEVTTVAXXXXXXXXXXXXPWQDP 59
           MLP F++KMSVQGT   ++DK  MK +DKV++ST DEEVTTV             PWQDP
Sbjct: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDP 60

Query: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119
            YFSSFGKELMFI TCMLAQLLNQAGQTHALCIMNVLSKSF SESNNQAWLMASFPLAAG
Sbjct: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120

Query: 120 SFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFIL 179
           SFILISGRLGDIYGLKKML+              LSKYSN+D+FFITCRAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFIL 180

Query: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239
           PNIMGLVGHVYKVGSLRKNLVISVIGAC P G +FGGVFGGLIVTEDP QWPWVFYAF I
Sbjct: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSI 240

Query: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIX 299
           ATFIS+LMAWYSIPNNVPTNVHGLSMDWTGS LAV+GLILFNFVWN+APIAGW +AYII 
Sbjct: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIV 300

Query: 300 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359
                         YEIKYAEVPLLPHAVTKNRHMIMILLAVF+GWGSFGIWTFYYVSFQ
Sbjct: 301 LLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419
           LNLRHYSPVWTGGTYFVF IFG+IAAFFVAFSIKRLGPA+LLCFALMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420

Query: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479
           VEQSYWKLNFAMQA+LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539
           MG TVE QINKSG+N+L+GYRAA+YLGIGLASLG+LISVTYMLE  WN+ K+ ++K LEA
Sbjct: 481 MGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEA 540

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/540 (80%), Positives = 470/540 (87%), Gaps = 1/540 (0%)

Query: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVST-DEEVTTVAXXXXXXXXXXXXPWQDP 59
           M   F++K SVQGT S +++KI++K +DKV+VST DEEVTT+             PWQDP
Sbjct: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDP 60

Query: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119
           TYFSSFGKELMFI TCMLAQLLNQAGQTHALCIMNVLSKSF SE+NNQAWLMASFPLAAG
Sbjct: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120

Query: 120 SFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFIL 179
           SFILISGRLGDIYGLKKML+              LSKYSN+D+FFIT RAFQGVGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180

Query: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239
           PNIMGLVGHVYKVGS RKN+VIS IGAC PTG +FGG+FGGLIVTEDPNQWPWVFYAFGI
Sbjct: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGI 240

Query: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIX 299
           ATF+S+LMAWYSIPNNVPTN+HGLSMDWTGS LA+IGLILFNFVWN+API GWDK YII 
Sbjct: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIV 300

Query: 300 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359
                         YE KYAEVPLLP A+TKNRHMIMILLAVF+GWGSFGIWTFYYVSFQ
Sbjct: 301 LLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419
           LNLRHYSPVWTGGTYFVF IFG++AAFFVAFSIKRLGPALLLCF+LMAFDAGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420

Query: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479
           VEQSYWKLNFAMQA+LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539
           MG TVEHQINKSG ++L+GYRAAVYLG+GLASLGV+ISVTYMLE +WN  +K + +SLEA
Sbjct: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLEA 540

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/538 (77%), Positives = 455/538 (84%), Gaps = 1/538 (0%)

Query: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVST-DEEVTTVAXXXXXXXXXXXXPWQDP 59
           M P  E K++VQ   SPV DKISMK EDKV+VS+ DE+VTTVA            PWQDP
Sbjct: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119
           TYFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSF SES+ QAWLMASFPL AG
Sbjct: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120

Query: 120 SFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFIL 179
           SFILISGRLGDIYGLKKMLM              LSKYSNND+FFITCRAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180

Query: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239
           PN+MGLVGHVYKVGS RKNLVIS IGAC P G +FGG+FGGLIV ED  QWPWVFYAF I
Sbjct: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAI 240

Query: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIX 299
           A F++M++AWYSIPNN+PTNVHG SMDWTGSVLAVIGLILFNFVWN+AP AGW  AYII 
Sbjct: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300

Query: 300 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359
                         YE+KYA+VPLLPHAVTKNRHMIMILLAVF+GWGSFGIWTFYY+SFQ
Sbjct: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360

Query: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419
           LNLRHYSPVWTGGTYFVF IFGTIAAF VA SIKR+GPA LLCFAL+AFD GSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420

Query: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479
           V+QS+WKLNF MQA+LCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480

Query: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSL 537
           MGATVEHQINK+GK++L+GYR A+YLG+GLASLGVLIS TYMLET WN R+  Q+ S+
Sbjct: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/530 (57%), Positives = 385/530 (72%), Gaps = 7/530 (1%)

Query: 2   LPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTY 61
           LPS  +  S   +SS V    S   EDK I   ++EV + +            PWQ+P Y
Sbjct: 3   LPSILQTDSDNFSSSTV----SFPNEDKNISHNEKEVYSNSTDSVLDDDS---PWQNPNY 55

Query: 62  FSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSF 121
           FSS  KE  FI TCM+A LLNQAGQT  L  MNV+S+SF S+S  Q WLMASFPL +GSF
Sbjct: 56  FSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSF 115

Query: 122 ILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPN 181
           ILISGR+GDIYGLKK ++               + +++ND+FFI CRAFQG+GI+FILPN
Sbjct: 116 ILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPN 175

Query: 182 IMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIAT 241
           +MGL+G++YKVG+LRKN+VIS+IG   PTGA  G ++GGLIVTE+  QWPW+FYA+ +  
Sbjct: 176 VMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTG 235

Query: 242 FISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXX 301
            ++++MA YS+PN +PTNVH  +MDW GS++ V+GLILFNFVWN+ P+AGWDKAYII   
Sbjct: 236 LVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLL 295

Query: 302 XXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLN 361
                       YE+KY   PLLP  VTKN  ++ IL  +F+GWG+FGIWTFYY +FQLN
Sbjct: 296 IISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLN 355

Query: 362 LRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVE 421
           LR YSPVW GGTYF+F I+GTIAA  VAF+IK++GPA+LL F+ + F  GS+M SV P+ 
Sbjct: 356 LRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIH 415

Query: 422 QSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 481
           Q YW++N  MQ +LCFGMDLSFPASSIILSD LPMQYQGMAGSLVNTVINY+ SLCLGMG
Sbjct: 416 QMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMG 475

Query: 482 ATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531
            TVE QINKSG+++L+GYR+A+YL +GL  LG  I+   +  T+W +R+ 
Sbjct: 476 TTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRD 525

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/508 (58%), Positives = 373/508 (73%), Gaps = 5/508 (0%)

Query: 19  NDKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLA 78
           ND+ +++E+      ++ E  + +            PWQ+PTYF++  +E  FI TCMLA
Sbjct: 30  NDQTNVEEKKNCSTESEAEWCSESEFTDNDT-----PWQNPTYFANRWQEYAFISTCMLA 84

Query: 79  QLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 138
           QLLNQAGQ  A   MN+L+ +F S +  Q WLMASFPL +GSFIL+SGR+GDIYGLKK L
Sbjct: 85  QLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTL 144

Query: 139 MXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKN 198
           +               + Y++ND+FFI CRAFQG+GIAFILPN+MGL+G++YK  +LRKN
Sbjct: 145 IGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKN 204

Query: 199 LVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPT 258
            VIS +G C P GA  GGV+ GLI  E+P QWPW+FYA+ I   I+M+MA YSIP+ VPT
Sbjct: 205 FVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPT 264

Query: 259 NVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKY 318
           N+HG  MDWTGS + V+G+ILFNFVWN+ PI GW+K YII               YEIK+
Sbjct: 265 NIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKF 324

Query: 319 AEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFA 378
           A+ PLLP  V KNRH+ MILLAVF+GWGSFGIWTFYY +FQLNLRHYS VW GGT+F+F 
Sbjct: 325 AKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFV 384

Query: 379 IFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFG 438
           I+GTIAAF VA +IKR+GP++LLCF++  F  G IM SV PV QSYWK+N  MQ +L FG
Sbjct: 385 IWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFG 444

Query: 439 MDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEG 498
           MDLSFPASSIILSD LP QYQGMAGSLVNT++NYS SLCLG+G+T E Q+NK+G + L+G
Sbjct: 445 MDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKG 504

Query: 499 YRAAVYLGIGLASLGVLISVTYMLETVW 526
           YRAA+Y+GIGL + G+L++  Y+ E +W
Sbjct: 505 YRAALYVGIGLGACGMLVAFCYLFEVLW 532

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/533 (56%), Positives = 387/533 (72%), Gaps = 8/533 (1%)

Query: 6   ERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSF 65
           E + ++  TSS    K ++KE+D      DE  +                WQ+P YFSS 
Sbjct: 21  ESQSTIDCTSS--ERKTAIKEQD------DEIGSDSTTTSSSSLQENNSSWQNPDYFSSS 72

Query: 66  GKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILIS 125
            KE +F+ TCM+A LLNQAGQ+  L  MNV+S SF S +  Q WLMASFPL +GSFILIS
Sbjct: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILIS 132

Query: 126 GRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGL 185
           GRLGDIYGLK+M++               + Y+++D+FFI  RAFQG+GI+FILPN+MGL
Sbjct: 133 GRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGL 192

Query: 186 VGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISM 245
           VG++YKVG+LRKN+VIS+IG   PTG+ FG ++GGLIVTE+P QWPW+FYA+ +A  + +
Sbjct: 193 VGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCL 252

Query: 246 LMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXX 305
           +M +Y++P+N+PTNV+G +MDW GSVL VIGLILFNFVWN+ PI GW+KAYII       
Sbjct: 253 VMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSV 312

Query: 306 XXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHY 365
                   YEIKYA+VPLLP AVT+N H++ IL  +F+GWGSFGIWTFYY +FQLNLR Y
Sbjct: 313 IFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREY 372

Query: 366 SPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYW 425
           SPVW+GGT+FVF IFGT+AA  VA +IK++GPA+LL F+ + F  GSI+ SV PV Q+YW
Sbjct: 373 SPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYW 432

Query: 426 KLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVE 485
           +  F MQ +L FGMDL FPASSIILSD LPMQYQGMA SLVNT++NYS SLCLGMG TVE
Sbjct: 433 RNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVE 492

Query: 486 HQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538
            QINKSG ++L+GYRAA+Y G+G+A LG  I+   +   +W++R     K L+
Sbjct: 493 RQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQ 545

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/485 (62%), Positives = 377/485 (77%), Gaps = 3/485 (0%)

Query: 55  PWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASF 114
           P+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S S+ Q WLMASF
Sbjct: 72  PFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASF 131

Query: 115 PLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
           PL +GSFILISGRLGDIYGLKK L               L+KY+N+D+FFI CR+FQG+G
Sbjct: 132 PLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLG 191

Query: 175 IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVF 234
           IAFILPNIMGLVG++YKVG+LRKN+VIS IG   P GA  G +FGGLIVTED  QWPWVF
Sbjct: 192 IAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVF 251

Query: 235 YAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDK 294
           YAFGIA+F++ML+A YSIPNNVPTN++ L+MDW GS+L V GL+L N VWN+API GW +
Sbjct: 252 YAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGE 311

Query: 295 AYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFY 354
           AYII               YEIKYA  PLLP +V +N+ ++MIL A+F GWGSFGIWT+Y
Sbjct: 312 AYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYY 371

Query: 355 YVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIM 414
           Y +FQLNLR Y+P+W GGT+F+F I+GT+AAF VA +IK++GPA+LLCF+++AFD GSIM
Sbjct: 372 YYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIM 431

Query: 415 FSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSA 474
            SV PV Q+YW++N  MQ +L FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+NYS 
Sbjct: 432 LSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYST 491

Query: 475 SLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQR 534
           SLCLGMG TVE Q N  G ++L+GYR+A+YL IGLAS GV +S+ +++  +  +R    R
Sbjct: 492 SLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKR---HR 548

Query: 535 KSLEA 539
           K +E+
Sbjct: 549 KRIES 553

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/510 (57%), Positives = 368/510 (72%), Gaps = 1/510 (0%)

Query: 23  SMKEEDKVIVSTD-EEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQLL 81
           S+ EE  +I   D EE+                 WQ+P YF +  +E +FI +CM++QLL
Sbjct: 22  SITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLL 81

Query: 82  NQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXX 141
           NQA     L IMN+++ SF SE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+  
Sbjct: 82  NQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGG 141

Query: 142 XXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVI 201
                       L+KYS++D+FFI  RAFQG+ IAFILPN+MG+VG++YK  S RKN+VI
Sbjct: 142 YIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVI 201

Query: 202 SVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVH 261
           S+IGA  P GA FG +F GLI TEDP+QWPW FYAF IA+  ++ ++ YSIPN+VPTNVH
Sbjct: 202 SMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVH 261

Query: 262 GLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEV 321
           G +MDW GSVLAVIGLIL NFVWN+ PI GW  AYII               YE+KYAE 
Sbjct: 262 GFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAES 321

Query: 322 PLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFG 381
           PLLP  VTKNRH+IMIL A+F+GWGSFGI++FYY SF LNLRHYS +W G TYF+FAI+G
Sbjct: 322 PLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWG 381

Query: 382 TIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDL 441
           T+AA  V   IK++  A +L  +++AF+ G IM SV PV+Q+Y+++N     +L FGMD+
Sbjct: 382 TVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDM 441

Query: 442 SFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRA 501
           SFPA++IILSDGL MQYQGMAGSL NT++NYS SLCLGMG TVE QINKSG ++L+GYR 
Sbjct: 442 SFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRG 501

Query: 502 AVYLGIGLASLGVLISVTYMLETVWNERKK 531
           A YLGIGLA LG++I+  Y+ E +W +RK+
Sbjct: 502 AEYLGIGLAGLGIIITAIYLGEILWGKRKQ 531

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/533 (55%), Positives = 381/533 (71%), Gaps = 16/533 (3%)

Query: 6   ERKMSVQGTSSPVNDKIS--MKEEDKVIV-----STDEEVTTVAXXXXXXXXXXXXPWQD 58
           E K   Q TSS + ++ S   KEE+  +      S+++E  T+              WQ+
Sbjct: 15  EEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHS---------KWQN 65

Query: 59  PTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAA 118
           P YF +  +E +FI +CM++QLLNQA     L IMN+++ SF SE   + WL+ASFPL +
Sbjct: 66  PDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVS 125

Query: 119 GSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFI 178
           GSFILISGR+GDIYGLKK L+               + YS+ND FFI  RAFQG+GIAFI
Sbjct: 126 GSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFI 185

Query: 179 LPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFG 238
           LPN+MG+VG++YK  + RKN+VIS+IGA  P GA  G +F GLI TE+P QWPW FYAF 
Sbjct: 186 LPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFA 245

Query: 239 IATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYII 298
           IA+ I++ ++ YSIPNN+PTN+HG +MDW GS++AVIGLIL NFVWN+ PI GW KAYII
Sbjct: 246 IASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYII 305

Query: 299 XXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSF 358
                          YEIKYA+ P+LP  VTKNRH+IMIL A+F+GWGSFGI++FYY SF
Sbjct: 306 VLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSF 365

Query: 359 QLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVL 418
            LNLRHYS +W G TYF+FAI+GT+AA  V   IKR+  +++L F+++AF+ G IM SV 
Sbjct: 366 LLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVT 425

Query: 419 PVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCL 478
           PV+Q+Y+++N     +L FGMD+SFPA++IILSDGL MQYQGMAGSL NT++NYS SLCL
Sbjct: 426 PVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCL 485

Query: 479 GMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531
           GMG TVE QINKSGK +L+GYRAA YLG+GLA LG++IS  YM E +W +RK+
Sbjct: 486 GMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKE 538

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/506 (56%), Positives = 363/506 (71%), Gaps = 4/506 (0%)

Query: 26  EEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQLLNQAG 85
           E  + IVS+ ++ T               PWQ+  YF S  KE  FI TCM A LLNQAG
Sbjct: 2   ENKEPIVSSSQKKT----LSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAG 57

Query: 86  QTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXX 145
           QT  L  MNV+S+SF S+   Q WLMASFPL +GSFILISGR+GDIYGLKK ++      
Sbjct: 58  QTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFM 117

Query: 146 XXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIG 205
                    + Y+++D+FFI CRAFQG+GI+FILPNIMGLVG++YKVG+LRKN+VIS+IG
Sbjct: 118 IIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIG 177

Query: 206 ACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSM 265
              PTGA  G ++GGLI TE   QWPW+FYA+ +A F++++MA YS+P NVPTNVH  +M
Sbjct: 178 ITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAM 237

Query: 266 DWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLP 325
           DW G+++ V+GLILFNFVWN+ P+ GW K YII               YE+K+   PLLP
Sbjct: 238 DWMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLP 297

Query: 326 HAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAA 385
             VTKN  ++ IL  +F+GWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F I+G+IAA
Sbjct: 298 REVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAA 357

Query: 386 FFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPA 445
           F V F+I R+GPA+LL F+ + F  GS+M SV P+ Q+YW++N  MQ +L FGMDLSFPA
Sbjct: 358 FIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPA 417

Query: 446 SSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYL 505
           SSIILSD LPMQYQGMAGSLVNT+INYS SLCLGMG TVE QINK+G+ +L GYR+A+YL
Sbjct: 418 SSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYL 477

Query: 506 GIGLASLGVLISVTYMLETVWNERKK 531
            +GL  LG  ++   +   +W +RK 
Sbjct: 478 AVGLGGLGACVAFLNLCYDLWRKRKS 503

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/520 (55%), Positives = 369/520 (70%), Gaps = 10/520 (1%)

Query: 20  DKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQ 79
           D +S   +   I  TD++V++++             WQDPTYF S  +E  FIGTCMLA 
Sbjct: 34  DVLSDSVKKDQISITDDDVSSISNNS---------KWQDPTYFKSSWQEYTFIGTCMLAN 84

Query: 80  LLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
           LLNQAGQT  L  MNVL+ S  S+   + WLMASF LA+GSFIL+SGR+GDIYGLK   +
Sbjct: 85  LLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFI 144

Query: 140 XXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNL 199
                         +SKY+ N +FFI CRAFQG+G+AF+LPN+MGLVG++Y VGS+RKN+
Sbjct: 145 GGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNI 204

Query: 200 VISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTN 259
           VIS IG   P G  FGG++GGLIV  + +QWPW+F+A  IA FI+++M  YSIPN+VPTN
Sbjct: 205 VISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTN 264

Query: 260 VHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYA 319
           ++ L MDW GS+L VIGLIL NFVWN+API+GW KAYII               YE+K A
Sbjct: 265 IYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKA 324

Query: 320 EVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAI 379
           E PLLP  VTKNRH++ I++++F+GWG+FGIWTFYY +F LNLRH+SP+W G T+FVF I
Sbjct: 325 ESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFII 384

Query: 380 FGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGM 439
           FG++ A  VAF+I ++GP++L C + + F  G+I+FSV   +Q+YW+ +  MQ +L  GM
Sbjct: 385 FGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGM 444

Query: 440 DLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGY 499
           DLSFP SSIILSD LPMQYQGM+GSLVNT+ NY+ SLCLGMG T E Q N  GK+VL+GY
Sbjct: 445 DLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGY 504

Query: 500 RAAVYLGIGLASLGVLISVTYMLETVW-NERKKCQRKSLE 538
           RAA+Y+ IGL +LG   S +YM E +W   RK+ Q +  E
Sbjct: 505 RAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKE 544

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/475 (59%), Positives = 358/475 (75%)

Query: 56  WQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFP 115
           WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SFGSE N+++WLMASFP
Sbjct: 56  WQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFP 115

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           L +GSFILISGRLGDIYGLKKML+              ++KYS +D+FFI  RAFQG+GI
Sbjct: 116 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGI 175

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AF+LPN++G++G++Y  G+ RKN+VIS +GA  P GA  G +F GLI TEDP QWPW FY
Sbjct: 176 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFY 235

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKA 295
           A+ IA FI+ +++ Y+IP+ +PTN+H  SMDW GSVL VIGLIL NFVWN+API+GW++A
Sbjct: 236 AYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQA 295

Query: 296 YIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYY 355
           YII               YEI++A+ PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY
Sbjct: 296 YIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYY 355

Query: 356 VSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMF 415
             FQLN+R Y+ +W GGTYF+F I+G IAA  V F+IK + P++ L F+++AF+ GSIM 
Sbjct: 356 FQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMA 415

Query: 416 SVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 475
           SV PV ++Y++       +L FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS S
Sbjct: 416 SVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMS 475

Query: 476 LCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERK 530
           LCLGMGATVE Q+N  GK++L+GYR A YLGIGLASL  +IS  YM+E+    R+
Sbjct: 476 LCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRR 530

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/475 (60%), Positives = 359/475 (75%)

Query: 56  WQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFP 115
           WQ+P YF    +E +FI TCM++QLLNQAG T  L IMN+LS SFGSE N+++WLMASFP
Sbjct: 59  WQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFP 118

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           L +GSFILISGRLGDIYGLKKML+              ++ YS +D+FFI CRAFQG+GI
Sbjct: 119 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGI 178

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AF+LPN++G++G++Y  G+ RKN+VIS +GA  P GA  G +F GLI TE+PNQWPW FY
Sbjct: 179 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKA 295
           AF IA+ I+  ++ Y+IPNN+PTN+H  SMDW GSVL VIGLIL NFVWN+API+GW +A
Sbjct: 239 AFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQA 298

Query: 296 YIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYY 355
           YII               YE+ +A+ PLLPHAV K+ HMI I+LA+F GWGSFGI+TFYY
Sbjct: 299 YIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYY 358

Query: 356 VSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMF 415
             FQLN+RHY+ +W GGTYF+F I+G IAA  V F+IK + P++ L F+++AF+ GSIM 
Sbjct: 359 FQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMA 418

Query: 416 SVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 475
           SV PV ++Y++       +L FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS S
Sbjct: 419 SVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMS 478

Query: 476 LCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERK 530
           LCLGMGATVE Q++  GK++L+GYR A YLGIGLASL  +IS  YM+E+  N+ K
Sbjct: 479 LCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHK 533

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/477 (59%), Positives = 369/477 (77%)

Query: 55  PWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASF 114
           PWQ+P+YFSS  KE +FI TCML+ LLNQAGQT A   MNV+  +F ++S+++ WLMASF
Sbjct: 68  PWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASF 127

Query: 115 PLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
           PL +GSFIL+SGR+GDIYGLK+ ++               + YS++ +FFI CRAFQG+G
Sbjct: 128 PLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLG 187

Query: 175 IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVF 234
           IAF+LPN+MGLVG++YKVGSLRKN+VIS IG C PTGA FG  + GLI T+   QWPW+F
Sbjct: 188 IAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIF 247

Query: 235 YAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDK 294
           YA+  A  +++++A YSIP+ VP NVHG SMDWTGSV+ VIGLILFNFVWNEAPI GW+K
Sbjct: 248 YAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEK 307

Query: 295 AYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFY 354
           AYII               YEIK+A+ PLLP AVT N ++IMIL A+F+GWGSFGIWTFY
Sbjct: 308 AYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFY 367

Query: 355 YVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIM 414
           Y +F LNLR Y+P+  G ++ +F ++GTIAAF VAF+IKR+GP++LL  +++AF  GSIM
Sbjct: 368 YYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIM 427

Query: 415 FSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSA 474
            S+ PV Q+YWK+ F MQ +L FGMDLSFPASSIILSD LPM+YQGMAGSLVNT++NYS 
Sbjct: 428 LSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYST 487

Query: 475 SLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531
           SLCLGMG T E Q+NK+G ++L+GYRAA+Y+GIGL  +GV+I+  ++ E++  +R +
Sbjct: 488 SLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGR 544

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/484 (57%), Positives = 363/484 (75%)

Query: 56  WQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFP 115
           WQD TYF +  +E +F+GTCM++QLLNQA     L +MN+L+KSF S + NQ WLMASFP
Sbjct: 56  WQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFP 115

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           L +GSFILISGR+GDIYGLK  L+               + Y+++D+FFI  R+FQG+G+
Sbjct: 116 LVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGV 175

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AFILPN+MG VG++YK  + RKN+VIS+IGAC P GA  G  F GLI T++P+ WPW FY
Sbjct: 176 AFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKA 295
           A  IA+ +++L A YSIPN++PTNVHG SMDW GS LAV+GLIL NFVWN+ PI GW KA
Sbjct: 236 AMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKA 295

Query: 296 YIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYY 355
           YII               YE+ YA  PLLP  +T+NRHM+MIL+A+F+GWGSFGI++FYY
Sbjct: 296 YIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYY 355

Query: 356 VSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMF 415
            +F LNLRHYS VW GGTYF+FAI+G +A+  V  SI+++  +++L F+++AFD G IM 
Sbjct: 356 FAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIML 415

Query: 416 SVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 475
           SV PV+Q+Y+++N     +L FGMD+SFPA++IILSD LP QYQGMAGSL NT++NYS S
Sbjct: 416 SVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMS 475

Query: 476 LCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535
           LCLGMG+TVE QIN++GK++L+GYRAA YLGIG+ASL V++S+ YM E +W +RK+    
Sbjct: 476 LCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535

Query: 536 SLEA 539
           + E 
Sbjct: 536 TSET 539

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/500 (56%), Positives = 357/500 (71%)

Query: 35  DEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMN 94
           +EE  T++             WQ+P YF +   E +FI TCM++QLLNQAG T  L IMN
Sbjct: 36  NEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMN 95

Query: 95  VLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXL 154
           +++ SFGS  N++ WLMASFPL +GSFILISGRLGDIYGLKKML               L
Sbjct: 96  IIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155

Query: 155 SKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALF 214
           +KYS +D+FFI  RAFQG+GIAF+LPN++G++G++Y  G+ RKN+VIS++GA  P GA  
Sbjct: 156 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATL 215

Query: 215 GGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAV 274
           G +F GLI T++P QWPW FYA+ I + I++ ++ YSIPNN+PTN+   SMDW GS L V
Sbjct: 216 GCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGV 275

Query: 275 IGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHM 334
           IGL+L NFVWN+API+GWD+AYII               YE ++A+ PLLP AV K+RHM
Sbjct: 276 IGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHM 335

Query: 335 IMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKR 394
           I I+LA+F GWGSFGI+TFYY  FQLN+RHYS VW GGTYF+F I+G IAA  V   IK+
Sbjct: 336 IQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKK 395

Query: 395 LGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGL 454
           + P++ L  ++MAF+ GSIM SV PV ++Y++       +L FGMD SFPASSII SD L
Sbjct: 396 VSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNL 455

Query: 455 PMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGV 514
           PM+YQGMAGSLVNTV+NYS SLCLGMGATVE  ++  GK+VL+GYR A YLGIGLASL  
Sbjct: 456 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLAC 515

Query: 515 LISVTYMLETVWNERKKCQR 534
           +IS  YM+E +  + K   R
Sbjct: 516 IISGLYMVERIIKDHKAKAR 535

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/515 (54%), Positives = 370/515 (71%), Gaps = 2/515 (0%)

Query: 18  VNDKISMKEEDKVIVSTDEE--VTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTC 75
           + ++++++ ED    +  E    T V              WQ+P YF    +E +FI TC
Sbjct: 27  IENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTC 86

Query: 76  MLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135
           M++QLLNQ+G T  L IMN+L+ SFGS++N+++WLMASFPL +GSFILISGR+GDI+GLK
Sbjct: 87  MISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLK 146

Query: 136 KMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSL 195
            ML+              L+KYS +D+FFI  RAFQG+GIAF+LPN++G++G+VY  G+ 
Sbjct: 147 NMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTF 206

Query: 196 RKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNN 255
           RKN+VIS IGA  P GA  G  F GLI T +PNQWPW FYA+ I   I+++++ Y+IPNN
Sbjct: 207 RKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN 266

Query: 256 VPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYE 315
           +PTNVH  SMDW GS L VIGL+L N VWN+API+GW++AYII               YE
Sbjct: 267 IPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYE 326

Query: 316 IKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYF 375
           I +A+ PLLP AV K+RHMI I+L++F GWGSFGI+TFYY  FQLN+RHY+P+W GG+YF
Sbjct: 327 IHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYF 386

Query: 376 VFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVL 435
           +F I+G IAA  V FSIKR+ P++ L FA++AF+ GSIM SV PV ++Y+++      +L
Sbjct: 387 MFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIIL 446

Query: 436 CFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNV 495
            FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMGATVE Q++  GK++
Sbjct: 447 SFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHI 506

Query: 496 LEGYRAAVYLGIGLASLGVLISVTYMLETVWNERK 530
           L+GYR A YLGIGLASL  +IS  YM+E    + +
Sbjct: 507 LKGYRGAQYLGIGLASLACIISGLYMVECYIKDHR 541

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/478 (55%), Positives = 345/478 (72%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ FGSE++ QAWL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
            +GSFIL+ GR GDIYGLKKML+              L+ Y+++D FFI  +AFQG+G++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
           FILPNI+GLVG +Y+ GS++KN+ IS IGA  P GA FGG+F G++V +D   WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           F I +F+  +  ++ +P+NVPTN + L MDW GS + V+GL+LF+FVWN+AP+ GWDKAY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           II               YEI YAEVPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
           SF LNLRH+SPVWTGG YF F + G   A  V F IK + P+++L  ++  F  G+++F+
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V P +Q+YW+  F M  +L  GMDLSFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQR 534
           CLG+  TVE QIN SG ++L+GYRAA Y G+G+ +LG+ I+  YM ET W + K+  +
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/474 (55%), Positives = 343/474 (72%)

Query: 56  WQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFP 115
           +Q+P YF +  +E  FI + M+ QLL+QAG T  L IMNVL+K   S S+ QAWLM+SFP
Sbjct: 62  YQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFP 121

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           LA GSFIL+SGRLGDIYGLKK+L+              LS Y++ND+FFIT RAFQG+G+
Sbjct: 122 LALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGL 181

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AF LPN++GL+G +Y+ G  RKN++IS+IGA  PTGA  GG+F GL V  D + WPW FY
Sbjct: 182 AFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFY 241

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKA 295
           AFG+ +F++++++WY IPN++PTN+HGL MDW GSVL V GLI+ NFV+N+API GW  A
Sbjct: 242 AFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSA 301

Query: 296 YIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYY 355
           YII               YE+KYA+ PL+P A++ NR M+MIL ++F GWGSFGIWTFYY
Sbjct: 302 YIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYY 361

Query: 356 VSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMF 415
            SF+LNLRHYSP+W G +YF+F I G+  A     +IK++ P++L C ++M F  G+I+F
Sbjct: 362 FSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIF 421

Query: 416 SVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSAS 475
           +  PV Q++++       +L  GMD SFPASSIILSD LPMQYQGMAGSLVNTVINYS S
Sbjct: 422 AATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTS 481

Query: 476 LCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNER 529
           +CLGM  TVE + N  GK++L GYRAA+Y  IGLA L V +S  YM+E +W +R
Sbjct: 482 ICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/518 (52%), Positives = 357/518 (68%)

Query: 21  KISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQL 80
           K S + E +  +S ++++ T              PWQDP YF     E++F+ +CM+ QL
Sbjct: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQL 75

Query: 81  LNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMX 140
           LNQAG T  L  M VL +   S S   +WLMASFPL +GSFILISGRLGDIYGLKKML+ 
Sbjct: 76  LNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLL 135

Query: 141 XXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLV 200
                        LS +S+ND+FFIT RAFQG+GI+F+LPN++G+VG++YK G+ RKN+V
Sbjct: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195

Query: 201 ISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNV 260
           IS+IG C P GA FGG+F G++V    + WPW FYA+ IA F++ +++++ IPN++P NV
Sbjct: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNV 255

Query: 261 HGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAE 320
           +  +MDW GS L V GL+LFNFVWN++ + GW   YII               +EIKYA+
Sbjct: 256 NKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAK 315

Query: 321 VPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIF 380
           VPLLP  VT++R +IMIL ++  GWGSFGIW FYY  F L LR+YSPVW GGT+F+ +I 
Sbjct: 316 VPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIV 375

Query: 381 GTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMD 440
           G IAA  V FSIKR+GPA+LL F+++AF  GSI+ SV PV ++Y++       +L FGMD
Sbjct: 376 GCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMD 435

Query: 441 LSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYR 500
           LSFPA+SIILSD L MQYQGMAGSLVNTV+NYS SL LG+G T+E QINKSG  +LEG+R
Sbjct: 436 LSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFR 495

Query: 501 AAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538
           AA+Y  IG+ SLG+LIS  ++L+      K  +   LE
Sbjct: 496 AALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELE 533

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 347/481 (72%), Gaps = 1/481 (0%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           QDPTYFS+  KE +FI   M++QLLNQAG T  L ++N+LSK+F S ++ Q WLMASFPL
Sbjct: 42  QDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPL 101

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
            +GSFIL+SG++GDIYGLKK L+              L+ Y+++  FFI  RAFQG+GIA
Sbjct: 102 VSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIA 161

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
           FILPNIMG+VG++Y  G+ RKN+VIS+IGAC P GA  G +F GLI T    +W W FYA
Sbjct: 162 FILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYA 220

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           + I   I+M ++ + IPN +PTNV G SMDW GS + ++G+ILFNFVWN+ PI GWD AY
Sbjct: 221 YTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAY 280

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           II               YE KYA  PL+P     N  ++M LLAVF GWGSFGIWTFYY 
Sbjct: 281 IIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYF 340

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
            F LNLR Y+P+W GG+YF+F I+G IAA  V ++IKR+ P+L+L  +++AFD G IM S
Sbjct: 341 CFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLS 400

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V PV+Q+Y+++   M  +L FGMDLSFPASSIILSD LPM+ QGMAGSLV+T+INYS S+
Sbjct: 401 VTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSM 460

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKS 536
           CLG+  TVEHQINK+G ++L+GYRAA+YLGIGLASLGV IS  +MLE     R++  ++ 
Sbjct: 461 CLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

Query: 537 L 537
           +
Sbjct: 521 V 521

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/482 (54%), Positives = 341/482 (70%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           ++P YF+S  +E  FI +CML+QLLN AG T  L IMNVL++   S  + + WL+ASFPL
Sbjct: 43  RNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPL 102

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
            +GSFIL+SGRLGDIYGLKKML+              LS YS++  FFI  RAFQG+GI+
Sbjct: 103 VSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGIS 162

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
            +LPN++GL+G +YK G+L+KN+VIS++GA  P GA  GG+F GL+ TE    WPW FYA
Sbjct: 163 LVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYA 222

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           + +A FI+  +++YSIPNN+PTNV+ LSMDW GS   V+GLILFNFVWN+AP  GW+ AY
Sbjct: 223 YTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAY 282

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           +I               YE++YAE PLLP  + +NR +IMIL A+  GWGSFGIWTFYY 
Sbjct: 283 LIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYF 342

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
           SF LNLR+YSP+W GG+YF+F I GTI A    F +K++ PA+LL F+++ F+ G I+FS
Sbjct: 343 SFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFS 402

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V PV Q+Y++       +L  GMDLSFPASSIILSD LP Q+QGMAGSLVNTVINYS SL
Sbjct: 403 VTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSL 462

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKS 536
            LG+  TVE   NK+G ++L GYR A+Y GI  + + VLI+  YM+ET+++  K  + K 
Sbjct: 463 FLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

Query: 537 LE 538
            E
Sbjct: 523 CE 524

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/475 (54%), Positives = 342/475 (72%), Gaps = 1/475 (0%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q+P YF    KE +F+ + ML+QLLNQA    A  + ++LS+   ++++ QAWLMASFPL
Sbjct: 39  QNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPL 98

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
            +GSFIL+SG++GDIYGLKK L+              LS Y++N  FFI  R+FQG+GIA
Sbjct: 99  VSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIA 158

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
           F+LPN+ G+VG++YK  +  KN+V S+IGAC P GA  G +F GLI TE    W W FYA
Sbjct: 159 FVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYA 217

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           + I   ++ L+AWY IP+N+PTNVH   MDW GS L V GLI+FNFVWN+AP  GWD AY
Sbjct: 218 YTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAY 277

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           II               +E ++A+ PLLP AV  NR ++MIL ++F+GWGSFGIWT+YY+
Sbjct: 278 IIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYM 337

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
           +F LNLRHY+P+W GG+YF+FAIFGTIAAF V  +I + GPA++L  +++AFD G IM S
Sbjct: 338 AFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLS 397

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V PV+Q+Y++++     +L FGMDLSFPASSIILSD LP QYQGMAGSLVNT+INYS SL
Sbjct: 398 VTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSL 457

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531
           CLG+  T E Q+NK G ++L+GYRAA+Y+GIGLAS+G+ +S  Y +E  W  R++
Sbjct: 458 CLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRE 512

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/475 (54%), Positives = 343/475 (72%), Gaps = 1/475 (0%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q+P YF    KE +F+ + ML+QLLNQA  T    + +VLSK   ++ + Q WLMASFPL
Sbjct: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
            +GSFIL+SG++GDIYGLKK L+              LS Y++N  FF+  R+FQG+GIA
Sbjct: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
           F+LPN+MG+VG++YK  +  KNLV S+IGAC P GA  G VF GLI     + W W FYA
Sbjct: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYA 217

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           + I   ++ L+A + IPNN+PTNV+   MDW GS + V GLILFNFVWN+APIAGW  AY
Sbjct: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           II               YEI++A+ PLLPH+V  NR ++MIL ++F GWGSFGIWTFYY+
Sbjct: 278 IIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
           SF LNLRHYSP+W GGTYF+FAI+G +A+  V ++I + GPA++L  +++AFD G IM +
Sbjct: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V PV Q+Y+++   +  +L FGMDLSFPA+SIILSD LP QYQGMAGSLV+T+I+YS SL
Sbjct: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531
           CLG+  T EHQ+NK+G ++L+GY+AA+Y+GIGLASLGV+IS  +M+E  W  R+K
Sbjct: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRK 512

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 341/483 (70%), Gaps = 1/483 (0%)

Query: 56  WQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFP 115
           WQ+P YF S  KE +F+ +C ++QLLNQAG      IMN+++ S  S++  QAWLMA+FP
Sbjct: 50  WQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFP 109

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           L +GSFILISGR+GDIYGLKK L+              L+KY+++DSFFI  RAFQG+GI
Sbjct: 110 LISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGI 169

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           + ILPNI+G+VG +Y  GS RKN+VIS+IG   P GA  G VF GLI TED NQWPW FY
Sbjct: 170 SLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFY 229

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKA 295
           ++ I   I+ +++ + IPN +PTNVHG  MDW GS L V+GLI+ NFVWN+API GWD A
Sbjct: 230 SYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSA 289

Query: 296 YIIXXXXXXXXXXXXXXXYEIKYAE-VPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFY 354
           Y+I               YE+ +    PLLP  V K+   I++L A+F GWGSFGI++FY
Sbjct: 290 YLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFY 349

Query: 355 YVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIM 414
           Y +FQLNLRHY+P+W GGTYF+F I+G +AA  V F+IK++ P+++L  +++AF+ GSI+
Sbjct: 350 YFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSII 409

Query: 415 FSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSA 474
            SV P+ Q+Y++ +  M  +L FGMDLSFPASSI+LSD LP+QYQGMAGSLVNT++NYS 
Sbjct: 410 MSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSM 469

Query: 475 SLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQR 534
           S CLG+   VE  +N  GK+VL+GYR A YLGIGLAS+  +IS   ML  +   RK  + 
Sbjct: 470 SFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKD 529

Query: 535 KSL 537
            ++
Sbjct: 530 SAV 532

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/482 (54%), Positives = 334/482 (69%), Gaps = 4/482 (0%)

Query: 23  SMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQLLN 82
           S+KE  +  +S D+     +             WQDP YF +  +E +F+G+CM  QLLN
Sbjct: 8   SIKEHIQSDISIDKS----SNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLN 63

Query: 83  QAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXX 142
           QA     L IMNVLS SF S  +NQ WL+ASFPL AGSFILISGR+GDIYGLKK L+   
Sbjct: 64  QATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGY 123

Query: 143 XXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVIS 202
                       + YS +D+F I  RAFQG+GIAF LPN++G +G++Y VGSLRKN+VIS
Sbjct: 124 IFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVIS 183

Query: 203 VIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHG 262
           +I A  P GA  GG F GLIVTE P+QWPW FYAF IA   ++L++ YSIP+N+PTNV+G
Sbjct: 184 LIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNG 243

Query: 263 LSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVP 322
             MDW GS L V GLILFNF WN+ PI GWD AYII               YEI +A  P
Sbjct: 244 FKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSP 303

Query: 323 LLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGT 382
           L+   +T +R+MI+ +  +F+GWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG 
Sbjct: 304 LIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGV 363

Query: 383 IAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLS 442
           +A+ FV  SIK++   ++L F+++ F  G+ + SV PV+QSY+KL  A  A+L  G+D S
Sbjct: 364 LASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTS 423

Query: 443 FPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAA 502
           FPA++IILSDGLPM+YQGMAGSL  T++NYS SLCLGMG TVE QINK G++VL+GYR+A
Sbjct: 424 FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483

Query: 503 VY 504
            Y
Sbjct: 484 EY 485

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  516 bits (1330), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 244/486 (50%), Positives = 337/486 (69%), Gaps = 4/486 (0%)

Query: 58  DPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLA 117
            P YF +   E +FI +CM++Q ++QAG T AL IMN+L++   +E + QAWLMASF L+
Sbjct: 88  SPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLS 147

Query: 118 AGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAF 177
            GSFIL+SGRLGDIYGLKK+L+               S YS+ND+FFIT RAFQG+G+AF
Sbjct: 148 MGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAF 207

Query: 178 ILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAF 237
           +LPN +GL+G +Y+ GS++KN++I  +GA  P GA  GG+F G+I T+DP QWPW FY+F
Sbjct: 208 VLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSF 267

Query: 238 GIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYI 297
           GI +F +M+++WYSIPNN+PTN++ LSMDW G++L + GL++ NFV+N+API GW  AYI
Sbjct: 268 GIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYI 327

Query: 298 IXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVS 357
           I               YE+KYA+ PL+P A++ NR M+MIL A+F GWG+FG WTFYY S
Sbjct: 328 IVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFS 387

Query: 358 FQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSV 417
           F LN+R Y+  W GG+YF+F + G   A    F +K++ P+++L  +++ F  G +M +V
Sbjct: 388 FVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTV 447

Query: 418 LPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 477
            P+ QSY++    +  VL  G+DLSFPA+SIILSD LP+QYQGMAGSLV T+ NYS S+C
Sbjct: 448 TPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSIC 507

Query: 478 LGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYM---LETVWNERKKCQR 534
           LGM  +VE   N +G+N+L+GYR A+     LA LG+++S  YM   L T+    K   +
Sbjct: 508 LGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK 567

Query: 535 -KSLEA 539
            K LE 
Sbjct: 568 PKHLET 573

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  416 bits (1070), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 197/480 (41%), Positives = 291/480 (60%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           + P  F +  +E  F+   ++ Q L+Q G T  L  MN+L++   +    Q WLMA+FPL
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPL 170

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
             G  ILISGRLGDI+GLKK+L+               S Y+++D  FI  R FQG+G+A
Sbjct: 171 GLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLA 230

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236
             LPN+  L+G +YK    +KN++  +IGA  P GA  GG+F GL V  +   WPW FY+
Sbjct: 231 CALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYS 290

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296
           F I  F++ ++AW+ IPN++  N  GL MDW GS L + GL++ NFV+N+ PI GW  AY
Sbjct: 291 FAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAY 350

Query: 297 IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356
           +I               YE+  A  PL+P  +  N  +I+ILL +F GWG F IWTFYY 
Sbjct: 351 LIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYF 410

Query: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416
           +FQLNLRHYSP+W   + FV  I GTI       +++R+ P +LL F+++ F  G+I+F+
Sbjct: 411 AFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFA 470

Query: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476
           V P+ Q++++  F    +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  INY+ S+
Sbjct: 471 VTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSI 530

Query: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKS 536
           C+GM  +     N  G+++L G+RAA YL IGL+   V +S  YM+ ++W +R +  +++
Sbjct: 531 CVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKEN 590

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  332 bits (852), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/478 (38%), Positives = 268/478 (56%), Gaps = 17/478 (3%)

Query: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126
           E  F+G    AQL+ QAG   +L  ++++ KSFG+ +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 127 RLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186
           RLGDI+G KK  +               S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
           G  YK G  RKN+V S+ GAC P G + G VF  L+       WPW ++  GIA F   +
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218

Query: 247 MAWYSIPNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
             ++ IP+    + H  S      +D+ GSV  VIGLILFNF WN+ P+ GW   Y    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 301 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420
           + R  +P+ +   +   A+ G  AA    + + R  P+ ++ FA+ AF AG+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
            Q+YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538
             T+E  +N  G   L+GYR + Y+GIGL+ LG+ ++  Y     W+  KK ++++ E
Sbjct: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIY----AWSTFKKSKKRTSE 510

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/475 (38%), Positives = 263/475 (55%), Gaps = 13/475 (2%)

Query: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126
           E  F+G    AQL+ QAG   +L  ++++  SFG+ +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 127 RLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186
           RLGDI+G KK  +               S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
           G  YK G  RKN+V S+ GA  P G + G VF  ++       WPW ++  GIA F+  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 247 MAWYSIPNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
             +Y IP+    N    S      +D+ GSV  V+GLILFNF WN+ P+ GW   Y    
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 301 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420
           + R  +P+ +   +   AI G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
            Q+YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535
             T+E  +N  G NVL+GYR + YLGIGL+  G+ ++ TY + T    +K+   K
Sbjct: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/475 (37%), Positives = 261/475 (54%), Gaps = 13/475 (2%)

Query: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126
           E  F+G    AQL+ QAG   +L  ++++  SFG+ +  Q +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 127 RLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186
           RLGDI+G KK  +               S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
           G  YK G  RKN+V S+ GA  P G   G VF  ++       WPW ++  GIA F+  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217

Query: 247 MAWYSIPNNVPTNVHGLS------MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
             ++ IP+    +    S      +D+ GSV  V+GLILFNF WN+ P+ GW   Y    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 301 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 335

Query: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420
           + R  +P+ +   +   AI G  AA    F +    P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
            Q+YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535
             T+E ++N  G   L+GYR + Y+GIGL+ LG+ ++ TY   T    +K+   K
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEK 510

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/475 (37%), Positives = 261/475 (54%), Gaps = 13/475 (2%)

Query: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126
           E  F+G    AQL+ QAG   ++  ++++  SFG+ +  Q +W  +S+ L  G+FILI+G
Sbjct: 43  EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAG 102

Query: 127 RLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186
           RLGDI+G +K  +               S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHRKFFILGFFWYALWSLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
           G  YK G  RKN+V S+ GA  P G + G VF  ++       WPW ++  GIA F+  +
Sbjct: 162 GRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAV 218

Query: 247 MAWYSIPN------NVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
             ++ IP+      + P+      +D+ GSV  VIGLILFNF WN+ P+ GW+  Y    
Sbjct: 219 AGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVL 278

Query: 301 XXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQL 360
                         E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLGVFVFIESR-AAYPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFME 336

Query: 361 NLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV 420
             R  SP+ +   +   AI G  AA    F +     + ++ FA+ AF  G I+ +  PV
Sbjct: 337 ESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPV 396

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
            Q+YW   F    V+ +GMD+SFPA++I+LS+ +P ++QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 481 GATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535
             T+E Q+N  G N L+GYR + Y+GIGL+ LG+ ++  Y   T    +KK   K
Sbjct: 457 AGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEK 511

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  310 bits (794), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/474 (38%), Positives = 257/474 (54%), Gaps = 12/474 (2%)

Query: 68  ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFILISG 126
           E  F+G    AQL+ QAG   ++  ++++  SFG+ +  Q +W  A++ L  G+FILI+G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 127 RLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLV 186
           RLGD+YG KK  +               S YSN   FF  CRAFQG+G A +LPN + ++
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGIGPALLLPNAIAIL 163

Query: 187 GHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
           G  Y  G  RK +++S+ GA  P G + G VF  +        WPW ++A GI  F   +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIF--GQLTWWPWAYWAMGIVCFFLAV 220

Query: 247 MAWYSIPN----NVPTNVHGLS-MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXX 301
                IP      + T+V     +D  GSV  VIGL+L NF WN+ P+ GW   Y     
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 302 XXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLN 361
                        E + A  PLLP +   +     +L  V  GW SFGIW +Y+  F   
Sbjct: 281 IVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 362 LRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVE 421
           LR +SP+ T   +   AI G  AA    F I R+  +L++ FA+ AF  G I+ +  PV+
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 422 QSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 481
           Q YW   F    V+ +GMD+SFPA++I+LSD +P ++QG+A SLVN V+NYS S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 482 ATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRK 535
            TVE ++N  G N+L+GYR A Y+GIGL+  G+LI+  Y   T    +K    K
Sbjct: 459 GTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  304 bits (778), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/481 (35%), Positives = 256/481 (53%), Gaps = 16/481 (3%)

Query: 64  SFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFPLAAGSFI 122
           S  +E +F+G    AQL+ QAG   ++  + ++  SFG  +  Q +W  A++ L  G+FI
Sbjct: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94

Query: 123 LISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNI 182
           LI+GRLGD++G KK+ +               S YSN   FF  CRA QG+G AF+LPN 
Sbjct: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQI-FFDCCRALQGIGPAFLLPNS 153

Query: 183 MGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATF 242
           + ++G  Y  G  RK +V S+ GA  P G + G VF  +        WPW ++A G A  
Sbjct: 154 IAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACL 210

Query: 243 ISMLMAWYSIPNNVPTNVH---GL--SMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYI 297
           +  +     IP   P  +    G+   +D  G+   ++GL L NF WN+ P+ GW   Y 
Sbjct: 211 VLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYT 270

Query: 298 IXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVS 357
                            E + A  PLLP A      +  +L  +  GW SFGIW FY+  
Sbjct: 271 YALLIVGFVFLLVFSLIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQ 328

Query: 358 FQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSV 417
           F  + R  SP+ T   +   AI G  AA    + +  +    ++  A++AF  G ++ + 
Sbjct: 329 FLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVAT 388

Query: 418 LPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLC 477
            P+ Q+YW   F    ++ +GMD+SFPA++I++S+ +P ++QG+A SLVNTV+NYS SL 
Sbjct: 389 APINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLA 448

Query: 478 LGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSL 537
           LG   T+E ++N  G N LEGYR A Y+GIGL+ LGVL+++ Y     W+  KK + + L
Sbjct: 449 LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVY----AWSTLKKFKEEQL 504

Query: 538 E 538
            
Sbjct: 505 S 505

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  296 bits (758), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 177/486 (36%), Positives = 267/486 (54%), Gaps = 14/486 (2%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ-AWLMASFP 115
           Q+   ++S  KE   I     AQL+ QAG   ++  + ++  SFG ++  Q +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
           L  G+FILI+GRLGD +G KK  +               S YSN   FF  CRAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIGP 136

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AF LPN + ++   Y+ G  ++N++ S+ GAC P+G + G VF  L+   +   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGL-----SMDWTGSVLAVIGLILFNFVWNEAPIA 290
             GI  F+  +  +  IP++ P +          +D  GSV  V+GLILFNF WN+ P+ 
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 291 GWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTK-NRHMIMILLAVFVGWGSFG 349
           GW+ +Y                  E + A+ PLLP  V K +   I ++  +  GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310

Query: 350 IWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFD 409
           IW +Y      NLR   P+ +   +   AI G  AA    F + R  P+ ++  A++AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 410 AGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 469
            GSI+ + +PV Q+YW   F    V+ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 470 INYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNER 529
           INYS S+ LG   T+E QI+    ++L+GYR A Y+GIGLA LG+ ++++Y +      +
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFHYSRLK 490

Query: 530 KKCQRK 535
           +    K
Sbjct: 491 RSLSEK 496

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  273 bits (698), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/502 (32%), Positives = 260/502 (51%), Gaps = 17/502 (3%)

Query: 20  DKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMFIGTCMLAQ 79
           +K   KE+  V  S   E +                W   + F    KE  F+ T ++AQ
Sbjct: 2   NKKHDKEDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQ 61

Query: 80  LLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
             NQAG T  L ++NVLS SF  +     +L+ S+P+  GSF+LI GRLG+++G K+ L+
Sbjct: 62  AFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLL 116

Query: 140 XXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYK--VGSLRK 197
                         LS+YS +  F++ CRAFQGVG+A ILPN      + Y+    + RK
Sbjct: 117 GGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRK 176

Query: 198 NLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVP 257
            ++ ++IG    TGA  G    G+ VT   + W W +Y + IA  +++ +++YS+P+N+ 
Sbjct: 177 TILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNIT 236

Query: 258 TN----VHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXXXXXXX 313
                 ++GL   W  +     GL++ N   N A +A  + ++II               
Sbjct: 237 KKNKPCLNGL--GWFSN--RSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLV 292

Query: 314 YEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 373
           +E+K++E P+    +  N  + ++L ++F GWG++GIW+ Y+  F LNLR+YSP+  G T
Sbjct: 293 FELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGST 352

Query: 374 YFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQA 433
           Y    I G +A   ++  +KR GP L L F+ + F    I+ SV P+ QSY++       
Sbjct: 353 YLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMI 412

Query: 434 VLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGK 493
            L  G+D SFP+S+IIL + LP +Y  M   L N + NY+ S   G+  +    +  S  
Sbjct: 413 FLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSL--SSI 470

Query: 494 NVLEGYRAAVYLGIGLASLGVL 515
            +++ YR   Y  IGL+++G+ 
Sbjct: 471 ELIKYYRYVYYFAIGLSAIGLF 492

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  193 bits (490), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 229/474 (48%), Gaps = 19/474 (4%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFG-SESNNQAWLMASFP 115
           ++ T   S   E++F+     +Q+L  AG    +  M+V+ + F  +  ++  W    + 
Sbjct: 67  EEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYA 126

Query: 116 LAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGI 175
              GSF+LI+G++GD+ G K M +               S+Y  +  FF  CRA QG+G 
Sbjct: 127 TTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGA 186

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           AF   + + ++G  Y     RKN + S  GACG  G + G VF  L        W W ++
Sbjct: 187 AFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFT--QLAHWSWAYW 243

Query: 236 AFGIATFISMLMAWYSIPNNVPTNVHGLS----MDWTGSVLAVIGLILFNFVWNEAPIAG 291
           +  IA  + ++++ + IP +V    H  S     D+ G+ L V GL+LF+  WN+AP  G
Sbjct: 244 SMAIACVVIIILSIFFIPGDV-VEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYG 302

Query: 292 WDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLP-HAVTKNRHMIMILLAVFVGWGSFGI 350
           + + Y+                 E K  + PLLP   ++ N   + +LLA+F  + SF +
Sbjct: 303 FGRTYVYVLLIVSVVILALAMYVETKVDD-PLLPWTHISANT--LKVLLAIFFAYASFTM 359

Query: 351 WTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIK-RLGPALLLCFALMAFD 409
           W  Y   F L  +  + +         A+ G  AA F A  +   +   + +  +L+AF 
Sbjct: 360 WAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFL 419

Query: 410 AGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTV 469
              I+ + +   Q+YW   F    V+ FG+D+SFP+++++LS+ +P +++G+  SLV  V
Sbjct: 420 VPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAV 479

Query: 470 INYSASLCLGMGATV-EHQ----INKSGKNVLEGYRAAVYLGIGLASLGVLISV 518
           +NY+ +L     A+V  +Q    +   G    +      Y+GIG A LG L+++
Sbjct: 480 LNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAI 533

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  171 bits (432), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 129/483 (26%), Positives = 226/483 (46%), Gaps = 18/483 (3%)

Query: 67  KELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQ---AWLMASFPLAAGSFIL 123
           KE++ +      Q ++  G    +  M  ++ +F    +      W  A++   A +F++
Sbjct: 47  KEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVI 106

Query: 124 ISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSN-NDSFFITCRAFQGVGIAFILPNI 182
           I+G+LGDI G K M +               SKY+  N  FF  CR  QG+G AF+ P  
Sbjct: 107 IAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTG 166

Query: 183 MGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATF 242
           + L+G  Y     RKN V S  GACGP G + G VF  L        W W +++  +   
Sbjct: 167 LALLGKHYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALFT--QLTTWAWTYWSMAVTCL 223

Query: 243 ISMLMAWYSIP-NNVPTNVHG--LSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIX 299
           I  ++++  IP +N P        S D+ G    + G+ILF+ VWN+AP++ +   Y+  
Sbjct: 224 IITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYS 283

Query: 300 XXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359
                          + +  + PL+P   +   ++I  L+ VF G+  F IW FY   F 
Sbjct: 284 LLIVSVVFMTMALIIDSRVKD-PLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFY 341

Query: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPA-LLLCFALMAFDAGSIMFSVL 418
           L  ++ S +     +    I G  AA F    + +  P  L L  A+ AF   +I+ S +
Sbjct: 342 LVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTM 401

Query: 419 PVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCL 478
            ++++YW   F    ++  G+D++FP+++++LS+G+  + QG+A +L  T +NY  +L  
Sbjct: 402 TLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGP 461

Query: 479 GMGATV-----EHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQ 533
           G+   +     +  + +S    +     A Y+ IG A + V++++   +   + ER    
Sbjct: 462 GVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDL 521

Query: 534 RKS 536
           R+ 
Sbjct: 522 REK 524

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  137 bits (344), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 108/190 (56%), Gaps = 34/190 (17%)

Query: 76  MLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135
           M++QLLNQ G T  L ++NVLS+ F S +  Q  L+AS PL +GSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 136 KMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSL 195
             L+              L++Y+ +  FF+  RAFQG+G+AF+LPN+MG V +VY  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 196 RKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNN 255
           RKN+V                                  YA+ +A  ++M +  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 256 VPTNVHGLSM 265
           +PTNV G +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 454 LPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVL 496
           +P   +G A      ++ YS  +CLG+  TVEH+++K G + L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 136/557 (24%), Positives = 242/557 (43%), Gaps = 41/557 (7%)

Query: 6   ERKMSVQGTSS-----PVNDKISMKEEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPT 60
           +R + +Q T +     P N   S     +    T E+ + +             P   P+
Sbjct: 12  DRTLKIQDTGNTDHYLPSNSTASSLHSQR----TKEQCSNLQPAQAQDQLESMNPPPGPS 67

Query: 61  YFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSF---GSESNNQAWLMASFPLA 117
                 +E MFI     +Q ++ A  + A+  M+ ++  F      S    W  A+F + 
Sbjct: 68  RL----RECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAIT 123

Query: 118 AGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYS--NNDSFFITCRAFQGVGI 175
            G+FI+ +G+L D+ G K + +              +S+Y+     +FF   R  QG+G 
Sbjct: 124 CGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGA 183

Query: 176 AFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           A + P+ + L+G  Y   S +KN+V S+ G C P G + GGVF  +        W W ++
Sbjct: 184 AALFPSSLALLGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSAIFT--QLAHWSWNYW 240

Query: 236 AFGIAT-FISMLMAWYSIPNNVPTN---------VHGLSMDWTGSVLAVIGLILFNFVWN 285
           +  I + F +++  +Y  P+ +  +          H    D+ G+ L V  L+LF   WN
Sbjct: 241 SMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWN 300

Query: 286 EAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGW 345
           +A    +    +                 E  Y + P++P A   +   I  LL VF  +
Sbjct: 301 QATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTIKALLVVFFSY 358

Query: 346 GSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFA- 404
            SF IW FY   +   +R+ + +     +   +I G IAA F    I    P  +   A 
Sbjct: 359 LSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAG 418

Query: 405 LMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGS 464
             +F    I+F  L   +SYW   F    ++  G+D+SFP+++++LS+G+P + +G++ +
Sbjct: 419 ACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAA 478

Query: 465 LVNTVINYSASLCLGMGAT-VEHQINK---SG--KNVLEGYRAAVYLGIGLASLGVLISV 518
           LV T +NY   +   +  T + +Q +K   SG     ++    A  +GIG + + V++ +
Sbjct: 479 LVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVVGL 538

Query: 519 T-YMLETVWNERKKCQR 534
              + E  W      +R
Sbjct: 539 YGTVTEYSWETHSYSKR 555

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 127/551 (23%), Positives = 234/551 (42%), Gaps = 81/551 (14%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFG---SESNNQAWLMAS 113
           Q PT  +S+  +++FI     +Q +  A  + A+  M+ LS  F    + +    W+ AS
Sbjct: 62  QSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNAS 119

Query: 114 FPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKY-SNNDSFFITCRAFQG 172
           F +  G+FI+++G+L DI   + + +               + Y   N  F   CR  QG
Sbjct: 120 FAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQG 179

Query: 173 VGIAFILPNIMGLVGHVYKV---------------------GSLRKNL------------ 199
           +G A + P+ + L+   Y V                       + KNL            
Sbjct: 180 IGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSI 239

Query: 200 -------------VISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISML 246
                          S+ GAC P G + GG+F  +        WPW +++  I T +  +
Sbjct: 240 ADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTLLSI 297

Query: 247 MAWYSIPNNVP-----TNVHGL----SMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYI 297
           ++++ +   +P     +N + L    + D+ G +L +  LILF   W++A +  +   ++
Sbjct: 298 LSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHV 357

Query: 298 IXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRH--MIMILLAVFVGWGSFGIWTFYY 355
                           +E  Y   P++P    +  H   I  LL VF  + SF  W FY 
Sbjct: 358 YLTLLFSLVSFIAMIIWE-YYFNNPIIP---IRQIHPGTIKALLVVFFSYISFTQWLFYT 413

Query: 356 VSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFF-VAFSIKRLGPALLLCFALMAFDAGSIM 414
                 ++  SP+     +   ++ G I+A F +   +KR+   + L     +F    I+
Sbjct: 414 WKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHIL 473

Query: 415 FSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSA 474
                ++ SYW   F     +  G+D+SFP+++++L++G+P + QG+  +LV +V+NY  
Sbjct: 474 LLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGT 533

Query: 475 SLCLGMGAT-VEHQIN------KSGKNVLEGYRAAVYLGIGLASLGVLISVT-YMLETVW 526
           ++   +  T +++Q           K  L+G   A  +G+G + + VLI +   + E  W
Sbjct: 534 AIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLIGIYGTITEYSW 593

Query: 527 NER---KKCQR 534
             +   KKC +
Sbjct: 594 KTKGFSKKCIK 604

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  136 bits (343), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 116/484 (23%), Positives = 212/484 (43%), Gaps = 25/484 (5%)

Query: 67  KELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQA---WLMASFPLAAGSFIL 123
           +E+  +   + +QL+   G    + I   L + +  E        W  AS+ L +   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 124 ISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSN-NDSFFITCRAFQGVGIAFILPNI 182
           I+G+LGD+ G K+M++               S Y   N +F+ T RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 183 MGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATF 242
           + ++G  Y    L+K ++ S+ G    TG + G  F  L       +W W ++A      
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLF--AQLTKWAWNYWALACVCV 214

Query: 243 ISMLMAWYSIPNNVPTN-VHGLS-------MDWTGSVLAVIGLILFNFVWNEAPIAGWDK 294
           +  + A   IP   P N VH  +        D+ G++  V GL+LF+  + +A   GW  
Sbjct: 215 LYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSP 271

Query: 295 AYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFY 354
            +                  + +  + PL+P    +   +++IL+ V+ G+ SF IW  +
Sbjct: 272 PHTYITLIIGVILILIAMFVDWRVDD-PLVPLQHLR-ADVVVILICVYFGFLSFVIWANW 329

Query: 355 YVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIK-RLGPALLLCFALMAFDAGSI 413
           +  F   + + SP+         AI    AA F    ++  +    ++  +++ F   +I
Sbjct: 330 FWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNI 389

Query: 414 MFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYS 473
           + + +    +YW   F    +  F +D++ P ++++ SD +  + QG+A SL+ TVI+Y+
Sbjct: 390 LMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYA 449

Query: 474 ASLCLGMGATVEHQINKSGKNVLEG-----YRAAVYLGIGLASLGVLISVTYMLETVWNE 528
            S+     A V   +   G +   G       +    GI L+ +G++ +V   L      
Sbjct: 450 ISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGLIDYKIT 509

Query: 529 RKKC 532
           R  C
Sbjct: 510 RTHC 513

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 109/529 (20%), Positives = 197/529 (37%), Gaps = 64/529 (12%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q  TY  +    L+F+G      LLN A     + +++ L++ +       +W + S+ +
Sbjct: 21  QKSTYQLNVNVALIFLGCTF--DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAV 75

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
               FI   GRLGDI G   +                L     N   F   RA QG+  A
Sbjct: 76  TFAGFIAFMGRLGDIVGNSILF---TVSCFFFAILSLLCAVMPNFPAFAVFRAIQGISAA 132

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPT-----GALFGGVFGGLIVTEDPNQWP 231
            ++P    L+  +     ++K   I    +CG +     G + GG F    +      + 
Sbjct: 133 GLVPCAYALIPMLAPEEEVQKYFSIV---SCGFSSTIGLGLIIGGAFAATKI-----GYK 184

Query: 232 WVFY-AFGIATFISMLMAWYSI--------PNNVPTNVHGLSMDWTGSVLAVIGLILFNF 282
            +FY  F +   IS++  +++         P          S+D+ GS++ V G IL   
Sbjct: 185 GIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVV 244

Query: 283 VWNEAPIAGWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVP-------------------L 323
              E     W++                   +   YA +                    L
Sbjct: 245 GLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKVQLL 303

Query: 324 LPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTI 383
           +P  V   ++ I I+LA  +         +    +       SP++ G       I   I
Sbjct: 304 IPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVI 363

Query: 384 AAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPV--EQSYWKLNFAMQAVLCFGMDL 441
                AF   +L P + +        AGSI+ + L +  E  +WK+ F+ QA++ FG+ +
Sbjct: 364 GNGLCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAI 423

Query: 442 SFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQIN----KSG--KNV 495
            +P +  I   G P + +G+A  +  T       +   + A+V   I+    KSG  +  
Sbjct: 424 FYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKF 483

Query: 496 LEGYRAAVYLGIGLASLGVLISVTYMLET------VWNERKKCQRKSLE 538
             G++   Y  + + +LG L+++  + +T      + +     QR  +E
Sbjct: 484 RTGFQNCTYFTVAVGALGFLVTLFGLKDTRPPTDDISDVESSIQRTKVE 532

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/484 (20%), Positives = 177/484 (36%), Gaps = 46/484 (9%)

Query: 69  LMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRL 128
           L+F+G      LLN A     + +++ L+K++       +W + S+ +    FI   GRL
Sbjct: 33  LIFLGCTF--DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRL 87

Query: 129 GDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGH 188
           GDI G   +                L     N   F   RA QG+  A ++P    L+  
Sbjct: 88  GDIIGNSVLF---TISCSCFAVLSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPI 144

Query: 189 VYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMA 248
           +     ++K   I   G     G   G + GG   T         +  F + T IS++  
Sbjct: 145 LAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAF 202

Query: 249 WYSI--------PNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
           +++         P     +    S+D+ GS++ V G IL      E     W++      
Sbjct: 203 FFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVT 261

Query: 301 XXXXXXXXXXXXXYEIKYAEVP-------------------LLPHAVTKNRHMIMILLAV 341
                        +   Y ++                    L+P  V   ++ I I+LA 
Sbjct: 262 LVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAF 321

Query: 342 FVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLL 401
            +         +    +       SP+  G       I   I     AF   +L P + +
Sbjct: 322 ALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGV 381

Query: 402 CFALMAFDAGSIMFSVLPV--EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQ 459
                   AGSI+   L +  E  +WK+ F+ QA++ FG+ + +P +  I   G P + +
Sbjct: 382 AIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESR 441

Query: 460 GMAGSLVNTVINYSASLCLGMGATVEHQIN--KSGKNVLEGYRAAV----YLGIGLASLG 513
           G+A  +  T       +   + A+V   IN  K   N ++ +R       Y  + + +LG
Sbjct: 442 GIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALG 501

Query: 514 VLIS 517
            L++
Sbjct: 502 FLVT 505

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 100/484 (20%), Positives = 177/484 (36%), Gaps = 46/484 (9%)

Query: 69  LMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRL 128
           L+F+G      LLN A     + +++ L+K +       +W + S+ +    FI   GRL
Sbjct: 33  LIFLGCTF--DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRL 87

Query: 129 GDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGH 188
           GDI G   +                L     N   F   RA QG+  A ++P    L+  
Sbjct: 88  GDIVGNSVLF---TISCSCFAILSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPI 144

Query: 189 VYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMA 248
           +     ++K   I   G     G   G + GG             +  F + + IS++  
Sbjct: 145 LAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAF 202

Query: 249 WYSI--------PNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXX 300
           +++         P  +       S+D+ GS++ V G IL      E     W++      
Sbjct: 203 FFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVT 261

Query: 301 XXXXXXXXXXXXXYEIKYAEVP-------------------LLPHAVTKNRHMIMILLAV 341
                        +   YA++                    L+P  V   ++ I I+LA 
Sbjct: 262 LIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAF 321

Query: 342 FVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLL 401
            +         +    +       SP+  G       I   +     AF   +L P + +
Sbjct: 322 ALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGV 381

Query: 402 CFALMAFDAGSIMFSVLPV--EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQ 459
                   AGSI+   L +  +  +WK+ F+ QA++ FG+ + +P +  I   G P Q +
Sbjct: 382 ALGFSLALAGSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSK 441

Query: 460 GMAGSLVNTVINYSASLCLGMGATVEHQINK-SGK-----NVLEGYRAAVYLGIGLASLG 513
           G+A  +  T       +   + A+V   IN+  GK     N   G++   Y  + + +LG
Sbjct: 442 GIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALG 501

Query: 514 VLIS 517
            L++
Sbjct: 502 FLVT 505

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 95/445 (21%), Positives = 170/445 (38%), Gaps = 46/445 (10%)

Query: 87  THALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXX 146
           T  L     +  ++  E    +W + ++ +    FI   GR+GDI G   + +       
Sbjct: 42  TAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFS 101

Query: 147 XXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGA 206
                  +    NN   F   RA QG+  A I+P+   L+  +     ++    I    +
Sbjct: 102 ILSL---ICAVVNNFGTFAVFRALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIV---S 155

Query: 207 CGPTGALFGGVFGGLIVTEDPNQWPWVFY-AFGIATFISMLMAWYSI---PNNVPTN--- 259
           CG + +   G   G   T     +  +FY  F +   IS++ +++SI    N  P     
Sbjct: 156 CGFSTSFGIGFIIGGAFTLTRIGYKGIFYLTFAVMLVISII-SYFSIGTSANQKPCTKDS 214

Query: 260 ------VHGLSMDWTGS-------VLAVIGLILFNFVWNEAP-----IAG---------W 292
                    LS+D+ GS       +L V+GL      W +       I G         W
Sbjct: 215 PKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGGESWKKPSAYVTLIVGIALFVLFFIW 274

Query: 293 DKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWT 352
           +  Y +               Y  +  +V L+P  V   ++ I I +AVF  +G      
Sbjct: 275 NICYGVLVKNLKSASNPKVYNY-FRTIQV-LIPKDVLMMKNFIPITVAVFANYGCLFSNL 332

Query: 353 FYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGP--ALLLCFALMAFDA 410
           +    +   +   SP+          +   I    +A     + P  A++L F +M   +
Sbjct: 333 YIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGS 392

Query: 411 GSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVI 470
             ++   L  +  YWK+ F  Q+++ FG  + FP S  IL    P +Y+G+A  ++ T  
Sbjct: 393 IILIQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFG 452

Query: 471 NYSASLCLGMGATVEHQINK-SGKN 494
            +   +   +  ++   IN+ SGK+
Sbjct: 453 QFGVEVTFSVMTSILGNINELSGKS 477

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 108/504 (21%), Positives = 197/504 (39%), Gaps = 52/504 (10%)

Query: 67  KELMFIGTCML-AQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILIS 125
           K L FI  C+L A  L+ A     + ++  +   F        W + S+ +    FI   
Sbjct: 21  KHLKFI--CILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFF 78

Query: 126 GRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGL 185
           GR+GDI G   M+               L     N   F   RAFQG+  A I+P    L
Sbjct: 79  GRVGDIVGNGIMMC---VFSVIFGIFSLLCAVVPNFIAFTVFRAFQGMAGAGIVPCAYAL 135

Query: 186 VGHVYKVGSLRK--NLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY-----AFG 238
           V  +++  +L++  +++ SVI A    G + GG FG     E    +   FY     +  
Sbjct: 136 VNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFG-----ETALGYKSFFYFLFAASLA 190

Query: 239 IATFISMLMAWYSIPNNVPT-----------NVHGLSMDWTGSVLAVIGLILFNFVWNE- 286
            A  I +L+ +  +  N  +           +V G  +  +GS+L V+GL      WN+ 
Sbjct: 191 TAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGLTQGGESWNDP 250

Query: 287 ---APIA----------GWDKAYIIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRH 333
               P+A           W+  Y +               Y ++   + L+P  +  + +
Sbjct: 251 TAYVPLAVSIVLLIIFFMWNLGYAVVLKLIKPISTHKGYAY-MESVNL-LIPKNLMFSHN 308

Query: 334 MIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAF-FVAFSI 392
            I +LLA F  +  F +  +   ++   +   S +       +  I G + A   VA+  
Sbjct: 309 FIPVLLATFFLFCGFMVVMYVIANYSATVEGNSMI-VASIKIIPMISGLVLANGTVAYKQ 367

Query: 393 KRLGPA-LLLCFALMAFDAGSIMFSVLPVEQS-YWKLNFAMQAVLCFGMDLSFPASSIIL 450
               P   L+  + ++   G+    +  V+ + +WKL F        G    F     + 
Sbjct: 368 DLFKPKNALVVGSFISILGGAFFVPIKYVDDNLFWKLFFMGGFFTGLGGAFFFCYMITMA 427

Query: 451 SDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLA 510
               P QY+ +AG +V T   +   + L +  ++         ++ + ++ A Y+ I  A
Sbjct: 428 IGDAPDQYKALAGGIVQTSGQFGNEVSLSIVISLLGNQTTDKADLRDRFQNASYIVITAA 487

Query: 511 SLGVLISVTYM---LETVWNERKK 531
           ++  L+S+  +   LE+  +E K+
Sbjct: 488 TISTLVSLFLVKGPLESSGDEEKQ 511

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 58/150 (38%), Gaps = 20/150 (13%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXX 151
           I++V+++ FG+ S    WL+  + L      LI GR   I G +  L+            
Sbjct: 60  IIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLI 118

Query: 152 XXLSKYSNNDSFFITCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIG 205
             L+   N     I  R   GVG      + F++   M        VG   + LVIS++ 
Sbjct: 119 AALASSMN---MLIFGRVVAGVGGSGLQTLCFVIGCTM--------VGERSRPLVISILS 167

Query: 206 ACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
                 A+ G + GG   T     W W FY
Sbjct: 168 CAFAVAAIVGPIIGGAFTTH--VTWRWCFY 195

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 3/92 (3%)

Query: 168 RAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACG---PTGALFGGVFGGLIVT 224
           R F GV  A      M L G  +K G + +     ++G       TGA+   +FG L  +
Sbjct: 182 RFFTGVFEAPSYIAYMYLFGSFFKSGEVARRSGFMIVGQYAGLMSTGAMQSAIFGALNTS 241

Query: 225 EDPNQWPWVFYAFGIATFISMLMAWYSIPNNV 256
              + W W F   G  + +  L+ +YS+P ++
Sbjct: 242 HGLSGWRWYFIIVGAISIVVALLGFYSLPGDI 273

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            L+              L+ ++ N + F   RA  G+G
Sbjct: 103 ALL---TAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            L+              L+ ++ N + F   RA  G+G
Sbjct: 103 ALL---IAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            L+              L+ ++ N + F   RA  G+G
Sbjct: 103 ALL---TAHFFFGIGCLLTCFARNVTEFSIARAICGIG 137

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 76/197 (38%), Gaps = 32/197 (16%)

Query: 57  QDPTYFSSFGKELM--------FIGTCMLAQLLNQAGQTHALCIMNVL----SKSFGSES 104
           + P + S +GK  M         + TC  +  L        + I++ +    +K FG+ S
Sbjct: 54  KKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYS 113

Query: 105 NNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFF 164
               W+ A + L      L+ GR+  I G K  ++              +S  +N+ +  
Sbjct: 114 KT-GWIFAGYSLPNALLALLWGRIASIIGFKSCML---AAIIIFEIGSLISGVANSMNML 169

Query: 165 ITCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVF 218
           I  R   GVG      +AF++ + +        V   R+ L+I+ + +     ++ G   
Sbjct: 170 IGGRVIAGVGGSGIQSLAFVIGSNL--------VDERRRGLIIACMSSAFAVASVIGPFL 221

Query: 219 GGLIVTEDPNQWPWVFY 235
           GG   T     W W FY
Sbjct: 222 GGAFTTHA--TWRWCFY 236

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 168 RAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDP 227
           R FQ +G + ++P  +G V  +    +  K +   ++G     G + G +FGGLI+  + 
Sbjct: 208 RVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGP--NMGPILGPIFGGLILM-NG 264

Query: 228 NQWPWVFYAFGIATFISMLMAWYSIPNNV 256
           NQW W+F    I T + +++    +P  +
Sbjct: 265 NQWRWLFGFTSITTGVGLILIVTFLPETL 293

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 73/177 (41%), Gaps = 15/177 (8%)

Query: 93  MNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXX 152
           +  L K F  + N     +  + L  G    +SG L D++G + +++             
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGL 184

Query: 153 XLSKYSNNDSFFITC--RAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPT 210
             +      S+ + C  R  Q +GI+  +    G+VG  + +   R   V +  G     
Sbjct: 185 ACAP-----SYGVICFLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGL---- 234

Query: 211 GALFGGVFGGLIVTEDPNQWPW--VFYAFGIATFISMLMAWYSIPNNVPTNVHGLSM 265
             L G  FG LI      +W W  +F+   I + +++++A +++P    T V  LS+
Sbjct: 235 -VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 56/136 (41%), Gaps = 19/136 (13%)

Query: 106 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFI 165
           N  WL+  + L+   F+L+ GRL +I G K+ LM              +S  SN+ +  I
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTKECLM---ISVIVFEIGSLISALSNSMATLI 100

Query: 166 TCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFG 219
           + R   G G      +AF++   +    H    G +   L IS + A G  G   GG F 
Sbjct: 101 SGRVVAGFGGSGIESLAFVVGTSIVRENH---RGIMITALAISYVIAEG-VGPFIGGAF- 155

Query: 220 GLIVTEDPNQWPWVFY 235
                 +   W W FY
Sbjct: 156 -----NEHLSWRWCFY 166

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F SES+ + W+  SF L   +F  + G+L DI G + 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRP 102

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            L+              ++ ++ N + F   RA  G+G
Sbjct: 103 ALL---TAQFFFGLGCLMTCFARNVTEFSIARAVCGIG 137

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 62/158 (39%), Gaps = 38/158 (24%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXX 151
           IMN +++ F  ES+ + W++ SF L   +F  + G+L D+ G K  LM            
Sbjct: 63  IMNKVAEEF-EESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLF 121

Query: 152 XXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGP-- 209
             LS+   N   F   RA  G+G            G +  + S      ISV   C P  
Sbjct: 122 TALSR---NLVEFSIARAVCGMG-----------AGGISALSS------ISVSDICTPKE 161

Query: 210 -------------TGALFGGVFGGLIVTEDPNQWPWVF 234
                        TG++ GG  GG ++  D   W  +F
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLM--DSFGWKVIF 197

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 49/124 (39%), Gaps = 8/124 (6%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q+  Y       L+F+G      LLN AG    + ++  L +++G E    +W + S+ +
Sbjct: 24  QNSKYQLIINMALIFLGCTF--DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAI 78

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
                I   GRLGDI G   +                L     N   F   RA QG+  A
Sbjct: 79  TFAGLIAFMGRLGDIIGNSVLF---TISGFFFSLFCLLCAVVTNFPAFAVLRALQGIAAA 135

Query: 177 FILP 180
            ++P
Sbjct: 136 GLVP 139

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/136 (18%), Positives = 59/136 (43%), Gaps = 8/136 (5%)

Query: 394 RLGPALLLCFALMAFDAGSIMFSVLPV--EQSYWKLNFAMQAVLCFGMDLSFPASSIILS 451
           +L P + +    ++   GSI+   L +  E  YWK+ F  Q ++ FG  + +P +  ++ 
Sbjct: 381 KLRPRIGVALGFLSMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVV 440

Query: 452 DGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINK------SGKNVLEGYRAAVYL 505
              P   +G+A  +  T       +   +  +V   I +      S +   +G++   Y 
Sbjct: 441 GDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQVKSRPDSFERFRDGFQKCTYF 500

Query: 506 GIGLASLGVLISVTYM 521
            +   + G++++  ++
Sbjct: 501 TLASGAFGLVLTTFFV 516

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 62/154 (40%), Gaps = 22/154 (14%)

Query: 90  LCIMNVLSKSFGSESNNQA---WLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXX 146
           +CI   L  + G E N+ A   WLMA + L    F+L+ GR+  + GLK  LM       
Sbjct: 26  ICI--TLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLM---ASIV 80

Query: 147 XXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGS-----LRKNLVI 201
                  ++  +N+    I  R   G G +       G+   VY VG+       +  VI
Sbjct: 81  IFEAGSLMAGAANSMGMLIGARVISGFGGS-------GIESLVYGVGTSIVEEKHRARVI 133

Query: 202 SVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           +V+G         G   GG +   +   W W FY
Sbjct: 134 TVLGIAYMLAEGAGPFVGGGLA--EHVSWRWCFY 165

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 87/424 (20%), Positives = 160/424 (37%), Gaps = 55/424 (12%)

Query: 92  IMNVLSKSFGSESNNQ---AWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXX 148
           I+  L     SE N     +W+  ++ L++ +F  + G+L DI+G + +L+         
Sbjct: 159 IVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLG 218

Query: 149 XXXXXLSKYSNNDSFFITCRAFQGVG-------IAFILPNIMGLVGHVYKVGSLRKNLVI 201
                +SK   N    +  R   G+G        +    +I+ L       G    N+  
Sbjct: 219 ALICGMSK---NLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGIC--NVFF 273

Query: 202 SVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISM--LMAWYSIP------ 253
            +  AC   G L GG+F    V      W   F      T +S   +  + ++P      
Sbjct: 274 GLGTAC---GGLVGGLFADRAV-----GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAH 325

Query: 254 -----NNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIXXXXXXXXXX 308
                 ++P       +DWTG+V  V+ L  F  V +   + G D  ++           
Sbjct: 326 KGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSG 382

Query: 309 XXXXXYEIKYAEVPLLPHAVTKNRHMIMILLA---VFVGWGSFGIWTFYYVSFQLNLRHY 365
                +E+  A  P+LP    +NR ++   L+     +G  + G +   Y +  LN+   
Sbjct: 383 SYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM--- 439

Query: 366 SPVWTGGTY---FVFAIFGTIAAFFVAFSIKRLGPA--LLLCFALMAFDAGSIMFSVLPV 420
            P   G      F    FG++ A    + +KR G     LL F L+    G +  S +  
Sbjct: 440 GPTDIGKRIVPSFFSTAFGSLGA---GYYMKRTGKYYWFLLAFCLVGV-LGQVQISYVTP 495

Query: 421 EQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 480
             S W+  + +  +  FG  +    + + L   +P ++Q    S+     +  ++L + +
Sbjct: 496 SISTWR-QYCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSI 554

Query: 481 GATV 484
           G  +
Sbjct: 555 GGAI 558

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 82/223 (36%), Gaps = 36/223 (16%)

Query: 26  EEDKVIVSTDEEVTTVAXXXXXXXXXXXXPWQDPTYFSSFGKELMF-------IGTCMLA 78
           ++D VI  T  + ++V+              ++P   ++FG+           +G+ +L 
Sbjct: 2   DKDSVIADTRGDASSVSTGSVK---------EEPVRTNAFGQRFPTGVELWAPLGSLVLC 52

Query: 79  QLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 138
             L          I+  +S+ FG  S    WL   + L     +LI GR+  + G K   
Sbjct: 53  LFLAALDVMTVSTIIEEVSQKFGDYSK-VGWLFTGYSLPNALLVLIWGRIATLVGFKTST 111

Query: 139 MXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG------IAFILPNIMGLVGHVYKV 192
           +              +S  +N+    I  R   G+G      + F++ + +        V
Sbjct: 112 L---AAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTL--------V 160

Query: 193 GSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
               + L+I+V+ +     ++ G   GG   T     W W FY
Sbjct: 161 EERNRGLIIAVMSSSFGIASVVGPFLGGAFTTH--VTWRWCFY 201

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            ++              L+ ++ N + F   RA  G+G
Sbjct: 107 AVL---TSHFFFGLGCFLTCFAQNITQFSIARAICGIG 141

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F  ES  + W+  SF L   +F  + G+L DI G K 
Sbjct: 42  LGSFLSSIDSTIVANIMNKVAEEF-QESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKF 100

Query: 137 MLM 139
            L+
Sbjct: 101 ALL 103

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 98/238 (41%), Gaps = 25/238 (10%)

Query: 57  QDPTYFSS--FGK------ELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQA 108
           QD   F S  FGK       L  + +  +A  L    +T    IMN +++ F  ES+   
Sbjct: 27  QDCKIFDSDEFGKLQEVMPRLPMLLSLWMANFLASMDRTIIANIMNSVTEEF-KESHRIQ 85

Query: 109 WLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCR 168
           W+  SF L +  F  I G+L D+ G + +L+              ++ Y+ N   F   R
Sbjct: 86  WVATSFLLTSTVFQPIYGKLSDVTGRRFVLV---LAYSLFLLGCLVTAYARNIWEFAFGR 142

Query: 169 AFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPN 228
           A  G+G   I    +  +G ++ V    +++  S        G + G   GG+ +  +  
Sbjct: 143 AICGIGAGGIPTMCVITMGDMFSVK--EQSIYQSYAHIIYTIGEVLGAPIGGIAL--ETV 198

Query: 229 QWPWVFYA----FGIATFISM----LMAWYSIPNNVPTNVHGLS-MDWTGSVLAVIGL 277
            W  +F A      I  ++++    L   +  P+        +S MD +GS+L +I L
Sbjct: 199 GWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRMDLSGSILLIISL 256

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
           IMN +++ F SES+ + W+  SF L   +F  + G+L D+ G K  L+
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALL 104

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135
           L   L+    T    IMN +++ F + SN + W+  S+ L   +F  + GRL DI G K
Sbjct: 74  LGSFLSALDATIVAVIMNRVAEDFNA-SNQKQWIATSYLLTNTAFQPLYGRLSDIIGRK 131

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 79/209 (37%), Gaps = 11/209 (5%)

Query: 59  PTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAA 118
           P    ++ ++ M +G   +    +  G       +  L K F  + N     +  + +  
Sbjct: 81  PHSLFTYNQKWMMVGVLTMCGFWSSLGSPIYYPALKQLEKQFDVDENMVNVTVVVYLIFQ 140

Query: 119 GSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFI 178
           G      G L D++G + +++               S   N+    +  R  Q  GI+  
Sbjct: 141 GLSPTFCGGLADLFGRRPVILTGMLIYTVASIGLACS---NSYGVIVFLRCLQSAGISPT 197

Query: 179 LPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPW--VFYA 236
           +    G VG  + V S R   V +V G       L G  FG LI       + W  +F+ 
Sbjct: 198 ISISSGAVGD-FTVKSERGTFVGAVSGL-----VLLGQAFGSLIGAALAASFNWRAIFWF 251

Query: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSM 265
             I   +SM++A++ +P    T V  LS+
Sbjct: 252 LTIGCGVSMMVAFFVLPETKRTIVGNLSI 280

>SAKL0B02112g Chr2 complement(202102..203685) [1584 bp, 527 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260w TNA1 High affinity nicotinic acid
           plasma membrane permease, responsible for uptake of low
           levels of nicotinic acid; expression of the gene
           increases in the absence of extracellular nicotinic acid
           or para- aminobenzoate (PABA)
          Length = 527

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 10/64 (15%)

Query: 210 TGALFGGVFGGLI---VTEDPNQ------WPWVFYAFGIATFISMLMAWYSIPNNVPTNV 260
           +G+L  G F GLI   + E  +       W W F   G  T +++ +A+Y +P+N P+N 
Sbjct: 210 SGSLISGAFAGLISAGIIEGMDNVKGLRAWRWCFIIEGALTIVTVPLAYYILPDN-PSNS 268

Query: 261 HGLS 264
             LS
Sbjct: 269 KMLS 272

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 23/142 (16%)

Query: 102 SESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNND 161
           ++ N+  WL+  + L++  F L+ GR+  + GLK  LM              ++  SN+ 
Sbjct: 75  NDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLM---LSVLIFEIGSLIAAVSNSM 131

Query: 162 SFFITCRAFQGVGIAFILPNIMGLVGHVYKVGS-----LRKNLVISVIGACGPTGALFGG 216
              I  R   G G +       G+   VY VG+       + +VI V+     T A  G 
Sbjct: 132 GMLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVL-----TFAFVGS 179

Query: 217 VFGGLIVTEDPNQ---WPWVFY 235
             GG I+    N+   W W F+
Sbjct: 180 NAGGPILGGALNEHASWRWCFF 201

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 93/239 (38%), Gaps = 30/239 (12%)

Query: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116
           Q+  Y       L+F G      LLN AG    + ++  L +++       +W + S+ +
Sbjct: 20  QNSRYQLGINITLIFFGCTF--DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAI 74

Query: 117 AAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIA 176
               FI   GRLGDI G   +                L     +   F   RA QG+  A
Sbjct: 75  TFAGFIAFMGRLGDIVGNSVLF---TISCFLFTLFSLLCAVVRDFPTFAVFRALQGISAA 131

Query: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY- 235
            I+P    L+  + +   ++K   I    +CG +  +  G+  G         +  +FY 
Sbjct: 132 GIVPCGYALIPLLAEPQDIQKFFSIV---SCGFSSTIGIGLIVGGAFALTKVGYAGIFYL 188

Query: 236 AFGIATFISMLMAWYS---------------IPNNVPTNVHGLSMDWTGSVLAVIGLIL 279
           +F     +S+  ++Y+               IP++ P      S+D+ GS++ V G +L
Sbjct: 189 SFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVA---SLDFVGSLIFVSGSVL 244

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 61/158 (38%), Gaps = 14/158 (8%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXX 151
           I++ +  SFG +     W++  + L    F L+ GRL  + G +  ++            
Sbjct: 67  IIDTVCTSFG-DYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLI 125

Query: 152 XXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTG 211
             L+K  N     I+ R   GVG + +    + LV     V    + LV+S++       
Sbjct: 126 SALAKSMN---MLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAVA 180

Query: 212 ALFGGVFGGLIVTEDPNQWPWVFY------AFGIATFI 243
           ++ G   GG   T     W W FY         IA FI
Sbjct: 181 SIVGPFLGGAFTTH--VTWRWCFYINLPIGGLAIAIFI 216

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 54/136 (39%), Gaps = 19/136 (13%)

Query: 106 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFI 165
           N  WL+  + L+   F+L+ GRL +I G  + LM              +S  SN     I
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTTECLM---ISVVIFEIGSLISALSNTMGTLI 100

Query: 166 TCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFG 219
             R   G G      +AF++     +V   Y+ G +   L +S + A G  G   GG F 
Sbjct: 101 GGRVIAGFGGSGIESLAFVVGT--SIVQENYR-GIMITALAVSYVIAEG-VGPFIGGAF- 155

Query: 220 GLIVTEDPNQWPWVFY 235
                 +   W W FY
Sbjct: 156 -----NEHLSWRWCFY 166

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
           IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G K  L+
Sbjct: 74  IMNRVAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALL 120

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135
           IMN +++ F +ES+ + W+  SF L   +F  + G+L DI G K
Sbjct: 66  IMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRK 108

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 53/136 (38%), Gaps = 19/136 (13%)

Query: 106 NQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFI 165
           N  WL+  + L    F+L+ GRL +I G  + LM              +S  SN+    I
Sbjct: 44  NIGWLVTGYALTNAVFMLLWGRLAEILGTNECLM---ISVIIFEVGSLISALSNSMGTLI 100

Query: 166 TCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFG 219
           + R   G G      +AF++   +    H    G++   L  S + A G  G   GG F 
Sbjct: 101 SGRLIAGFGGSGIESLAFVVGTSIVQENH---RGTMITALATSYVIAEG-VGPFIGGAF- 155

Query: 220 GLIVTEDPNQWPWVFY 235
                 +   W W FY
Sbjct: 156 -----NEHLSWRWCFY 166

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 64/170 (37%), Gaps = 20/170 (11%)

Query: 72  IGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDI 131
           +G+  LA  L+         I+  +S+ F +E +   WL+  + L      L+ GR   I
Sbjct: 46  LGSLTLALFLSALDILIVSTIIETVSRDF-NEYSKSGWLVTGYSLPTALLSLVWGRAASI 104

Query: 132 YGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG------IAFILPNIMGL 185
            G K  ++              +S  +N+ +  I  R   GVG      + F++ + +  
Sbjct: 105 IGFKSSML---LSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTL-- 159

Query: 186 VGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
                 V    + + ISV+       ++ G   GG   T     W W FY
Sbjct: 160 ------VNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHV--TWRWCFY 201

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
           IMN +++ F  ES+ + W+  SF L   +F  + G+L DI G +  L+
Sbjct: 56  IMNRVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALL 102

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 20/169 (11%)

Query: 75  CMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQA---WLMASFPLAAGSFILISGRLGDI 131
           C+ +  L        + I+  L ++ G +  + A   WL+  + L    F L+ GRL  I
Sbjct: 9   CLTSLALTLFLAALDIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASI 68

Query: 132 YGLKKMLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYK 191
            GLK  L               +   SN+    I  R   G G +       G+   V+ 
Sbjct: 69  LGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGRVVAGCGGS-------GIQSLVFV 118

Query: 192 VGS-----LRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
           VG+       + +VI+V+G         G V GG   TE+ + W W FY
Sbjct: 119 VGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF-TENVS-WRWCFY 165

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 58/149 (38%), Gaps = 20/149 (13%)

Query: 93  MNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXXX 152
           + V+++ F   S +  W+++ + L      L+ GR   I G K  L+             
Sbjct: 142 IEVIAEQFKDYSKS-GWIVSGYSLTEALLTLLWGRFATIIGFKSSLL---VSILIFEAGS 197

Query: 153 XLSKYSNNDSFFITCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIGA 206
            +S  SN+ +  I  R   G+G      + F++ + +             + ++ISV+  
Sbjct: 198 LISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 207 CGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
                A+ G   GG + T     W W FY
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFY 276

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L+    T    IMN +++ F  ES+ + W+  S+ L   +F  + G+L D+ G K 
Sbjct: 45  LGSFLSSLDGTIVANIMNRVAEEF-QESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKF 103

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVG 174
            ++              L+ ++N+ + F   RA  GVG
Sbjct: 104 AVL---TAHFFFGLGCLLTCFANSVTQFAIARAICGVG 138

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 92  IMNVLSKSFGSE---SNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLM 139
           I+  L  +  SE   SN  +W+  S+ L+  +F  + G+L D++G K +L+
Sbjct: 51  IVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLI 101

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 61/150 (40%), Gaps = 20/150 (13%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXX 151
           I+  ++K FGS S    WL   + L      LI GR+    G K+ ++            
Sbjct: 90  IIEEVAKQFGSYSE-IGWLFTGYSLPNALLALIWGRIATPIGFKETML---FAIVIFEIG 145

Query: 152 XXLSKYSNNDSFFITCRAFQGVG------IAFILPNIMGLVGHVYKVGSLRKNLVISVIG 205
             +S  +N+ S  I  R   GVG      ++F++ + +        V   ++ ++I+V+ 
Sbjct: 146 SLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTL--------VEESQRGILIAVLS 197

Query: 206 ACGPTGALFGGVFGGLIVTEDPNQWPWVFY 235
                 ++ G   GG+  +     W W FY
Sbjct: 198 CSFAIASVVGPFLGGVFTSSV--TWRWCFY 225

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 84/220 (38%), Gaps = 23/220 (10%)

Query: 211 GALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLS------ 264
           GA+ G  FGG I +     W W F      + IS ++  Y +PN    N    S      
Sbjct: 103 GAICGASFGGTIASSI--GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPG 160

Query: 265 -----MDWTGSVLAVIGLILFNFVWN---EAPIAGWDKAYIIXXXXXXXXXXXXXXXYEI 316
                +D  GS+L + GL L     +         W    ++               +E 
Sbjct: 161 KILRDIDVMGSILIITGLTLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHER 220

Query: 317 KYAEVPLLPHAVTKNRHMIMIL-LAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYF 375
           K +   ++P  +  + + +++L +++ VG+ S+       + FQ+ L   S    G    
Sbjct: 221 KTSARAIIPMELVNSSYSVVVLSISILVGFASYAYLFTLPLFFQIVLGD-STAKAGLRLT 279

Query: 376 VFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMF 415
           + ++F  + +    FS+ +       C  L+ +   S+MF
Sbjct: 280 IPSLFTPVGSLITGFSMSKYN-----CLRLLLYIGISLMF 314

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 112/291 (38%), Gaps = 61/291 (20%)

Query: 77  LAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKK 136
           L   L  A  T    IM  ++  F +E    +W+  ++ L++ +F  + G+L DI+G K 
Sbjct: 87  LGIFLAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKP 145

Query: 137 MLMXXXXXXXXXXXXXXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVG--- 193
           +LM                   NN  F + C       +  + P+  GLVG  +  G   
Sbjct: 146 LLML------------------NNIVFLVGCL------MCGLTPSFWGLVGARFISGIGG 181

Query: 194 ---SLRKNLVISVI----------GACG---PTGALFGGVFGGLIVTEDPNQWPWVFY-A 236
              +   ++ IS I          G C      G   GGV GG   ++    W   F   
Sbjct: 182 GGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWF-SDHGGGWRMAFLIQ 240

Query: 237 FGIATFISMLMAWY------SIPNNVPTNVHG--LSMDWTGSVLAVIGLILFNFVWNEAP 288
             ++   S+L+A +      S   N P ++    LS+DW G+   V+ L LF      A 
Sbjct: 241 VPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVT---AS 297

Query: 289 IAGWDKAY----IIXXXXXXXXXXXXXXXYEIKYAEVPLLPHAVTKNRHMI 335
           + G + A+     +                E+  A+ P+LP +  +NR ++
Sbjct: 298 LGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVL 348

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135
           IMN ++  F +ES+ + W+  S+ L   +F  + G+L DI G K
Sbjct: 65  IMNSIAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRK 107

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 53/144 (36%), Gaps = 8/144 (5%)

Query: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMXXXXXXXXXXXX 151
           I++V++K FG+ S    WL+  + L      L+ GR   I G +  L+            
Sbjct: 68  IIDVVAKQFGNYSKT-GWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLV 126

Query: 152 XXLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTG 211
             L+   N     +             L  +  ++G    V    + LVIS++       
Sbjct: 127 AALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTM-VDERSRPLVISILSCAFAVA 181

Query: 212 ALFGGVFGGLIVTEDPNQWPWVFY 235
           A+ G + GG   T     W W FY
Sbjct: 182 AIVGPIIGGAFTTHV--TWRWCFY 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,731,452
Number of extensions: 1890918
Number of successful extensions: 6126
Number of sequences better than 10.0: 140
Number of HSP's gapped: 6146
Number of HSP's successfully gapped: 149
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)