Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4508.840ON62262232980.0
YMR278W (PGM3)8.840ON62262228710.0
Suva_13.4668.840ON62262228390.0
Smik_13.4918.840ON62262227810.0
SAKL0D01474g8.840ON62462320820.0
TDEL0B005708.840ON63062020720.0
Kpol_1068.88.840ON63262120390.0
NCAS0C004108.840ON62562220320.0
NDAI0K004108.840ON62661420010.0
TPHA0I002508.840ON62962220000.0
ZYRO0G14190g8.840ON61061419980.0
KNAG0J002708.840ON62562019790.0
CAGL0M02981g8.840ON61761519570.0
TBLA0B032508.840ON64364219470.0
KAFR0B039208.840ON62461419090.0
Kwal_27.102588.840ON62062318470.0
KLTH0C03872g8.840ON62162318440.0
KLLA0D01573g8.840ON60763217600.0
ABL126W8.840ON62462917540.0
Ecym_46118.840ON63062617530.0
TPHA0G029002.445ON5692961038e-04
Skud_11.1022.445ON570257970.004
CAGL0B03597g6.11ON54030940.011
Smik_11.1122.445ON570257930.014
YKL127W (PGM1)2.445ON570296910.020
YEL058W (PCM1)6.11ON55741910.023
Skud_5.316.11ON55741910.023
Skud_13.2632.445ON569295910.024
TDEL0E00210singletonON570298900.026
NCAS0F002006.11ON54928900.027
KAFR0L003406.11ON54052900.027
Suva_5.106.11ON55341900.027
TDEL0G046006.11ON52828900.029
TPHA0B011601.229ON392143890.030
TPHA0G024702.445ON569298900.032
TBLA0G009806.11ON55828890.035
NDAI0K028906.11ON56130890.040
NCAS0F014702.445ON569250890.043
Kpol_1032.26.11ON53928880.053
Suva_13.2822.445ON569251870.061
Smik_5.296.11ON55540860.077
Kpol_1033.542.445ON570299860.078
YMR105C (PGM2)2.445ON569295860.094
KAFR0D030102.445ON569250850.11
TBLA0I013802.445ON571297850.11
KNAG0E009406.11ON538115850.11
ZYRO0F00506g6.11ON55024840.15
Smik_13.2912.445ON569295830.21
KLTH0D04796g2.445ON570384830.22
KLLA0D00858g6.11ON54119820.29
SAKL0E00902g6.11ON54419820.30
KLTH0C11506g6.11ON54420810.34
TDEL0A022102.445ON572253810.35
Kwal_56.223556.11ON54120810.35
ACR015W6.11ON55252810.36
Suva_11.982.445ON570258800.46
NDAI0H023502.445ON569250800.49
TBLA0B090102.445ON569296780.72
TPHA0M002106.11ON54580780.85
SAKL0E03630g2.445ON57199770.95
KNAG0E023902.445ON569256770.98
Kwal_26.76282.445ON570262771.1
CAGL0K03421g2.445ON568296771.2
AAR162C6.115ON117163761.4
ZYRO0G02508g2.445ON569297751.6
NCAS0A043502.445ON569250751.7
Ecym_30146.11ON55119751.7
KNAG0A062802.445ON57098742.3
ABL029W2.445ON568189733.3
CAGL0K07480g2.445ON567128706.7
KLLA0B12694g2.445ON5682956910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.450
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...  1274   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...  1110   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...  1098   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...  1075   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   806   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   802   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   790   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   787   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   775   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   775   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   774   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   766   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   758   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   754   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   739   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   716   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   714   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   682   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   680   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   679   0.0  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               44   8e-04
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    42   0.004
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.011
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    40   0.014
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    40   0.020
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    40   0.023
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    40   0.023
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    40   0.024
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    39   0.026
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.027
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.027
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    39   0.027
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.029
TPHA0B01160 Chr2 complement(263016..264194) [1179 bp, 392 aa] {O...    39   0.030
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.032
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    39   0.035
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.040
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    39   0.043
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.053
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    38   0.061
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.077
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    38   0.078
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    38   0.094
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    37   0.11 
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    37   0.11 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.11 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.15 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    37   0.21 
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    37   0.22 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.29 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.30 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.34 
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    36   0.35 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.35 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    36   0.36 
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    35   0.46 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    35   0.49 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    35   0.72 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.85 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    34   0.95 
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    34   0.98 
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    34   1.1  
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    34   1.2  
AAR162C Chr1 complement(634067..637582) [3516 bp, 1171 aa] {ON} ...    34   1.4  
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    33   1.6  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    33   1.7  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   1.7  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               33   2.3  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    33   3.3  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    32   6.7  
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    31   10.0 

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1274 bits (3298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/622 (98%), Positives = 610/622 (98%)

Query: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60
           MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL
Sbjct: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120
           RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL
Sbjct: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120

Query: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240
           HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL
Sbjct: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240

Query: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIG        
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
               SMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
           KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
           KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK
Sbjct: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
           LTWDVLRREWFRPEKTNITTNF
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 1110 bits (2871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/622 (83%), Positives = 568/622 (91%)

Query: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60
           M Q  L T+PSDLK PISLWF QDR+P+TIEEVTALCKKSDW+ELHKRFD+RIQFGTAGL
Sbjct: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120
           RSQMQAGFSRMN LV+IQASQGLATY+RQQFP+NLVAVVGHDHRFHSK+FARATA AFLL
Sbjct: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120

Query: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240
           HD AIS++ID NLEPWAN W+FDD+L+K LKQGKLMYSREEMLKLYLE++S NLVE  PL
Sbjct: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240

Query: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLEV++KPWFVYTPMHGVGFDIFSTIVKK++CLVEGKDYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EEKGAL+IG+ LAEKHDI LL+ANDPDADRFSVA+KDMQSG W+QLTGNEIG        
Sbjct: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
               SMD++FQ  HPLAML+STVSSQMIK+MAE+EGFHYEDTLTGFKWIGNRAI+LEK+G
Sbjct: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISAS+VFLQAYCKWK+ +NLDP+NVLENGFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
           KEYNGYY+VPNP VTK+IF YIR+VYTP    YP  IGEEI VL YRDLTTGYQSDT++H
Sbjct: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540

Query: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
           KPTLPVDPTSQMITV ARP++ + NEHIRFTIRGSGTEPKLKVYIE  ANEE+RASFLAK
Sbjct: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
           LTW+VLRREWFRP++ NI T F
Sbjct: 601 LTWNVLRREWFRPDEMNIVTKF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/622 (82%), Positives = 565/622 (90%)

Query: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60
           M QQ L T+PSDLKGPISLWFDQDR+PETIEEVT LCK SDWDELHKRFDTRIQFGTAGL
Sbjct: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120
           RS+MQAGFSRMN LVIIQA+QGLATYI+QQFP+NLV VVGHDHRFHSK+FARATATAFLL
Sbjct: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240
           HD AIS++IDMNLEPWAN W F D+L+K LKQGKLMYSREEML LY +++S  LVET PL
Sbjct: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240

Query: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           KLE+++KPWFVYTPMHGVGF+IFSTIVKK+M LVEG+DYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EEKGAL+IGMRLAE+HDI+LL+ANDPDADRFS+A+KD QS  W+QLTGNEIG        
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
               + DE+FQ++HPLAMLSSTVSSQMIK+MAEVEGF YEDTLTGFKWIGNRAIILEKEG
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISA+VV LQAYCKWK+ +NLDPI++LENGF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
           KEYNGYY+VP+P+VT EIF+YIR+VYTP  VPYPP IGEEI V+ YRDLTTGYQSDT DH
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
           KP LPVDPTSQMIT+  +P+D NGNEHIRFTIRGSGTEPKLKVYIE  A+ E+RAS+LAK
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
           LTWDVLRR WFRPE  NITT+F
Sbjct: 601 LTWDVLRRGWFRPEIMNITTDF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/622 (80%), Positives = 562/622 (90%)

Query: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60
           MS QFL  +PS+LK  ISLWF+QD++PETIEEVTALCKKSDW+ELH+RFD+RIQFGTAGL
Sbjct: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60

Query: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120
           RSQMQAGF+RMN LVIIQASQGLATY +QQFPNNLVAVVGHDHRFHSK+FARATATAFLL
Sbjct: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240
           HD AIS++IDMNLEPWAN WNFDD+L+K LKQGKLMYSREE+LKLYL ++S NLV T PL
Sbjct: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240

Query: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
           K EV++KPWFVYTPMHGVGFDIFSTIVKK+M LVEGKDYLCVPEQQ PDPSFPTV FPNP
Sbjct: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EEKGAL++G+ LAE H I+LLIANDPDADRFSVAIKD++SG W+QLTGNEIG        
Sbjct: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
               SM++QFQ  HPLAMLSSTVSSQMIK+MAEVEGFHYE+TLTGFKWIGNRAI+LEKEG
Sbjct: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDG+SAS+VFLQAYC+WK+ +NLDPI++LE+GFKKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
           KEYNGYYIV +PIVT EIF YIR+ YTP+ V YP  IG+EI VL YRDLT GYQSDT +H
Sbjct: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540

Query: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
           KPTLP+DP+SQMITV A+P+D N  EHIRFTIRGSGTEPK+KVYIE  A+EE+RA+FLAK
Sbjct: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
           LTW+VL+REWFRPEK +I T+F
Sbjct: 601 LTWNVLKREWFRPEKMDIVTHF 622

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/623 (60%), Positives = 465/623 (74%), Gaps = 13/623 (2%)

Query: 8   TIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAG 67
           T+P DLK  ++LW   D++PET  E+  L +   W+ELH R D RI FGTAGLRS+M+AG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 68  FSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHY 127
           FSRMN L ++QASQGLA+YI+ QFP NL  +VGHDHR+HS +FAR T TAFL  GFKV+Y
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 128 LN-----PGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           LN       + FVHTP+VPF +++LNAS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKL 242
           + IS  ID NL PW  AW+ D+++   ++ G L   +E++   Y++ +SD LV    L  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246

Query: 243 EVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302
           +   KPWFVYTPMHGVGF+IF  I   ++ L EGK Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 303 KGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXX 362
           KGAL++ + LAE+ DI L+IANDPDADRFSVA+K+     W QLTGNEIG          
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361

Query: 363 XXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYY 422
              + E F++ HPLAM++STVSSQMIK +AE E FHYEDTLTGFKW+GNRA  LE +GYY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKE 482
           VPF +EEAIGYMFP +EHDKDGISA+VVFLQ YC+W   + + P+ VL+ GF KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 483 YNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKP 542
           YNGYYIVP   +TKE+F YIR+ YTP    YPP IG E  V+ +RDLTTGYQSDT+D+ P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 543 TLPVDPTSQMITVFARPN---DSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599
            LPVD +SQMIT   RP+   +S   E +RFTIRGSGTEPKLKVYIE ++ +E+RA  LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 600 KLTWDVLRREWFRPEKTNITTNF 622
           + TW VLRREWFRPE+T + T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/620 (60%), Positives = 475/620 (76%)

Query: 3   QQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRS 62
           ++ + ++P+DL   ++ W  QD + +T  E+  LCK  DW ELHKR DTRI FGTAGLRS
Sbjct: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70

Query: 63  QMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKG 122
           +M+AGFSRMN LV++QA+QGLA +I++QFP+ L AVVGHDHRF+S++FA AT   FL  G
Sbjct: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130

Query: 123 FKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV +LN G +FVHTP+VPF V+E+ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190

Query: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKL 242
             I+ +I+ NL  W  AW +D++L + L    L+Y+ EEM++ Y +K+  +LV+ T +  
Sbjct: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250

Query: 243 EVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302
           E   KPWFVYTP+HGVG+DIF  I +++M L+ G+DYLCV EQQ PDPSFPTV FPNPEE
Sbjct: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310

Query: 303 KGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXX 362
           KGAL++ + +A+K+ ISL++ANDPDADRFS A+KD ++G W+QLTGNEIG          
Sbjct: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQK 370

Query: 363 XXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYY 422
               +E++++ HPLAML+STVSSQ+I +MAE+E FHY DTLTGFKWIGNR + LE   YY
Sbjct: 371 YQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKE 482
           VPFGFEEAIGYMFP MEHDKDGISA+ VFLQ Y KW + +    + VLE+ F+KYGVFKE
Sbjct: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490

Query: 483 YNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKP 542
           YNGYY V +P V KE+F +IR+ Y+  + PYP  IGEE++V  +RDLT GYQSDT++ +P
Sbjct: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550

Query: 543 TLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLT 602
            LPVDP SQMIT + + N +   E +RFTIRGSGTEPKLKVYIE  +  E RAS LA+LT
Sbjct: 551 DLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610

Query: 603 WDVLRREWFRPEKTNITTNF 622
           W VL+REWFRP+ T +TT F
Sbjct: 611 WRVLKREWFRPDVTGLTTTF 630

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/621 (60%), Positives = 472/621 (76%), Gaps = 4/621 (0%)

Query: 6   LGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQ 65
           L T+P DL+  +  W  QD++PETI EV  LCK +  +ELHKRFD RI FGTAGLRS+M+
Sbjct: 12  LETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKME 71

Query: 66  AGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKV 125
           AGFSRMN LV++QA+QGLATYI+QQFP+NL AV+GHDHR+HSK+FA    + FL  GF V
Sbjct: 72  AGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTV 131

Query: 126 HYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAI 185
           + LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP D +I
Sbjct: 132 YNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASI 191

Query: 186 SNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK-LEV 244
           +  ID NLEPW+N+W+    +   L   KL+Y R EML  Y +K+ +N+++   ++  + 
Sbjct: 192 AKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE 251

Query: 245 RSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304
             KPWFVYTPMHGVG++IF+++V + + L E +DYL V EQ  PDP+FPT+ FPNPEEKG
Sbjct: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311

Query: 305 ALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXX 364
           AL++ + LA+++DISL+IANDPDADRFS AI +  SG WQQLTGNEIG            
Sbjct: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371

Query: 365 SMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVP 424
           +MD +F++ HPLAML+STVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+KEGY+V 
Sbjct: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431

Query: 425 FGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYN 484
           FG+EEAIGYMFPAMEHDKDGI+ASVVFLQAY +W   + +  I++LE G +KYG FKEYN
Sbjct: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491

Query: 485 GYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTL 544
           GYY+V NP VT +IF YIR+ Y      YP  IG  + V  +RDLTTG+QSDT+D+ P+L
Sbjct: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551

Query: 545 PVDPTSQMITVFARPND---SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKL 601
           PVDP+SQMIT+ A+  D      +  +RFT+RGSGTEPKLK+YIE  + +   AS +AKL
Sbjct: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611

Query: 602 TWDVLRREWFRPEKTNITTNF 622
           TWDVL++EW RPE T +TT++
Sbjct: 612 TWDVLKKEWIRPEVTGVTTSY 632

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/622 (59%), Positives = 470/622 (75%), Gaps = 1/622 (0%)

Query: 2   SQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLR 61
           +Q  L   P +L+ PI+LW   D++ ET +EV  LC+  +W ELH+RFDTRI FGTAGLR
Sbjct: 4   TQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLR 63

Query: 62  SQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLK 121
           S+M+AGFSRMN+L+I+Q++QGLA YI++QFPNNL AVVGHDHRFHSK+FA  TA+ FL  
Sbjct: 64  SRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRA 123

Query: 122 GFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           GFKV YL P  +FVHTPLVPF+V  L ASVGVMITASHNPKMDNGYKVYY N CQIIPPH
Sbjct: 124 GFKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPH 183

Query: 182 DQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK 241
           D+ I+  I  NLEPW+ +W++D    K L+  KL++ ++ M + YL ++   L+ ++ L 
Sbjct: 184 DKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLS 243

Query: 242 LEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPE 301
           L+    P+FVYTPMHGVG +IF+ +  + + L E  DYL V EQ+ PDPSFPTV FPNPE
Sbjct: 244 LKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPE 303

Query: 302 EKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXX 361
           EKGAL++ ++LA+++ +SL+IANDPDADRFS A+ + ++G W+QLTGNEIG         
Sbjct: 304 EKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQ 363

Query: 362 XXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGY 421
                D  F++THPLAM++STVSSQMIKRMA++ GFHYEDTLTGFKWIGN+AI L +EGY
Sbjct: 364 LYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGY 423

Query: 422 YVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFK 481
           YVPFGFEEAIGYMFP ME DKDGISA+ VFLQAYC W     + P +++E GF K+GVFK
Sbjct: 424 YVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFK 483

Query: 482 EYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHK 541
           EYNGYYI+ +  +TK +F +IR  Y   N  YP  IG E+ V  +RDLT GYQS+T D+ 
Sbjct: 484 EYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNI 543

Query: 542 PTLPVDPTSQMITVFARPND-SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
           P LPVDPTSQMITV A+P++ SN    +R T+RGSGTEPKLKVYIE  +  E  A+ LA+
Sbjct: 544 PNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLAR 603

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
            TWD+L+REWFRPE T +TT+F
Sbjct: 604 STWDILKREWFRPEVTGLTTSF 625

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/614 (62%), Positives = 466/614 (75%), Gaps = 1/614 (0%)

Query: 10  PSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGFS 69
           P++L+  I LW  QD+  ET  EV  LCK S+W ELHKRFD+RI FGTAGLRS+M+AGFS
Sbjct: 13  PANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGFS 72

Query: 70  RMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLN 129
           RMN LVI+QASQGLA YI+ QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFKV+YLN
Sbjct: 73  RMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLN 132

Query: 130 PGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAI 189
           P   FVHTPLVPF+V+ LNAS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD+ I+  I
Sbjct: 133 PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATI 192

Query: 190 DMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSK-P 248
           D NLEPW++ WN+D    KNLK+ KL+Y REEM   YL+ + D LV ++  +     K P
Sbjct: 193 DENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGKKP 252

Query: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308
           WFVYTPMHGVG++IF+ I K  +   E  DY  V EQ  PDP+FPTV FPNPEEKGAL++
Sbjct: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312

Query: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXXSMDE 368
             +LAE+++ISL+IANDPDADRFSVA K+ ++G WQQL+GNEIG            S D 
Sbjct: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDI 372

Query: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428
           ++++THPLAM++STVSSQMIK+MA+VE FHYEDTLTGFKWIGNRA+ L+ +GYYVPFGFE
Sbjct: 373 EWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGFE 432

Query: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488
           EAIGYMFP M  DKDG+SA+VVFL AY  W   +   P ++LE GFKK+G FKEYNGYYI
Sbjct: 433 EAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGYYI 492

Query: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548
             +P  TK+IF ++R  Y     PYP  IG+E ++  +RDLTTGYQS+T+D+ P LPVDP
Sbjct: 493 YDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVDP 552

Query: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608
            S+MIT+ A P    G   +RFT+RGSGTEPKLK+YIE  A+ E+ A  LA   W+VL++
Sbjct: 553 HSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLKK 612

Query: 609 EWFRPEKTNITTNF 622
           EW RP+ T +TT F
Sbjct: 613 EWIRPDVTGLTTTF 626

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/622 (60%), Positives = 468/622 (75%), Gaps = 3/622 (0%)

Query: 3   QQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRS 62
           +  L +IP DLK  I +WF  D + ET++EV  LC     DELHKRFD RI FGTAGLRS
Sbjct: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68

Query: 63  QMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKG 122
           +M+AGF+RMN L ++Q++QGLA+YI+ QFP+NL AVVGHDHR+HSK+FA+ TA  FL  G
Sbjct: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128

Query: 123 FKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV+YLNP  EFVHTP+VPF ++  +AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188

Query: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLV-ETTPLK 241
           + I+  I+ NLEP ++ WN + ++SK ++  KL+YS+E++L+ Y+  +   ++ +   L 
Sbjct: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248

Query: 242 LEVRSK-PWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
             ++ K PWFVYTPMHGVG+ IF  I    + LVE  DY+CV EQ  PDPSFPTV FPNP
Sbjct: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EEKGAL++G++ A+KH+I L++ANDPDADRFSVA+++  +  +QQLTGNEIG        
Sbjct: 309 EEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLW 368

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
                +   F+   PLAM++STVSSQMIK+MAEVEGF+YEDTLTGFKWIGN+A  LEKEG
Sbjct: 369 EQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEG 428

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           YYVPFGFEEAIGYMFP ME DKDGI+A+VVFLQAY  W + N     +++E GFKKYGVF
Sbjct: 429 YYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVF 488

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
           KEYNGYYIV +  +TK IF  IR+    +   Y  +IG E +V+ +RDLT GYQSDT+ +
Sbjct: 489 KEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGN 547

Query: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600
            PTLPVDP+SQMIT+   P     N  +RFTIRGSGTEPKLKVYIE  A  E  A+ LAK
Sbjct: 548 VPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAK 607

Query: 601 LTWDVLRREWFRPEKTNITTNF 622
           LTWDVL+REWF  EKT +TTNF
Sbjct: 608 LTWDVLKREWFSSEKTGLTTNF 629

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/614 (59%), Positives = 460/614 (74%), Gaps = 8/614 (1%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           IP +LK PISLW  QDR+ +T +E+  LC   +W ELH+R ++R+QFGTAGLR++M+AGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           SRMN LV+IQA+QGLA YI++QFP++LVAVVGHDHRF+S  FA+ATAT  L  GF+VHYL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188
           N G  +VHTP+VPF VD + ASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ +
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248
           I+ NLEP    W++D  + +   +GKL+Y R++ML+ Y+  + D+ V  T L    + KP
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKGKP 242

Query: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308
           WFVYTPMHGVG+ +F  I  K + L   +D+L V EQ NPDP FPTV FPNPEEKGAL++
Sbjct: 243 WFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALDL 302

Query: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXXSMDE 368
            ++LAE H I L+IA+DPDADRFSVA K      WQQL+GN+IG              D 
Sbjct: 303 AIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFDA 360

Query: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428
           ++Q++HPLAML+STVSSQMI  MA +EGFH+EDTLTGFKWIGNRA+ LE  GYYVPFGFE
Sbjct: 361 EYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGFE 420

Query: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488
           EAIGYMFPA EHDKDGISA+VVFLQAY  W ++    P+++L+    KYGVF+EYNGYY+
Sbjct: 421 EAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYYL 479

Query: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548
           V  P +T + F YIR+ YTP+   YP  IG +++V  +RDLTTGYQSDT ++ P L VDP
Sbjct: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVDP 538

Query: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608
           +SQMIT+ A+P      EH+RFT+RGSGTEPKLKVYIE  A  + RA  LA+ TWD+LR 
Sbjct: 539 SSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILRE 598

Query: 609 EWFRPEKTNITTNF 622
           EWF   +  +TT F
Sbjct: 599 EWFN--RPGLTTKF 610

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/620 (59%), Positives = 457/620 (73%), Gaps = 2/620 (0%)

Query: 4   QFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQ 63
             L   P  L+  I  W   D++ ET  EV  LC++ DW EL+ RF  RI FGTAGLRS+
Sbjct: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66

Query: 64  MQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGF 123
           M+AG +R+N+LVI+QA+QGLA YI  QFP N VAVVGHDHRFHSK+FA  TA  FL  GF
Sbjct: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126

Query: 124 KVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183
           KV YLNPG   VHTPLVPF VD LNASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186

Query: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243
            I+ +ID NLEPW  +W++  ++    K+ +++Y +++M +LY +     L+    +   
Sbjct: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246

Query: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303
             S PWFVYTPMHGVG +IFS I +  + + E +DYLCVPEQ++PDPSFPTV FPNPEEK
Sbjct: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306

Query: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXX 363
           GAL+  + LA ++ I+L+IANDPDADRFS+A+ D ++  W+QLTGNEIG           
Sbjct: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366

Query: 364 XSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423
            +MD+ FQ+ HPL +L+STVSSQMIK+MAEVEGFHYEDTLTGFKWIGNRA  LEK+G++ 
Sbjct: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426

Query: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483
           PFG+EEAIGYMF  MEHDKDGISAS++FL +Y  W    +  P+++LE+G+KKYGVFKEY
Sbjct: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486

Query: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543
           NGYYIV NP + KE F YIR+   P    YP  IG E +V+ +RDLT G+QSDT DH PT
Sbjct: 487 NGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545

Query: 544 LPVDPTSQMITVFARP-NDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLT 602
           LPVDP SQMITV A+P +D+   +H+RFTIRGSGTEPKLKVYIE  +  E  A  LAK  
Sbjct: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605

Query: 603 WDVLRREWFRPEKTNITTNF 622
           WD L+  WFRP+ T + T+F
Sbjct: 606 WDTLQEVWFRPQTTGLVTDF 625

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/615 (58%), Positives = 452/615 (73%), Gaps = 4/615 (0%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           IP +L+  I  W   D++ ET  EV  LC   +WDELHKRFD+RI FGTAGLR++M+AG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           +R+N LVI+QASQGLATYI+ +FP NL AVVGHDHR+HS++FA+ TA  F+  GFKV+YL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188
           NP  EFVHTP+VP++VD LNASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHD  I+  
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248
           I+ NLEPW+  WNF  ILS     GK+ Y R+ ML  YL  + + L++      +   KP
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243

Query: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308
           WFVYTPMHGVG  IFSTI+ +S+ L +  DY+ VPEQ++PDPSF TV FPNPEEKGALN+
Sbjct: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303

Query: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXXSMDE 368
            + LAE + I L++ANDP+ADRFSVA++D     W+QLTGNEIG               +
Sbjct: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363

Query: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428
           +  +  PLAML+STVS+Q+IKRMAE EGF Y+DTLTGFKWIGN A  LE++GY+VPFG+E
Sbjct: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423

Query: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488
           EAIGYMFPAMEHDKDG+SA++VFLQAY  W L ++ +PI+++   + KYGV  EYNGYYI
Sbjct: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYI 482

Query: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548
           V +P  T ++F+ IR  YT   + +P  IGE  RV  +RDLT G+ S T D KP LPVD 
Sbjct: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542

Query: 549 TSQMITVFARPND-SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLR 607
            SQMIT+ A P+  SN  E +RFTIRGSGTEPKLKVYIE  ++ E RA  LAK  W+ L+
Sbjct: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602

Query: 608 REWFRPEKTNITTNF 622
            EWF+P    ++T+F
Sbjct: 603 HEWFKPSSNGLSTDF 617

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/642 (57%), Positives = 465/642 (72%), Gaps = 25/642 (3%)

Query: 3   QQFLGTI---PSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAG 59
           QQF   I   P DL+  + LW +QD+D  T +E+  LCK ++  ELH+RFD+RI FGTAG
Sbjct: 5   QQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAG 64

Query: 60  LRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNN---LVAVVGHDHRFHSKKFARATAT 116
           LRS M+AGFSRMN L ++QASQGLATY++    N    L+AV+GHDHR+HSK+FA+  AT
Sbjct: 65  LRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAAT 124

Query: 117 AFLLKGFKVHYLNPGQ-------EFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKV 169
            FL+ GFKV+YLN          +FVHTP+VPF V  L ASVGVM+TASHNPKMDNGYKV
Sbjct: 125 VFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKV 184

Query: 170 YYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEK 229
           YYSNGCQIIPPHD  IS  ID NLEPW N+WN+ +I++    +G L+Y R+ ML  Y+ +
Sbjct: 185 YYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQ 244

Query: 230 ISDNLVETTPL----KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQ 285
           + + L     +    K++V+SKPWFVYTPMHGVG++IF+ I  + + + EG+D++ V EQ
Sbjct: 245 LEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQ 304

Query: 286 QNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQS-GMWQ 344
           ++PDP FPTV FPNPEEKGA+++G++LAE + ISL+IANDPDADRFS+A+K   S G W 
Sbjct: 305 KHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWH 364

Query: 345 QLTGNEIGXXXXXXXXXXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLT 404
           Q TGNEIG                  Q  H L M++STVSSQMIK+MAE+EGF+YE+TLT
Sbjct: 365 QFTGNEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLT 421

Query: 405 GFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNL 464
           GFKWIGNRAI L  +G  VPFG+EEAIGYMFP ME DKDGI+A+V+F+QA+  W   + +
Sbjct: 422 GFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKM 481

Query: 465 DPINVLENGFKKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVY----TPRNVPYPPYIGEE 520
           DP  +++ GFKKYGVF EYNGYY   +  +TK+IF Y+R  Y    +  N  YP +IGEE
Sbjct: 482 DPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEE 541

Query: 521 IRVLCYRDLTTGYQSDTLDHKPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPK 580
            +++ YRDLTTGYQSDT D+KP LPVDP+SQMITV   P D+  +  IR TIRGSGTEPK
Sbjct: 542 FKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPK 601

Query: 581 LKVYIETRANEERRASFLAKLTWDVLRREWFRPEKTNITTNF 622
           LKVYIE  +     ASFLAK  W+VL+REW RPE+T ITT F
Sbjct: 602 LKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/614 (58%), Positives = 439/614 (71%), Gaps = 4/614 (0%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           +P  LK     W   D++ ET  E+  +  + DW EL  R + RI FGTAGLR +M+AGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           +RMN+LVI+Q SQGLA YI ++FP NL  VVGHDHR+HSK+FA  T   FL  GFKV YL
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188
           N   EFVHTPLVP++VD+L ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD+ I+  
Sbjct: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194

Query: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248
           I+ NL PW+  WN+ D+ S   + G L ++  +M   Y++ I+   V T    +    KP
Sbjct: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDIT-RYVFTNGSPMLKTGKP 253

Query: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308
           WFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ  PDPSFPTV FPNPEEKGAL++
Sbjct: 254 WFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDM 313

Query: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXXSMDE 368
            ++LAE+  ++L+IANDPDADRFS A+KD +S  W+QL+GNEIG               E
Sbjct: 314 AIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQ---EHKE 370

Query: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428
           +     PLAML+STVSSQM+K+MA+VEGFHYE+TLTGFKWIGNRA+ LE++GY V FG+E
Sbjct: 371 KAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYE 430

Query: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488
           EAIGYMFP MEHDKDGI ASVVFL  Y KW     L P++VL+  F+KYGVF EYNGYY 
Sbjct: 431 EAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYT 490

Query: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548
           V  P + + +F YIRD Y P+  PYP  +G E  +  +RDLT GYQSDT+D KPTLPVD 
Sbjct: 491 VEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDA 550

Query: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608
           +SQMIT   +P  + G+E IRFTIRGSGTEPKLKVYIE+ A  +  A+ LA LTW+VLRR
Sbjct: 551 SSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRR 610

Query: 609 EWFRPEKTNITTNF 622
           EWFRPE T + T+F
Sbjct: 611 EWFRPEITGLKTSF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/623 (56%), Positives = 445/623 (71%), Gaps = 19/623 (3%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           IP+DLK  +  WF+ D++ ET  E+  L  + +W+ELHKR D RI FGTAGLRS+M+AGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           SRMN L ++QASQGLA YI ++FP N    VGHDHRF+S+ FA  T+ AFL   FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 129 ----NPGQE-FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183
               +P ++ FVHTP+VPFA+D L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD+
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243
            I+ +I  NL PW  AW+   ++++  ++G  +  ++ M+  Y+++ISD LV +    + 
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS---DIG 244

Query: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303
            RSKPWFVYTP+HGVGF+IF  I  + + LVEG+DY CV E + PDP+FPTV FPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXX 363
           GAL++ + LA+K+ IS ++ NDPDADRFS A+K    G W+QLTGNEIG           
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362

Query: 364 XSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423
                +F+  +PLA+++STVSSQMIK++A VE FHYEDTLTGFKW+GNRA  LE  GYYV
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483
           PF +EEAIG+MF  + HDKDG+SA+VVFLQ    WK    L PI+VL++ F KYGVFKEY
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWK-KQALSPIDVLQSAFGKYGVFKEY 481

Query: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543
           NGYY VP+  +T  IF  IR  Y      YP +IG +  V+ + DLT G+QSDT D+ P 
Sbjct: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537

Query: 544 LPVDPTSQMITVFARPNDSNGN----EHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599
           LPVDP+SQMI     P+ S G+    E +RFT RGSGTEPKLKVYIE  + EE RAS LA
Sbjct: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597

Query: 600 KLTWDVLRREWFRPEKTNITTNF 622
           + TW+VLR EWF+P++T ++T F
Sbjct: 598 RTTWNVLRDEWFKPKETGLSTKF 620

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/623 (56%), Positives = 443/623 (71%), Gaps = 19/623 (3%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           +P DLK  +  W   D++ +T +++  L +   W EL  R + RI FGTAGLRS+M+AGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           +RMN L ++QASQGLA YI   FP+NL  VVGHDHRF+SK FA  T  AFL  GFKV+ L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 129 NPGQE-----FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183
              ++      VHTP+VPF +D L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHDQ
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243
            IS +I  NLEPW  AW+   + ++ ++   L+ +++ ++  Y++ +  +LV T    + 
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN---VN 245

Query: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303
               PWFVYTP+HGVGF+IF  I+  +  L +G+DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305

Query: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXX 363
           GAL+  + LAEKHDI+ ++ NDPDADRFSVA K   +G W+QLTGNEIG           
Sbjct: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363

Query: 364 XSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423
               ++F+ T+PLAM++STVSSQMIK+MAEVEGFHYEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423

Query: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483
           PF +EEAIGYMF  + HDKDGISA+VVFLQ    WK A  L P +VL+  ++KYGVFKEY
Sbjct: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWK-AQALTPFDVLQRAYQKYGVFKEY 482

Query: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543
           NGYYIVP+  +T ++F  IR  ++ +    P +IG+E RV  Y DLTTGYQS+T D +P 
Sbjct: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538

Query: 544 LPVDPTSQMITVFARPNDSNG----NEHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599
           LPVDP+SQMIT    P  S G    +E +RFT RGSGTEPKLKVYIE  ++ E  AS LA
Sbjct: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALA 598

Query: 600 KLTWDVLRREWFRPEKTNITTNF 622
           K  WDVLRREWF+PE+T + TNF
Sbjct: 599 KKAWDVLRREWFKPEQTGLATNF 621

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/632 (54%), Positives = 438/632 (69%), Gaps = 43/632 (6%)

Query: 4   QFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQ 63
           + + ++PSDL+G +  W   D+  ET  E+  LC K D  ELHKR DT I FGTAGLR +
Sbjct: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64

Query: 64  MQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGF 123
           M+AGF+RMN L + QASQGLA YI++QFP NL  VVGHDHR +S+ F + T   FL  GF
Sbjct: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124

Query: 124 KVHYLNPGQE--FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           KV +LN   E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184

Query: 182 DQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK 241
           D+ I+ +I  NLEP+++            + G ++  +E+M K Y++ I   L++    K
Sbjct: 185 DKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAVNK 233

Query: 242 LEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPE 301
               ++PWFVYTPMHGVGF+IF +I K+ + L EGKDYL V EQ+ PD  FPTV FPNPE
Sbjct: 234 --KTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291

Query: 302 EKGALNIGMRLAEKHD-ISLLIANDPDADRFSVAIKDMQ---SGMWQQLTGNEIGXXXXX 357
           EKGAL++ +    K+D + L+IANDPDADRFSVA++D     +  W+QLTGNEIG     
Sbjct: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351

Query: 358 XXXXXXXSMDEQFQQT---HPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAI 414
                     E+++ +    PLAML+STVSSQMIKRMAE+EGFHYEDTLTGFKW+GNRA+
Sbjct: 352 YEW-------ERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRAL 404

Query: 415 ILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGF 474
            LE+EGYY PF +EEAIGYMF ++ HDKDGISA++VFLQAY KW+ A+    +++L    
Sbjct: 405 ELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWR-ASGQTVLDILATAS 463

Query: 475 KKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQ 534
            KYG FKE+NGYYIVP+  +TK++F  IR + +    PYP  +G    ++ +RDLT GYQ
Sbjct: 464 LKYGHFKEFNGYYIVPDLAITKQVFDAIRSIES----PYPKKLGSSFEIIKFRDLTNGYQ 519

Query: 535 SDTLDHKPTLPVDPTSQMIT----VFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRAN 590
           SDT DH P L  DP+SQMIT    +  +P        +RFTIRGSGTEPKLKVYIE R N
Sbjct: 520 SDTPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTN 574

Query: 591 EERRASFLAKLTWDVLRREWFRPEKTNITTNF 622
            E  +  LAK TWDVLR+EWF+PE T + T F
Sbjct: 575 TEPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/629 (54%), Positives = 428/629 (68%), Gaps = 25/629 (3%)

Query: 8   TIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAG 67
            +PS LK  +  W   D++ ET  E+  L     WDEL KR   RI FGTAGLR++M+AG
Sbjct: 7   AVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAG 66

Query: 68  FSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHY 127
           FSRMN L +IQASQGLA YI+ QFP++L  V+GHDHRFHS++FA AT  AFL   + ++Y
Sbjct: 67  FSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYY 126

Query: 128 LN---PGQE---FVHTPLVPFAVDELNA---SVGVMITASHNPKMDNGYKVYYSNGCQII 178
           LN   PG +   FVHTP+VPFA++ +     S GVMITASHNPKMDNGYKVYY+NGCQII
Sbjct: 127 LNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186

Query: 179 PPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETT 238
           PPHD+ I   ID NLEPW  AW+   ++ + +K GKL   R+EML+ Y + I   LV+ +
Sbjct: 187 PPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS 246

Query: 239 PLKLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFP 298
            LK      PWFVYTPMHGVG++ F   V   + + E KDY+ VPEQ+ PDP FPTV FP
Sbjct: 247 NLKFA--GGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFP 304

Query: 299 NPEEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXX 358
           NPEE+GAL++ M++A+ + I++++ANDPDADRFSVA+K    G W QLTGN+IG      
Sbjct: 305 NPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIG------ 356

Query: 359 XXXXXXSMDEQFQQ----THPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAI 414
                  M   F++       LAML+S VSSQ++++MAE EGF   +TLTGFKW+GNRA 
Sbjct: 357 ILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416

Query: 415 ILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGF 474
            LE EGYYVPF +EEAIGYMF  + HDKDGI+A+ VFLQ   +WK         VL+  +
Sbjct: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECY 475

Query: 475 KKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQ 534
           +KYG F +YNGYYI   P VTKE+F Y R+ YTP   PYP +IG E  V   RDLT GYQ
Sbjct: 476 EKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQ 535

Query: 535 SDTLDHKPTLPVDPTSQMITVFARPNDSNGN-EHIRFTIRGSGTEPKLKVYIETRANEER 593
           SDT  + P LPVD  SQMIT   +P     + E +RFT RGSGTEPKLKVYIE+ A   +
Sbjct: 536 SDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595

Query: 594 RASFLAKLTWDVLRREWFRPEKTNITTNF 622
           RAS L+ L WDVL+REWFRP +T + TNF
Sbjct: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/626 (53%), Positives = 428/626 (68%), Gaps = 20/626 (3%)

Query: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68
           IP DL+  I  WF  D++P+T  E+ +L    +W+EL  R   RI FGTAGLR++M+AGF
Sbjct: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72

Query: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128
           +RMN L +IQASQGLATYI+ QFPNNL  VVGHDHR++SK FA     AFL  GF+V+YL
Sbjct: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132

Query: 129 N--PG----QEFVHTPLVPFAVD--ELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           N  P     + +VHTP+VPF V   E  AS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192

Query: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240
           HD+ I++ ID NL PW  AW+   ++       +L   ++E++K Y+++I  +LV T   
Sbjct: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN-- 250

Query: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300
            L    K WFVYTPMHGVG++IF+ IV  ++ L E + YL V  Q+ PDP F TV FPNP
Sbjct: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310

Query: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXX 360
           EE+GALN+ + LA +    L++ANDPDADRFS A+KD     W+QLTGN++G        
Sbjct: 311 EEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVGQL 368

Query: 361 XXXXSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420
               + +E      PLAML STVSSQMI +MA+VEGF + +TLTGFKW+ NRAI LE +G
Sbjct: 369 EKFSNQNE---NKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480
           +YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK      P++VL  G++KYG F
Sbjct: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYGNF 484

Query: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540
            EYNGYY V +  +  ++FKYIR+     +VPYP  IG E  V  +RDLT GYQSDT +H
Sbjct: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544

Query: 541 KPTLPVDPTSQMITVFARP----NDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRAS 596
            P LPV P S MIT   +P         ++++RFTIRGSGTEPKLKVYIE+ A ++  A+
Sbjct: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604

Query: 597 FLAKLTWDVLRREWFRPEKTNITTNF 622
            LAKLTWDVL+REWFRPE T + T F
Sbjct: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 126/296 (42%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +   +  N       ++     I    P    N   VVG D RF++    +
Sbjct: 19  GTSGLRKKSKVFMNEPN------YTENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVMITASHN---PKMDNG 166
             A      G  V  L  GQ   + TP     +   +  V  G+++TASHN   P+ D G
Sbjct: 73  LIAEIGAANG--VRKLIIGQAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMY-- 217
            K   +NG     P  ++++NAI     NL  +    +F  I    +S+N+K G L+   
Sbjct: 131 IKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDI 186

Query: 218 --SREEMLKLYLEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLV 274
             S E+ +K +L++I D  +    ++ + ++  W  ++  ++GV       I      L 
Sbjct: 187 IDSTEDYVK-FLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
             +    V +  +P P F  +  P+P    A  +  R+ +K  I    A+D D DR
Sbjct: 246 ADE----VLQNWHPQPDFGGL-HPDPNLTYARTLVDRV-DKEKIEFGAASDGDGDR 295

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 106/257 (41%), Gaps = 30/257 (11%)

Query: 92  PNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQEFVHTPLVPFAV----DEL 147
           P+    VVG D RF++       A      G +   +  G   + TP     +    D  
Sbjct: 52  PDGATLVVGGDGRFYNDVIMNKIAAVGAANGIRKLIIGQGG-LLSTPAASHIIRTYEDRC 110

Query: 148 NASVGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWN 201
           N   G+++TASHN   P+ D G K    NG     P  ++++NAI      L  +    N
Sbjct: 111 NGG-GIILTASHNPGGPENDLGIKYNLRNGG----PAPESVTNAIWEASKKLTHYKIVTN 165

Query: 202 FDDI----LSKNLKQGKLMYSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYT 253
           F ++    L KN   G L+    +  + Y   L++I D  +  + L  + R+K W  ++ 
Sbjct: 166 FPELDMNKLGKNQNYGPLLVDIIDPARAYVQFLKEIFDFDLIKSFLTEQRRTKGWKLLFD 225

Query: 254 PMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLA 313
            ++G+       I      L   +    V +  +P P F  +  P+P    A  +  R+ 
Sbjct: 226 SLNGITGPYGKAIFVDEFGLPAEE----VLQNWHPLPDFGGL-HPDPNLTYARTLVSRV- 279

Query: 314 EKHDISLLIANDPDADR 330
           ++  I+   A+D D DR
Sbjct: 280 DREKIAFGAASDGDGDR 296

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 110/257 (42%), Gaps = 30/257 (11%)

Query: 92  PNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQEFVHTPLVPFAV---DELN 148
           P  +  VVG D RF++       A      G +   +  G   + TP     +   ++  
Sbjct: 52  PGGVTLVVGGDGRFYNDVIMNKIAAVGAANGVRKLVIGQGG-LLSTPAASHVIRTYEDKC 110

Query: 149 ASVGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNF 202
           +  G+++TASHN   P+ D G K    NG     P  ++++NAI      L  +    +F
Sbjct: 111 SGGGIILTASHNPGGPENDLGIKYNLPNGG----PAPESVTNAIWEASKKLTHYKIIKDF 166

Query: 203 DDI----LSKNLKQGKLMYSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTP 254
            ++    L KN + G L+    E  K Y   L++I D  +    LK + R K W  ++  
Sbjct: 167 PELNLNKLGKNQRYGPLLVDIIEPAKAYVQLLKEIFDFDLIRGFLKEQRRVKGWKLLFDS 226

Query: 255 MHGVGFDIFSTIVKKSMCLVE-GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLA 313
           ++G+     +    K++ + E G     V +  +P P F  +  P+P    A  +  R+ 
Sbjct: 227 LNGI-----TGPYGKALFVDEFGLPAEEVLQNWHPLPDFGGL-HPDPNLTYAHTLVDRV- 279

Query: 314 EKHDISLLIANDPDADR 330
           ++  I    A+D D DR
Sbjct: 280 DREKIEFGAASDGDGDR 296

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 119/296 (40%), Gaps = 39/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLV-IIQASQGLATYIRQQFPNN---LVAVVGHDHRFHSKKFA 111
           GT+GLR + +      +     IQA+        Q  PN       VVG D RF++    
Sbjct: 19  GTSGLRKKTKVFMDEPHYTENFIQATM-------QSIPNGSEGTTLVVGGDGRFYNDVIM 71

Query: 112 RATATAFLLKGFKVHYLNPGQEFVHTPLVPFAV---DELNASVGVMITASHN---PKMDN 165
              A      G +   +  G   + TP     +   +E     G+++TASHN   P+ D 
Sbjct: 72  NKIAAVGAANGVRKLVIGQGG-LLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPENDL 130

Query: 166 GYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMYS 218
           G K    NG     P  ++++NAI      L  +    NF  +    L KN K G L+  
Sbjct: 131 GIKYNLPNGG----PAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGPLLVD 186

Query: 219 REEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLV 274
             +  K Y   L++I D  +  + L  + + K W  ++  ++G+       I      L 
Sbjct: 187 IIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDEFGLP 246

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
             +    V +  +P P F  +  P+P    A  +  R+ ++  I+   A+D D DR
Sbjct: 247 AEE----VLQNWHPLPDFGGL-HPDPNLTYARTLVDRV-DREKIAFGAASDGDGDR 296

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANA 100

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANA 100

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 121/295 (41%), Gaps = 38/295 (12%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +  F    N      ++     I +  P        VVG D R+++     
Sbjct: 19  GTSGLRKKTKV-FKDQPNY-----TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 113 ATATAFLLKGFKVHYLNPGQ-EFVHTPLVPFAVD--ELNASVGVMITASHN---PKMDNG 166
             A      G K   L  GQ   + TP     +   E   + G+++TASHN   P+ D G
Sbjct: 73  KIAAIGSANGIK--KLVIGQYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI----LSKNLKQGKLMYSR 219
            K   SNG     P  ++++NA   I   L  +    +F ++    + KN K G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDV 186

Query: 220 EEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLVE 275
            ++ K Y   L+KI D  +    +  +  +K W  ++  M+GV       I      L  
Sbjct: 187 IDITKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
            +    V +  +P P F  +  P+P    A ++  R+ ++  I    A+D D DR
Sbjct: 247 EE----VLQNWHPSPDFGGM-HPDPNLTYASSLVKRV-DREKIEFGAASDGDGDR 295

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 120/298 (40%), Gaps = 41/298 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR +       MNN   +  ++     I    P    + + VVG D R+++ K  +
Sbjct: 17  GTSGLRKKTAV---FMNN---VHYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAV------DELNASVGVMITASHN---PK 162
             A      G  V  L  GQ   + TP     +      D    + G+++TASHN   P+
Sbjct: 71  IIAAISAANG--VRKLVIGQHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPE 128

Query: 163 MDNGYKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI---LSKNLKQGKLM 216
            D G K   SNG     P  ++++NA   I   L  +     F +I   +      G L+
Sbjct: 129 NDIGIKYNLSNGG----PAPESVTNAIWDISKKLTHYKIVKGFPEINLSVKGEKSYGSLV 184

Query: 217 YSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMC 272
               +  + Y   L+ I D  +    +  +  +K W  ++  ++GV       I    + 
Sbjct: 185 IDVVDTTQEYVDFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFVDELG 244

Query: 273 LVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
           L E +    V +  +P P F  +  P+P    A  +  R+ +K  I    A+D D DR
Sbjct: 245 LPENE----VLQNCHPKPDFGGI-HPDPNLTYARTLVDRV-DKEKIEFGAASDGDGDR 296

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNF 202
           +GVMITASHNP  DNG K+   +G  +I   +Q     I  +L   A+  NF
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQ-----IATDLANIASHGNF 105

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANA 100

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>TPHA0B01160 Chr2 complement(263016..264194) [1179 bp, 392 aa] {ON}
           Anc_1.229 YJL125C
          Length = 392

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 84  ATYIRQQF---PNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQEFVHTPLV 140
           ++YI Q+F   PN  V   G      S  FAR++   F  +  +V Y    +EF    L+
Sbjct: 98  SSYIMQRFNCGPNTRVIEAGTGSGSFSHAFARSSNHLFTFEFHEVRYEQALEEFQDHGLI 157

Query: 141 PFAVDELNASVGVMITASHNPKMDNGYKVYYSNGC--QIIPPHDQAISNAIDMNLE---P 195
                + N +    +T +H    +NG+ +  ++    +     D+   NA  + L+   P
Sbjct: 158 GNDDAKSNEAFK-NVTITHRDVCENGFTIKQTDKTSYKFAEGEDEVKINANVVFLDLPAP 216

Query: 196 WANAWNFDDILSKNLKQGKLMYS 218
           W    N D ++SKN K G   +S
Sbjct: 217 WNAIPNLDQVISKNEKVGVCCFS 239

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 122/298 (40%), Gaps = 44/298 (14%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +   +  N       ++     I    P    +   VVG D RF++    +
Sbjct: 19  GTSGLRKKTKIFMNEPN------YTENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVMITASHN---PKMDNG 166
             A      G  V  L  GQ   + TP     +   +  V  G+++TASHN   P+ D G
Sbjct: 73  LIAEIGAANG--VRKLIIGQAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMYSR 219
            K   +NG     P  ++++NAI      L  +    NF  I    +S+N+K G L+   
Sbjct: 131 IKYNLANGA----PAPESVTNAIWEESKKLTTYKIIKNFPKIDINTISENVKYGPLLVDI 186

Query: 220 EEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLVE 275
            E  + ++E    I D  +    ++ + ++K W  ++  ++GV       +      L  
Sbjct: 187 IEPTEAHVELLKGIFDFPLIKKFIETQRKTKNWKLLFDSLNGVTGPYGKAVFVDEFGLPA 246

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHD---ISLLIANDPDADR 330
            +    V +  +P P F  +  P+P     L  G  L ++ D   I    A+D D DR
Sbjct: 247 DE----VLQNWHPQPDFGGL-HPDPN----LTYGRTLVDRVDKEKIEFGAASDGDGDR 295

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 104/250 (41%), Gaps = 29/250 (11%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD--ELNASVGVM 154
           VVG D R+++       A      G K   L  GQ   + TP     +   E     G++
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVK--KLVIGQRGLLSTPAASHIMRTYEEKTQGGII 115

Query: 155 ITASHNP---KMDNGYKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI--- 205
           +TASHNP   K D G K   SNG     P  + ++N    I   +  +    +F ++   
Sbjct: 116 LTASHNPGGIKNDMGIKFNLSNGG----PAPEPVTNKIWEISKKMTSFKIIKDFPELELE 171

Query: 206 -LSKNLKQGKLMYSREEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHGVGF 260
            L KN K G L+    +  K Y+E   +I D  +    +  +  +K W  ++  M+GV  
Sbjct: 172 TLGKNKKYGPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTG 231

Query: 261 DIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISL 320
                I    + L   +    V +Q +P P F  V  P+P    A  +  R+ ++ +I  
Sbjct: 232 PYGKAIFVDELGLPADE----VLQQWHPSPDFGGV-HPDPNLTYAKALVDRV-DRENIEF 285

Query: 321 LIANDPDADR 330
             A+D D DR
Sbjct: 286 GAASDGDGDR 295

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 108/251 (43%), Gaps = 31/251 (12%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD--ELNASVGVM 154
           VVG D R+++       A      G K   L  GQ   + TP     +   E   + G++
Sbjct: 58  VVGGDGRYYNDVILHKIAAISAANGVK--KLVIGQHGLLSTPAASHIMRTYEDKCTGGII 115

Query: 155 ITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI--- 205
           +TASHN   P+ D G K   SNG     P  ++++NA   I   L  +    +F ++   
Sbjct: 116 LTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIVKDFPELDLQ 171

Query: 206 -LSKNLKQGKLMYSREEMLKLYLEKISD----NLVETTPLKLEVRSKPW-FVYTPMHGVG 259
            + K+ K G L+    ++ K Y+E + +    NL++   +  +  +K W  ++  M+GV 
Sbjct: 172 TIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKF-IDNQRSTKNWKLLFDSMNGVT 230

Query: 260 FDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDIS 319
                 I      L   +    V +  +P P F  +  P+P    A ++  R+ ++  I 
Sbjct: 231 GPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGM-HPDPNLTYASSLVKRV-DREQIE 284

Query: 320 LLIANDPDADR 330
              A+D D DR
Sbjct: 285 FGAASDGDGDR 295

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISN 187
           VGVMITASHNP  DNG K+   +G  ++    P+   ++N
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLAN 99

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 119/299 (39%), Gaps = 45/299 (15%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +   S  N       ++     I    PN   N   VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV---GVMITASHN---PKMDN 165
                    G  V  L  GQ   + TP   + +     S    G+++TASHN   P+ D 
Sbjct: 73  KIMQISAANG--VRKLVIGQNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDI 130

Query: 166 GYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMYS 218
           G K   SNG     P  ++I++ I     +L  +    N   +    +S+N+K G L+  
Sbjct: 131 GIKYNLSNGG----PAPESITDEIWEASKHLTHYKIIENLPQLDTTKVSENVKYGPLLVD 186

Query: 219 REEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLV 274
             +  K Y+E   +I D  +    +  +     W  ++  ++GV      TI    + L+
Sbjct: 187 IIDSTKSYVELMKEIFDFPLIRNFIHTQREKNNWKLLFDSLNGVTGPYGKTIFVDELGLL 246

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHD---ISLLIANDPDADR 330
             +      +  +P P F  +  P+P     L     L E+ D   I+   A+D D DR
Sbjct: 247 ADETL----QNWHPLPDFGGL-HPDPN----LTYAHTLVERVDREMINFGAASDGDGDR 296

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 121/295 (41%), Gaps = 38/295 (12%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +  F    N      ++     I +  P        VVG D R+++     
Sbjct: 19  GTSGLRKKTKV-FKDEPNY-----TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD--ELNASVGVMITASHN---PKMDNG 166
             A      G K   L  GQ   + TP     +   E   + G+++TASHN   P+ D G
Sbjct: 73  KIAAIGAANGIK--KLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI----LSKNLKQGKLMYSR 219
            K   SNG     P  ++++NA   I   L  +    +F ++    + KN K G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDI 186

Query: 220 EEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLVE 275
            ++ K Y   L++I D  +    +  +  +K W  ++  M+GV       I      L  
Sbjct: 187 IDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
            +    V +  +P P F  +  P+P    A ++  R+ ++  I    A+D D DR
Sbjct: 247 DE----VLQNWHPSPDFGGM-HPDPNLTYASSLVKRV-DREKIEFGAASDGDGDR 295

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 106/250 (42%), Gaps = 29/250 (11%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVM 154
           VVG D R+++       A      G K   L  GQ   + TP     +   +  V  G++
Sbjct: 58  VVGGDGRYYNDVILEKIAKIGAANGVK--KLVVGQNGLLSTPAASHIIRSYHEKVTGGII 115

Query: 155 ITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDI------ 205
           +TASHN   PK D G K   +NG     P  +++++ I  N +   +     D+      
Sbjct: 116 LTASHNPGGPKNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTS 171

Query: 206 -LSKNLKQGKLMYSREEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHGVGF 260
            + +N K G ++    ++ K Y+E   +I D  +    +  + ++K W  ++  ++G+  
Sbjct: 172 KIGENQKYGPILIDVIDVTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITG 231

Query: 261 DIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISL 320
                I      L E +    V +  +P P F  +  P+P    A ++  R+ +K  I  
Sbjct: 232 PYGKAIFVDEFELPENE----VLQNYHPQPDFGGL-HPDPNLTYARSLVDRV-DKEKIEF 285

Query: 321 LIANDPDADR 330
             A+D D DR
Sbjct: 286 GAASDGDGDR 295

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 121/297 (40%), Gaps = 41/297 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLV--IIQASQGLATYIRQQFPNNL---VAVVGHDHRFHSKKF 110
           GT+GLR +  A F +  N     IQA       I +  P        VVG D R+++   
Sbjct: 20  GTSGLRKKT-AIFEKEPNYTENFIQA-------IMEAIPEGCKGATLVVGGDGRYYNDAI 71

Query: 111 ARATATAFLLKGFKVHYLNPGQE-FVHTPLVP-----FAVDELNASVGVMITASHN---P 161
               A      G  V  L  GQ   + TP        +A  E+    G+++TASHN   P
Sbjct: 72  LHNIAAIGAANG--VKKLIVGQNGLLSTPAASHIIRTYAPGEITG--GIILTASHNPGGP 127

Query: 162 KMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDI----LSKNLKQGKLMY 217
           K D G K    NG     P  +AI  A    L+ +    +F ++    L KN + G L+ 
Sbjct: 128 KNDMGIKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLV 186

Query: 218 SREEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCL 273
              +  + Y++   +I D  +    +  + ++K W  ++  M+GV       I    + L
Sbjct: 187 DVIDTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGL 246

Query: 274 VEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
              +    V +  +P P F     P+P    A ++  R+ +K  I    A+D D DR
Sbjct: 247 PADE----VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRV-DKEKIEFGAASDGDGDR 297

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 148 NASVGVMITASHNPKMDNGYKVYYSNGC----QIIPPHDQAISNAIDMNLEPWANAWNFD 203
            A VGVM+TASHNP  DNG KV    G     Q  P   +  + A +   + W   W   
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWT-S 113

Query: 204 DILSKNLKQGKLMY----SREEMLKLYLEKISDNLVETTPLKLEVRSKPWFVYTP 254
            +   N   G  +     +RE   +L L+ + D  +  +   + + SKPW    P
Sbjct: 114 LVEEGNYTGGARLCVGHDTRESSPRL-LKNLMDAALAVSGGSITI-SKPWITNHP 166

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNG 174
           +GVM+TASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 119/295 (40%), Gaps = 38/295 (12%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +  F    N      ++     I +  P        VVG D R+++     
Sbjct: 19  GTSGLRKKTKV-FKDQPNY-----TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD--ELNASVGVMITASHN---PKMDNG 166
             A      G K   L  GQ   + TP     +   E   + G+++TASHN   P+ D G
Sbjct: 73  KIAAIGAANGVK--KLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI----LSKNLKQGKLMYSR 219
            K   SNG     P  ++++N    I   L  +    +F ++    + KN K G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDI 186

Query: 220 EEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLVE 275
            ++ K Y   L++I D  +    +  +  +K W  ++  M+GV       I      L  
Sbjct: 187 IDITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
            +    V +  +P P F  +  P+P    A  +  R+ ++  I    A+D D DR
Sbjct: 247 DE----VLQNWHPSPDFGGM-HPDPNLTYASTLVKRV-DREKIEFGAASDGDGDR 295

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 150/384 (39%), Gaps = 70/384 (18%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +     MN       ++     I +  P    + V VVG D R+++ +  +
Sbjct: 19  GTSGLRKKTKV---FMNEP---HYTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDEL--NASVGVMITASHN---PKMDNG 166
                    G K   L  GQ   + TP     +      ++ G+++TASHN   P+ D G
Sbjct: 73  KIGEIGAANGVK--KLIVGQNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMYS- 218
            K   SNG     P  ++++N+I      L  +    NF  I    + KN + G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDV 186

Query: 219 ---REEMLKLYLEKISDNLVETTPLKLEVRSKPWF--VYTPMHGV----GFDIFSTIVKK 269
                E +KL  E    +L++        RS   F  ++  ++G+    G  IF+     
Sbjct: 187 IDVTAEYVKLMKEIFDFDLIKK--FIDHQRSTKGFKILFDALNGITGPYGKAIFA----- 239

Query: 270 SMCLVEGKDYLCVPEQQ-----NPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIAN 324
                   D L +P ++      P P F  +  P+P    A  +  R+ +K  I+   A+
Sbjct: 240 --------DELGLPAEEVLQNYEPKPDFGGL-HPDPNLTYAHTLVERV-DKEQIAFGAAS 289

Query: 325 DPDADRFSVAIKDMQSGMWQQLTGNEIGXXXXXXXXXXXXSMDEQFQQTHPLAMLSSTVS 384
           D D DR      +M  G         +             S    F++     +  S  +
Sbjct: 290 DGDGDR------NMIYGCGPAF----VSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPT 339

Query: 385 SQMIKRMAEVEGFHYEDTLTGFKW 408
           S  I R+A+ +G +  +  TG+K+
Sbjct: 340 SAAIDRVAKAQGLNCYEVPTGWKF 363

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 108/253 (42%), Gaps = 32/253 (12%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAV----DELNASV- 151
           VVG D R+++ K  +  A+     G  V  L  GQ   + TP     +    D+    V 
Sbjct: 58  VVGGDGRYYNDKILQIIASISAANG--VGKLVIGQHGLLSTPAASHIIRTYQDKSGKKVT 115

Query: 152 -GVMITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFD- 203
            G+++TASHN   P  D G K   SNG     P  ++++NA   I   L  +    N   
Sbjct: 116 GGIILTASHNPGGPDNDIGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIIKNLPQ 171

Query: 204 -DILSKNLKQ-GKLMYSREEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTPMHG 257
            D+ +K  K+ G L     ++ + Y+E   +I D  +    +  +  +K W  ++  ++G
Sbjct: 172 LDLSTKGEKKLGNLEIDVVDVTQAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNG 231

Query: 258 VGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHD 317
           V       I    + L E +    V +  +P P F  +  P+P    A  +  R+ +K  
Sbjct: 232 VTGPYGKAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTLVERV-DKEK 285

Query: 318 ISLLIANDPDADR 330
           I    A+D D DR
Sbjct: 286 IEFGAASDGDGDR 298

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 148 NASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANA 199
            A VGVM+TASHNP  DNG K        ++ PH + ++   + +    AN 
Sbjct: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 108/258 (41%), Gaps = 32/258 (12%)

Query: 92  PNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAV----DE 146
           P+    VVG D RF++       A      G K   L  GQ   + TP     +    D 
Sbjct: 52  PSGATLVVGGDGRFYNDVIMNKIAAVGAANGIK--KLVIGQAGLLSTPAASHIIRTYEDN 109

Query: 147 LNASVGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAW 200
            N   G+++TASHN   P+ D G K    NG     P  +++++AI      L  +    
Sbjct: 110 CNGG-GIILTASHNPGGPENDLGIKYNLPNGG----PAPESVTDAIWEASKKLTHYKIIK 164

Query: 201 NFDDI----LSKNLKQGKLMYSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVY 252
           +F ++    + KN K G L+    +  K Y   L++I D  +  + L  + ++K W  ++
Sbjct: 165 SFPELDLNKIGKNQKYGPLLVDIIDPTKAYVKFLKEIFDFDLIKSFLTEQRKAKGWKLLF 224

Query: 253 TPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRL 312
             ++G+       I      L   +    V +  +P P F  +  P+P    A  +  R+
Sbjct: 225 DSLNGITGPYGKAIFVDEFGLPAEE----VLQNWHPLPDFGGL-HPDPNLTYARTLVDRV 279

Query: 313 AEKHDISLLIANDPDADR 330
            ++  I+   A+D D DR
Sbjct: 280 -DREKIAFGAASDGDGDR 296

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 102/250 (40%), Gaps = 29/250 (11%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD--ELNASVGVM 154
           VVG D R+++       A      G K   L  GQ   + TP     +   E   + G++
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVK--KLVVGQHGLLSTPAASHIMRTYEEKTTGGII 115

Query: 155 ITASHNP---KMDNGYKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI--- 205
           +TASHNP   + D G K   SNG     P  + ++N    I   +  +    +F ++   
Sbjct: 116 LTASHNPGGLENDMGIKYNLSNGG----PAPEPVTNKIWEISKKMTHYKIIKDFPELELE 171

Query: 206 -LSKNLKQGKLMYSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGF 260
            L KN K G L+    ++ K Y   L++I D  +    +  +   K W  ++  M+GV  
Sbjct: 172 TLGKNKKYGPLLVDVIDITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTG 231

Query: 261 DIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISL 320
                I      L   +    V +Q +P P F  V  P+P    A  +  R+  +  I  
Sbjct: 232 PYGKAIFVDEFGLPADE----VLQQWHPQPDFGGV-HPDPNLTYAKALVDRV-NREKIEF 285

Query: 321 LIANDPDADR 330
             A+D D DR
Sbjct: 286 GAASDGDGDR 295

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 116/296 (39%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +      N       ++     I    P    +   VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMDEPN------YTENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVMITASHN---PKMDNG 166
             A      G  V  L  GQ   + TP     +      V  G+++TASHN   P  D G
Sbjct: 73  KIAAIGAANG--VKKLIIGQNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLG 130

Query: 167 YKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMY-- 217
            K    NG     P  +A+++AI      L  +    +F ++    + +N K G L+   
Sbjct: 131 IKYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDI 186

Query: 218 --SREEMLKLYLEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLV 274
             S E  +K Y+++I D  +    +  +  +K W  ++  ++GV       I      L 
Sbjct: 187 IDSTEAYVK-YMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGLP 245

Query: 275 EGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
             +    V +   P P F  +  P+P    A  +  R+ +K  I    A+D D DR
Sbjct: 246 ADE----VLQNYVPKPDFGGL-HPDPNLTYAKTLVSRV-DKEKIEFGAASDGDGDR 295

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 22/80 (27%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKN 209
           +VGVMITASHN   DNG K+   +G            + +D + EP+A         ++ 
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDG------------SMLDQSWEPFA---------TEL 95

Query: 210 LKQGKLMYSREEMLKLYLEK 229
             +    +S +E  KLYL++
Sbjct: 96  ANKASFCHSTQE-FKLYLQE 114

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVD---ELNASVGV 153
           VVG D RF++    +  A      G  VH L  GQ   + TP     +        + G+
Sbjct: 58  VVGGDGRFYNDVVVQKIAAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGI 115

Query: 154 MITASHNP---KMDNGYKVYYSNGCQIIPPHDQAISNAI 189
           ++TASHNP   K D G K   SNG     P  ++++N I
Sbjct: 116 ILTASHNPGGAKNDFGIKYNLSNGG----PAPESVTNKI 150

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 103/256 (40%), Gaps = 41/256 (16%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELN--ASVGVM 154
           VVG D R+++       A      G  V  L  GQ   + TP     +       + G++
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANG--VRKLVIGQNGLLSTPAASHIMRTYKEKCTGGII 115

Query: 155 ITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFD-------- 203
           +TASHN   PK D G K   SNG     P  + ++N I      W  +   D        
Sbjct: 116 LTASHNPGGPKNDMGIKYNLSNGG----PAPEPVTNKI------WEVSKQLDHYKIIPDL 165

Query: 204 -----DILSKNLKQGKLMYSREEMLKLYLE---KISDNLVETTPLKLEVRSKPW-FVYTP 254
                D L++N++ G L+    +  + Y+E   +I D  +  + +  +   K W  ++  
Sbjct: 166 PELALDTLAENVQYGPLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDG 225

Query: 255 MHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAE 314
           M+GV       I      L   +    V +  +P P F  +  P+P    A ++  R+ +
Sbjct: 226 MNGVTGPYGKAIFVDEFELPAEE----VLQNWHPQPDFGGI-HPDPNLTYARSLVDRV-D 279

Query: 315 KHDISLLIANDPDADR 330
           + +I    A+D D DR
Sbjct: 280 RENIEFGAASDGDGDR 295

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 102/262 (38%), Gaps = 45/262 (17%)

Query: 94  NLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDEL--NAS 150
           N   VVG D R+++ +  +         G +   L  GQ   + TP     +       +
Sbjct: 54  NATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMIL--GQNGILSTPAASHIIRSYPEKCT 111

Query: 151 VGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDD 204
            G+++TASHN   P+ D G K   SNG     P  ++++NAI      L  +    NF  
Sbjct: 112 GGIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNAIFEKSKQLTHYKIVKNFPK 167

Query: 205 I----LSKNLKQGKLMYSREEMLKLY------------LEKISDNLVETTPLKLEVRSKP 248
           I    + K+ K G L+    +    Y            ++K  DN   T   K+      
Sbjct: 168 IDFSKIGKDQKYGPLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKI------ 221

Query: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308
             ++  ++GV       I  K + L   +    V +   P P F  +  P+P    A  +
Sbjct: 222 --LFDSLNGVTGPYGEAIFVKELGLPAEE----VLQNYVPKPDFGGL-HPDPNLTYAHTL 274

Query: 309 GMRLAEKHDISLLIANDPDADR 330
             R+ +K  I+   A+D D DR
Sbjct: 275 VERV-DKEQIAFGAASDGDGDR 295

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 120/296 (40%), Gaps = 40/296 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +  F    N V     +     + +  P      V VVG D R+++    +
Sbjct: 18  GTSGLRKKTKV-FEDQPNYV-----ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELN--ASVGVMITASHN---PKMDNG 166
             A      G K   L  GQ   + TP     +       + G+++TASHN   P+ D G
Sbjct: 72  KIAAIGAANGVK--KLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMG 129

Query: 167 YKVYYSNGCQIIPPHDQAISNA---IDMNLEPWANAWNFDDI----LSKNLKQGKLMYSR 219
            K   SNG     P  + ++N    I   L  +    +F ++    L +N K G L+   
Sbjct: 130 IKYNLSNGG----PAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDV 185

Query: 220 EEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCLVE 275
            +    Y   L++I D  +    +  + + K W  +   M+GV     +    K++ + E
Sbjct: 186 IDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGV-----TGPYAKAIFVDE 240

Query: 276 -GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
            G D   V +  +P P F  +  P+P    A  +  R+  K  I    A+D D DR
Sbjct: 241 FGLDSKEVLQNWHPQPDFGGL-HPDPNLTYAHTLVERV-NKEKIEFGAASDGDGDR 294

>AAR162C Chr1 complement(634067..637582) [3516 bp, 1171 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL062W
           (PYC1) and YBR218C (PYC2)
          Length = 1171

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 391 MAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFP-AMEHDKDGISASV 449
           MA V  + YED L+  +   + A ++ +EG Y P G   AI  +   A +HD D I    
Sbjct: 42  MATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGY 101

Query: 450 VFL 452
            FL
Sbjct: 102 GFL 104

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 124/297 (41%), Gaps = 42/297 (14%)

Query: 56  GTAGLRSQMQAGFSRMNNLV--IIQASQGLATYIRQQFPNNL---VAVVGHDHRFHSKKF 110
           GT+GLR + +  F+   N     IQA       I +  P  +   V +VG D R+++   
Sbjct: 19  GTSGLRKRTKV-FAEEPNYTENFIQA-------ILEAIPEGVKDSVLLVGGDGRYYNDVV 70

Query: 111 ARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAV---DELNASVGVMITASHNPKMDN- 165
            +  A      G K   L  GQ   + TP     +    +   + G+++TASHNP   N 
Sbjct: 71  LQKIAAIGAANGVK--RLVVGQNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNN 128

Query: 166 --GYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFD--DILSKNLKQ-GKLMY 217
             G K   +NG     P  + ++NA+      L  +    +F   D+ +   KQ G L  
Sbjct: 129 DFGIKYNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTV 184

Query: 218 SREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGFDIFSTIVKKSMCL 273
              +  K Y   L+ I D  +  + +  +  +K W  ++  ++GV       I    + L
Sbjct: 185 DVIDSTKAYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGL 244

Query: 274 VEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
            E +    V +  +P P F  +  P+P    A  +  R+ ++ +I+   A+D D DR
Sbjct: 245 PEDE----VLQNCHPKPDFGGL-HPDPNLTYARTLVDRV-DRENIAFGAASDGDGDR 295

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 103/250 (41%), Gaps = 29/250 (11%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVM 154
           VVG D RF++       A      G K   L  GQ   + TP     +      V  G++
Sbjct: 58  VVGGDGRFYNDVIMNKIAAISAANGVK--KLIIGQNGLLSTPAASHIIRSYEEKVTGGII 115

Query: 155 ITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI--- 205
           +TASHN   P+ D G K   +NG     P  ++++NAI      L  +    NF  +   
Sbjct: 116 LTASHNPGGPENDLGIKYNLANGG----PAPESVTNAIWEVSKKLTHYKIIKNFPPLDLS 171

Query: 206 -LSKNLKQGKLMYSREEMLKLY---LEKISDNLVETTPLKLEVRSKPW-FVYTPMHGVGF 260
            + K+ K G L+    ++ K Y   L++I D  +    +  +  +K W  ++  ++G+  
Sbjct: 172 KMGKDQKYGPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITG 231

Query: 261 DIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISL 320
                I      L   +    V +  +P P F  +  P+P    A  +  R+ ++  I  
Sbjct: 232 PYGKAIFVDEFDLPANE----VLQNWHPKPDFGGL-HPDPNLTYAKTLVERV-DREKIEF 285

Query: 321 LIANDPDADR 330
             A+D D DR
Sbjct: 286 GAASDGDGDR 295

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VG MITASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 12/98 (12%)

Query: 98  VVGHDHRFHSKKFARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELN--ASVGVM 154
           V+G D RF++       A      G  V  L  GQ   + TP   + +      A+ G++
Sbjct: 59  VIGGDGRFYNDVVINKIAAISAANG--VRKLVIGQNGLLSTPATSYIIRSYKDKATGGII 116

Query: 155 ITASHN---PKMDNGYKVYYSNGCQIIPPHDQAISNAI 189
           +TASHN   P+ D G K   +NG     P  ++++NA+
Sbjct: 117 LTASHNPGGPENDMGIKYNLANGG----PAPESVTNAM 150

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 81/189 (42%), Gaps = 42/189 (22%)

Query: 56  GTAGLRSQMQAGFSRMNNLV--IIQASQGLATYIRQQFPN---NLVAVVGHDHRFHSKKF 110
           GT+GLR + +  F +  +     IQA       I +  P    N V V+G D R+++   
Sbjct: 19  GTSGLRKKTKV-FEQTEHYTENFIQA-------IMESIPEGSENAVLVIGGDGRYYNDAV 70

Query: 111 ARATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDELNASV--GVMITASHNPKM-DNG 166
            +  A      G  V  L  GQ   + TP     +   +  V  G+++TASHNP   DN 
Sbjct: 71  MQKIAEVGSANG--VRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDND 128

Query: 167 YKVYY--SNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLK 224
           + + Y  +NG     P  + ++N++            F+   S+NL   K+      M K
Sbjct: 129 FGIKYNLANGA----PAPEKVTNSM------------FER--SRNLTHYKITRG---MPK 167

Query: 225 LYLEKISDN 233
           L L KI +N
Sbjct: 168 LDLGKIGEN 176

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 52/128 (40%), Gaps = 17/128 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLVIIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKFAR 112
           GT+GLR + +      N       ++     I    P    + V VVG D RF++    +
Sbjct: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 113 ATATAFLLKGFKVHYLNPGQE-FVHTPLVPFAVDEL--NASVGVMITASHN---PKMDNG 166
             A      G  V  L  GQ   + TP     +       + G+++TASHN   P+ D G
Sbjct: 71  KIAAIGAANG--VRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLG 128

Query: 167 YKVYYSNG 174
            K   +NG
Sbjct: 129 IKYNLANG 136

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 118/295 (40%), Gaps = 40/295 (13%)

Query: 56  GTAGLRSQMQAGFSRMNNLV--IIQASQGLATYIRQQFP---NNLVAVVGHDHRFHSKKF 110
           GT+GLR + +  F    N     IQA       I +  P        V+G D R+++   
Sbjct: 19  GTSGLRKKTKV-FEETPNYTENFIQA-------IMEAIPEGSQGATLVIGGDGRYYNDVV 70

Query: 111 ARATATAFLLKGFKVHYLNPGQEFVHTPLVPFAVDELN--ASVGVMITASHN---PKMDN 165
            +  A      G +   +      + TP     +   +   + G+++TASHN   P  D 
Sbjct: 71  IQKIAAIGSANGVRKIVIGH-NGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDF 129

Query: 166 GYKVYYSNGCQIIPPHDQAISNAI---DMNLEPWANAWNFDDI----LSKNLKQGKLMYS 218
           G K   +NG     P  ++++N+I      L  +    +F  I    + ++ K G L+  
Sbjct: 130 GIKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVD 185

Query: 219 REEMLKLYLE---KISDNLVETTPLKLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVE 275
             +    Y+E   +I D  +  + +  + ++    ++  M+GV       +  K + L E
Sbjct: 186 IVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKELGLPE 245

Query: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADR 330
                   +  +P P F  +  P+P    A  +  R+ +K+ I    A+D D DR
Sbjct: 246 SS-----LQNYHPKPDFGGL-HPDPNLTYAHTLVERV-DKYGIQFGAASDGDGDR 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,128,525
Number of extensions: 3112788
Number of successful extensions: 6947
Number of sequences better than 10.0: 79
Number of HSP's gapped: 7013
Number of HSP's successfully gapped: 79
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)