Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4498.839ON73473434730.0
YMR277W (FCP1)8.839ON73270933000.0
Smik_13.4908.839ON73273432660.0
Suva_13.4658.839ON73271030610.0
KAFR0B039108.839ON72466521430.0
TDEL0B005808.839ON71365621390.0
NCAS0C004208.839ON72566521340.0
CAGL0M02959g8.839ON75866320990.0
ZYRO0G14168g8.839ON76465520970.0
NDAI0K004208.839ON77869320240.0
Kpol_1068.98.839ON74566119310.0
TBLA0D032608.839ON76868119080.0
TPHA0I002408.839ON73267219020.0
KNAG0J002808.839ON74267918970.0
SAKL0D01496g8.839ON68866118410.0
Kwal_27.102638.839ON74365917980.0
Ecym_46108.839ON75166917780.0
KLTH0C03894g8.839ON74563717590.0
ABL127W8.839ON72866017530.0
KLLA0D01595g8.839ON71966416530.0
TPHA0E030705.202ON4941331074e-04
NCAS0A068005.202ON4731291038e-04
SAKL0G12870g5.202ON3991661038e-04
NDAI0D018605.202ON5141311020.001
Ecym_20665.94ON880811000.002
Kpol_1010.615.94ON93292990.003
TPHA0H010705.94ON1015100970.006
YLR019W (PSR2)5.202ON397118950.007
Kpol_1050.635.94ON105870950.010
Suva_10.655.202ON415115940.010
NDAI0C032305.94ON1034188950.012
ZYRO0B10428g5.202ON482112930.014
Skud_12.575.202ON415123920.017
Smik_12.825.202ON392118920.017
Smik_12.535.202ON414112920.018
SAKL0G15620g5.94ON879164930.020
Kpol_478.165.202ON35094910.021
KAFR0E021405.94ON95190920.025
Ecym_50527.46ON87397900.041
TBLA0C060905.202ON484123880.052
Skud_12.875.202ON39245880.060
CAGL0D03234g5.202ON410112860.092
TDEL0E042705.202ON453112860.092
Kwal_33.151405.202ON410132850.11
KLLA0F15620g5.202ON414149850.12
YLL010C (PSR1)5.202ON42740850.13
Suva_10.995.202ON385114840.14
Smik_8.2385.94ON1075142850.14
TPHA0N006705.202ON452110850.14
NCAS0D027405.202ON398117840.15
Kpol_2002.1005.202ON477127840.17
AAL158W5.202ON478115840.18
KAFR0J009905.202ON483113840.19
CAGL0I01958g5.94ON1099164840.19
NDAI0I021705.202ON39145830.23
Smik_12.3356.48ON67896830.27
Skud_12.3406.48ON68095820.32
Ecym_71045.202ON492113820.35
KNAG0H019102.300ON52092810.40
CAGL0D05610g5.202ON447129810.45
KNAG0M017405.202ON481109800.50
NDAI0I023706.48ON76095800.57
KAFR0A065604.156ON55555800.59
KNAG0E005705.94ON981102800.66
NCAS0D015105.94ON900127790.73
Smik_16.1728.527ON477100771.1
Ecym_72764.156ON59353771.2
KLTH0B03388g5.202ON409132761.4
ADR369C7.46ON82797771.4
TBLA0H019905.202ON68840771.4
Suva_16.2498.527ON480100761.5
NCAS0D025106.48ON646104752.1
YHR154W (RTT107)5.94ON1070142762.1
KLLA0E15621g5.94ON89168752.4
Suva_10.3586.48ON68095742.7
KLTH0C01584g5.94ON913114743.0
YPL063W (TIM50)8.527ON476109743.1
KNAG0E027306.48ON74882743.4
SAKL0H20592g4.156ON50877734.0
YLR260W (LCB5)6.48ON68796734.5
ADL145C5.94ON875109734.5
Skud_8.2185.94ON107691725.2
Suva_15.3535.94ON1079142725.5
TBLA0I014602.530ON393112706.9
ZYRO0B15026g5.94ON116291717.9
Skud_16.2188.527ON480100709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.449
         (734 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...  1342   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...  1275   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...  1262   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...  1183   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   830   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   828   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   826   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   813   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   812   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   784   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   748   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   739   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   737   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   735   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   713   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   697   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   689   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   682   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   679   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   641   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    46   4e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   8e-04
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    44   8e-04
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     44   0.001
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    43   0.002
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    43   0.003
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    42   0.006
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    41   0.007
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    41   0.010
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    41   0.010
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    41   0.012
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    40   0.014
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    40   0.017
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    40   0.017
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    40   0.018
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    40   0.020
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    40   0.021
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    40   0.025
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    39   0.041
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    39   0.052
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.060
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    38   0.092
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    38   0.092
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    37   0.11 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    37   0.12 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.13 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    37   0.14 
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    37   0.14 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    37   0.14 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    37   0.15 
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    37   0.17 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    37   0.18 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    37   0.19 
CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakl...    37   0.19 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.23 
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    37   0.27 
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    36   0.32 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    36   0.35 
KNAG0H01910 Chr8 complement(337293..338855) [1563 bp, 520 aa] {O...    36   0.40 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    36   0.45 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    35   0.50 
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    35   0.57 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    35   0.59 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    35   0.66 
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    35   0.73 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    34   1.1  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    34   1.2  
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    34   1.4  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    34   1.4  
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    34   1.4  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    34   1.5  
NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {O...    33   2.1  
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    34   2.1  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   2.4  
Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260...    33   2.7  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    33   3.0  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    33   3.1  
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    33   3.4  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    33   4.0  
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    33   4.5  
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    33   4.5  
Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W...    32   5.2  
Suva_15.353 Chr15 (607037..610276) [3240 bp, 1079 aa] {ON} YHR15...    32   5.5  
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    32   6.9  
ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa...    32   7.9  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    32   9.2  

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score = 1342 bits (3473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/734 (90%), Positives = 661/734 (90%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                        TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180
           IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP
Sbjct: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240

Query: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300
           VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD
Sbjct: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300

Query: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360

Query: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420
           STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN
Sbjct: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420

Query: 421 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTYY 480
           ESKEELTKKLEYSASLEVQQQNRP                        MGTLSNIHNTYY
Sbjct: 421 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTYY 480

Query: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540
           QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS
Sbjct: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540

Query: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600
           DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600

Query: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTAXXX 660
           SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTA   
Sbjct: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTASDE 660

Query: 661 XXXXXXXXXXXXXXXPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHNXXXXXXXXXX 720
                          PTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHN          
Sbjct: 661 DEDDDHNDESNNENNPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHNEEEEENNEDS 720

Query: 721 XXXXXXXXMDMLDG 734
                   MDMLDG
Sbjct: 721 DSQLEEELMDMLDG 734

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 1275 bits (3300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/709 (87%), Positives = 639/709 (90%), Gaps = 1/709 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTTQIRSP+GLPYPIQIDKL+PSVGSYLHEGDRL+VYKFWYLVERASDT GDDDNEHD +
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDT-GDDDNEHDVS 59

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                        TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHD
Sbjct: 60  PGGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHD 119

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180
           IVYGGLCTQCGKEVSADAFDGVPLDVVGD+DLQISETEAIR+G+ALKEHLRRDKKLILVV
Sbjct: 120 IVYGGLCTQCGKEVSADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKLILVV 179

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN+DGS+L+PPP
Sbjct: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239

Query: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTGELFGDRILSRD
Sbjct: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299

Query: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359

Query: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420
           STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP AN
Sbjct: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419

Query: 421 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTYY 480
           ESKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY
Sbjct: 420 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYY 479

Query: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540
            M+SQ NEPEPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATST 
Sbjct: 480 DMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTP 539

Query: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600
           DIDYLTTHLITKNPSTYKARLAKKFNP+IKI+HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 540 DIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599

Query: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTAXXX 660
           SDEELQNFQ QLQKRQEYLEE Q+QQHMLT QENLNLFAAGTSWLNNDDDEDIPDTA   
Sbjct: 600 SDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNDDDEDIPDTASDD 659

Query: 661 XXXXXXXXXXXXXXXPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQH 709
                            GIDRKRSIEDNH+D SQKKTKAEP QDGPVQH
Sbjct: 660 DEDDDHDDESDDENNSEGIDRKRSIEDNHDDTSQKKTKAEPSQDGPVQH 708

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1262 bits (3266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/734 (85%), Positives = 645/734 (87%), Gaps = 2/734 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTTQIRSPEGLPYPIQIDKL+PSVGSYLHEGDRL+VYKFWYLVERAS+T G DDNEHDA+
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASET-GVDDNEHDAS 59

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                        TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHD
Sbjct: 60  PGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHD 119

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180
           IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIR+G+ALKEHLRRDKKLILVV
Sbjct: 120 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVV 179

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL+PPP
Sbjct: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPP 239

Query: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTG+LFGDRILSRD
Sbjct: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRD 299

Query: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359

Query: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420
           STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP AN
Sbjct: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419

Query: 421 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTYY 480
           ESKEELTKKLEYSASLEVQQQNRP                        MGTLSNIH TYY
Sbjct: 420 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYY 479

Query: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540
           QM+SQ NEPEPNLMEIIPSLKQKVFQNC FVFSGLIPLGTDIQRSDIVIWTSTFGATSTS
Sbjct: 480 QMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 539

Query: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600
           DID+LTTHLITKNPSTYKARLAKKFNPEIKI+HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 540 DIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599

Query: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTAXXX 660
           SDEELQNFQ QLQKRQEYLEENQ+QQHMLT QENLNLFA GTSWLNNDDD+DIPDTA   
Sbjct: 600 SDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLNNDDDDDIPDTASDD 659

Query: 661 XXXXXXXXXXXXXXXPTGIDRKRSIEDNHNDASQKKTKAEPPQDGPVQHNXXXXXXXXXX 720
                          P GIDRKRSIEDNH D SQKKTKAEP QDGPVQ            
Sbjct: 660 DEDDEHNDESDEENHPEGIDRKRSIEDNHEDTSQKKTKAEPLQDGPVQQK-REGDDNEDS 718

Query: 721 XXXXXXXXMDMLDG 734
                   MDMLDG
Sbjct: 719 DSQLEEELMDMLDG 732

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/710 (84%), Positives = 621/710 (87%), Gaps = 3/710 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTTQIRSPEGLPYPIQIDKL+PSVGS+L EGDRL+VYKFWYLVER SD    DD+    +
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAG--DDDNDHDS 58

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                        TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD
Sbjct: 59  SPGGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 118

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180
           IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIR+G ALKEHLRRDKKLILVV
Sbjct: 119 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVV 178

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM EDGSV KPPP
Sbjct: 179 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPP 238

Query: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTGELFGDRILSRD
Sbjct: 239 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 298

Query: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 299 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 358

Query: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420
           STGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEPSAN
Sbjct: 359 STGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSAN 418

Query: 421 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTYY 480
           ESKEELTKKLEYSASLEVQQQNRP                        M TL NIH TYY
Sbjct: 419 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYY 478

Query: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540
           QM+SQ  E EPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATSTS
Sbjct: 479 QMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 538

Query: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600
           DI+YLTTHLITKNP TYKARLAKKFNPEIK++HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 539 DINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPI 598

Query: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTAXXX 660
           SD+ELQ+FQKQLQK+QEYL+E+ +QQHML PQEN+NLFAAGTSWLN+DDDEDIPDTA   
Sbjct: 599 SDDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWLNDDDDEDIPDTASDD 658

Query: 661 XXXXXXXXXXXXXXXPTGIDRKRSIEDNHNDASQKKTKAEPPQ-DGPVQH 709
                             IDRKRSIED  ++A QKKTKAE  Q DGP QH
Sbjct: 659 DDDNDDNSESDDERDSGDIDRKRSIEDGQDEAPQKKTKAEHSQEDGPAQH 708

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/665 (61%), Positives = 504/665 (75%), Gaps = 26/665 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTT + +PEGLPYPI ID+L+  +G+Y+ +G RL  YKFWY+VE AS     DDN+   T
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIAS---SPDDNDPANT 57

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHD
Sbjct: 58  DTQASHPK------KKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHD 111

Query: 121 IVYGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRSGEALKEHLRRDKKLI 177
           IVYGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  GE  K+ LR +KKL+
Sbjct: 112 IVYGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLV 171

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LVVDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM       K
Sbjct: 172 LVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGP-----K 226

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297
           P P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA++I KI+DPTGELFG+RIL
Sbjct: 227 PTP-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRIL 285

Query: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357
           SRDENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFL
Sbjct: 286 SRDENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFL 345

Query: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417
           PKQ T MLQLGR++R+K++E+ ELLTDIMD EKKLQEKID+EVKRQE+ L+HQ+   EE 
Sbjct: 346 PKQQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEES 405

Query: 418 SANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHN 477
            +NE+KEE TKKLE+SAS+EVQQQNRP                          TL+ +HN
Sbjct: 406 VSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHN 465

Query: 478 TYYQMISQS--NEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFG 535
            YY ++     +E   ++  I+P LKQ VF+ CHFVFSGLIPL TDI+R+DIV+WTS FG
Sbjct: 466 EYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFG 525

Query: 536 ATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLI 595
           A S+S+I+ +TTH+ITK P T+KARLAK FN +IKI+HPDW+FECL+ W  VDEKPYTLI
Sbjct: 526 AESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLI 585

Query: 596 VDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQ--EN----LNLFAAGTSWLNNDD 649
           V+ PISD EL+ F++ L  R+     N+Q    +T    EN    ++LFA GTSWLN++D
Sbjct: 586 VEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLNDED 645

Query: 650 DEDIP 654
           +++IP
Sbjct: 646 EDEIP 650

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/656 (61%), Positives = 492/656 (75%), Gaps = 24/656 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTT + SPE LPYPI ID+L+  +GS++ +G RL  +KFWY+VE AS     D+NE    
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP---DENE---- 53

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K +RESIEFFE+P+EGDL+SWNVDVGDE+   NQ ICEI RPCNHD
Sbjct: 54  ---------GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHD 104

Query: 121 IVYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILV 179
           IVYGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LV
Sbjct: 105 IVYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLV 164

Query: 180 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPP 239
           VDLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         P
Sbjct: 165 VDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG------PKP 218

Query: 240 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSR 299
           PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA++IAKI+DP G LFGDRILSR
Sbjct: 219 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSR 278

Query: 300 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 359
           DENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+
Sbjct: 279 DENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 338

Query: 360 QSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSA 419
           Q   MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE  A
Sbjct: 339 QQNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPA 398

Query: 420 NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTY 479
            ESK++L KKLEYSASLEVQQQNRP                           L+ +H+ Y
Sbjct: 399 PESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEY 458

Query: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539
           Y+ + Q +E + ++  ++P +K KVF++CHFVFSGLIPLGT+I R+DIV+WT+ FGA S+
Sbjct: 459 YKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSS 518

Query: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSP 599
            +ID  TTH+IT+ P TYKAR+AK FN  IK++HPDW+FECLV+WK VDEKPY LIV+  
Sbjct: 519 PEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQT 578

Query: 600 ISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQEN-LNLFAAGTSWLNNDDDEDIP 654
            +DEEL +++++L +R   L E + +  M + +   +NLFA GTSWLN+DDD+++P
Sbjct: 579 ATDEELGDYKQKLARRSSALAEQEMELAMESAKNGTINLFAGGTSWLNDDDDDEMP 634

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/665 (61%), Positives = 499/665 (75%), Gaps = 35/665 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M+TQI +P GLPYPI ID+L+  VG  + +GDRL+ YKFW++V+ AS     DDN+  + 
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSP---DDNDVSSP 57

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K +RESIEFFESPY+G LISWNVD+GDEIA+ NQV+ EI RPCNHD
Sbjct: 58  PTAGK---------KSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHD 108

Query: 121 IVYGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRSGEALKEHLRRDKK 175
           +VYGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KK
Sbjct: 109 VVYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKK 168

Query: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235
           L+LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM      
Sbjct: 169 LVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG----- 223

Query: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295
              PP+RKCWYYVKVRPGLKEF +K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDR
Sbjct: 224 -PKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDR 282

Query: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355
           ILSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSN
Sbjct: 283 ILSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSN 342

Query: 356 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 415
           FLPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT E
Sbjct: 343 FLPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTE 402

Query: 416 EP--SANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLS 473
           EP  SA E+KEE++KK+EYSASLEVQQQNRP                          TL 
Sbjct: 403 EPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLV 462

Query: 474 NIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTST 533
            IH+ YY ++ +  E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+T
Sbjct: 463 RIHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNT 522

Query: 534 FGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYT 593
           FGA STSDID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY 
Sbjct: 523 FGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYE 582

Query: 594 LIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLN-----LFAAGTSWLNND 648
           LIV+ P+S+ EL+ F+K+L KRQ     N+     L+P    N     LF+ G SWL +D
Sbjct: 583 LIVEQPVSETELEEFKKKLAKRQLLATANEN----LSPANGTNSAELELFSGGMSWL-DD 637

Query: 649 DDEDI 653
           D+ DI
Sbjct: 638 DEGDI 642

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/663 (61%), Positives = 496/663 (74%), Gaps = 31/663 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+     DDN+ D  
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIAN---SPDDNDID-- 55

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         +++RESIEF+E+P+EGDL+SWNVD  DEIA  N  +CEIKRPCNHD
Sbjct: 56  ----YEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHD 111

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177
           IVYGGLCT CGKEV  D +D V  ++     D +L++S  EAI   + +   L+ +KKL+
Sbjct: 112 IVYGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLV 169

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LVVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM        
Sbjct: 170 LVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG------P 223

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297
            PPVR CWYYVK+RPGLKEFF+K+APL+EMHIYTMATRAYA++IAKI+DP   LFGDRIL
Sbjct: 224 KPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 283

Query: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357
           SRDENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL
Sbjct: 284 SRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 343

Query: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417
           PKQ T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE 
Sbjct: 344 PKQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEES 403

Query: 418 SANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHN 477
           +  ESKE++ KKLE+SASLEVQQQNRP                          TL+ IH 
Sbjct: 404 TDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHK 463

Query: 478 TYYQMIS-QSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGA 536
            +Y ++   S++ E ++  ++P LK+KVF+ CHFVFSGLIPLGTDI+R+DIVIWTS FGA
Sbjct: 464 EFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGA 523

Query: 537 TSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIV 596
            STSDID  TTH++TK P TYKARLAK FNP+IK++HPDWIFECL +WK++DEKPY LIV
Sbjct: 524 ESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIV 583

Query: 597 DSPISDEEL--------QNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNND 648
           + P+S++EL        Q  +K  +   E  EE  ++ + + P   + LF   TSWLN+D
Sbjct: 584 EQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEP--TMPLFGGDTSWLNDD 641

Query: 649 DDE 651
           +DE
Sbjct: 642 EDE 644

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/655 (60%), Positives = 491/655 (74%), Gaps = 30/655 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M T + +PE LPYPI ID+L+  +GS + +G RL  YKFWY+VE AS    +D N     
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGN----- 55

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K +RESIEFFESP+EGDL+SW VD GDE+A+A QVICEI RPCNHD
Sbjct: 56  -------GGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHD 108

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177
           +VYGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+
Sbjct: 109 VVYGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLV 166

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LVVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM   G  L 
Sbjct: 167 LVVDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYM---GPRL- 222

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297
             P RKCWY+VKVRPGL+EFF ++APL+EMHIYTMATR YA++IAKI+DP G LFGDRIL
Sbjct: 223 --PERKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRIL 280

Query: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357
           SRDENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL
Sbjct: 281 SRDENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 340

Query: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417
           P+Q +G+LQLGR+T +K QES ELLTDIMD EK+LQEKID+EVKRQEEKL+HQL T +EP
Sbjct: 341 PRQQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP 400

Query: 418 SANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHN 477
              ESKE+LTKKLEYSASLEVQQQNRP                          TL+ IH 
Sbjct: 401 VQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHR 460

Query: 478 TYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGAT 537
            YY+++ + NE   ++  ++P++K +VF++C+FVFSGLIPLGT+I+R+DIV+WT  FGA 
Sbjct: 461 KYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAI 520

Query: 538 STSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVD 597
           ++S+ID  TTH+ITK P TYKAR+AK FN  +K++HPDW+FECLV W  VDEKPY LI+ 
Sbjct: 521 TSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQ 580

Query: 598 SPISDEELQNFQKQLQKRQEYLEENQQQQH-----MLTPQEN-LNLFAAGTSWLN 646
            P ++EE+Q+F++++++R   +EE +++Q      M T Q++ LNLFA GTSWLN
Sbjct: 581 DPATEEEIQDFKRKIEQRH-LIEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/693 (57%), Positives = 492/693 (70%), Gaps = 56/693 (8%)

Query: 3   TQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASD-------------- 48
           T IR+P GLPYPI ID+L+  +G+ +++ DRL+ YKFWY+VE A+               
Sbjct: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDNDNDN 64

Query: 49  --------TTGDDDNEHDATXXXXXXXXXXXXXTKQ--------LRESIEFFESPYEGDL 92
                    T + +N  + T             T          +RESIEFF+ PY+G L
Sbjct: 65  DPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPYDGIL 124

Query: 93  ISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD---GVPLDVV-G 148
            SW V+ GD+I   NQ +CEI+RPCNHD++YGGLCT CGKEV  +  D   G  L +   
Sbjct: 125 TSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTISHT 184

Query: 149 DMDLQISETEAIRSGEALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFE 208
           D +L+IS  EA+  G+++K+ LR DKKLILVVDLDQT+IHCGVDPTI EWK DP NPNFE
Sbjct: 185 DTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTNPNFE 244

Query: 209 TLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMH 268
           TL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFEMH
Sbjct: 245 TLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFEMH 298

Query: 269 IYTMATRAYAIQIAKIVDPTGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRG 328
           IYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDDRG
Sbjct: 299 IYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRG 358

Query: 329 DVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQELLT 383
           DVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +LLT
Sbjct: 359 DVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLT 418

Query: 384 DIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP--SANESKEELTKKLEYSASLEVQQQ 441
           DIMD EK LQ KI++EVKRQEEKLNHQLAT EEP  +A E+KEE++KK+EYSASLEVQQ+
Sbjct: 419 DIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQK 478

Query: 442 NRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIHNTYYQMISQSNEP----EPNLMEII 497
           NRP                          TLS IH+ YY+M+ ++NE     EP++  I+
Sbjct: 479 NRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIM 538

Query: 498 PSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTY 557
           P +KQ V Q+CHFVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+DID  TTH+ITK P TY
Sbjct: 539 PQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTY 598

Query: 558 KARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQE 617
           KARLAK ++P+IKI+HPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F ++L++R +
Sbjct: 599 KARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQ 658

Query: 618 YLEENQQQQHMLTPQENL-----NLFAAGTSWL 645
             E   +  +   P  N+     NLFA GTSWL
Sbjct: 659 LSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/661 (56%), Positives = 467/661 (70%), Gaps = 40/661 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M+T + +P GLPYPI I KL+ S+GS++ +G RL  YKFWY+VE A     +DD  +D  
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVND-- 58

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K +RESIEFF+SP+EGDL+SWNVDVGDEI   NQ ICEI RPCNHD
Sbjct: 59  ----------EHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHD 108

Query: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177
           IVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+ +K+ L R+KKLI
Sbjct: 109 IVYAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLI 166

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LVVDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM        
Sbjct: 167 LVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG------P 220

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297
            PP  KCWYYVK+RPGLKEFF++V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRIL
Sbjct: 221 KPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280

Query: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357
           SR+ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFL
Sbjct: 281 SRNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFL 340

Query: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT-AEE 416
           P+Q T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ A   EE
Sbjct: 341 PRQQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEE 400

Query: 417 PSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSNIH 476
            S+   KE++TKK+E+SASLEVQQQNRP                           L N+ 
Sbjct: 401 ISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQ 460

Query: 477 NTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGA 536
             YY+ +    E +  +  ++P LK+KV + C+FVFSGLIPLGT+IQ++DIV+WT+ FGA
Sbjct: 461 QKYYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGA 518

Query: 537 TSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIV 596
            S++DI   TTH+ITK P TYKA++AK F  +IK++HPDW+FECL+NWK + E PY   +
Sbjct: 519 QSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578

Query: 597 DSPISDEELQNFQKQLQK------------RQEYLEENQQQQHMLTPQENLNLFAAGTSW 644
               +D+EL  F++ L++             +E LE +       +   +++LFA+G SW
Sbjct: 579 IPTATDKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPS--SQGASVDLFASGASW 636

Query: 645 L 645
           L
Sbjct: 637 L 637

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/681 (55%), Positives = 476/681 (69%), Gaps = 41/681 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDD---DNEH 57
           M+T + SP  LP+PI ID+L+  +GS++ +G RL  YKFWY+VE A     +D   +N  
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 58  DATXXXXXXXXXXXXXT---KQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIK 114
           D +             +   K +RESIEFFESP+EGDLI WNVD GDEI + NQ++C+IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 115 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRD 173
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++    L++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           KKLILVVDLDQT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMG--- 237

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFG 293
                PPVRKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYA++IAKI+DP G LFG
Sbjct: 238 ---PRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294

Query: 294 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 353
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354

Query: 354 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELLTDIMDNEKK 391
           SNFLP+Q + MLQLG ++ +K                        +++ELLTDIMD EKK
Sbjct: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414

Query: 392 LQEKIDKEVKRQEEKL-NHQLATAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXX 450
           LQ+KID+EV+RQE+KL   ++   +  S   S  EL+KK+E+SASLEVQQQNRP      
Sbjct: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474

Query: 451 XXXXXXXXXXXXXXXXXXMGTLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHF 510
                                L+ +H+T+Y+ + +      ++  ++P LK  VF   +F
Sbjct: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534

Query: 511 VFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIK 570
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST+DID  TTH+ITK   TYKARLAK FNPEIK
Sbjct: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594

Query: 571 IIHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEENQ-----QQ 625
           ++HPDWIFECLV+WK++ EKPY LI++ P S+EEL+ F+K+L+ + E LE+ +     Q 
Sbjct: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQF 654

Query: 626 QHMLTPQENLNLFAAGTSWLN 646
           + + T    ++LFA+GTSWLN
Sbjct: 655 EALNTRDPAIDLFASGTSWLN 675

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/672 (55%), Positives = 468/672 (69%), Gaps = 38/672 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVE--RASDTTGDDDNEHD 58
           M T ++ P+G+PYPI I KL+  VGSY+++GDRL  YKFWYLVE  ++ D    + N  D
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 59  ATXXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCN 118
                           K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+
Sbjct: 61  G-----------EQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCD 109

Query: 119 HDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKK 175
           HDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KK
Sbjct: 110 HDIVYAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKK 167

Query: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235
           LILVVDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      
Sbjct: 168 LILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG----- 222

Query: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295
              PPV KC YYVKVRPGLKEFF+KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+R
Sbjct: 223 -PKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNR 281

Query: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355
           ILSRDENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSN
Sbjct: 282 ILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSN 341

Query: 356 FLPKQSTGMLQLGRKTRQK--SQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 413
           FLP+Q   MLQ+GR+       +ES+ELLTDI+D EKKLQEKIDKEVKRQE  L H+ A 
Sbjct: 342 FLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401

Query: 414 -AEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTL 472
             EE  A     ++TKK+E+SASLEVQQQNRP                           L
Sbjct: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461

Query: 473 SNIHNTYYQM--ISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIW 530
           + + + +Y+   +   N  + ++ E++P LK+ VF++C+FVFSGLIPLGTDIQ++DIV+W
Sbjct: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521

Query: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEK 590
           T  FGA+STS+I   TTH+ITK P T KAR+AK FNP IK++HPDW+FECL  WK VDEK
Sbjct: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581

Query: 591 PYTLIVDSPISDEELQNFQKQLQKRQE---------YLEENQQQQHMLTPQENLNLFAAG 641
            + L VD   S+ EL+ F+K L+KR +           + N     M +    ++LFA G
Sbjct: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641

Query: 642 TSWLNNDDDEDI 653
           +SWL +D+ ED+
Sbjct: 642 SSWLVDDELEDV 653

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/679 (54%), Positives = 471/679 (69%), Gaps = 44/679 (6%)

Query: 3   TQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERAS-DTTGDDDNEHDATX 61
           T + S  GLPYP+ +D+L+P VG  +  GDRL  YKFWY+VE A  D   + D++   T 
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 62  XXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 121
                        K +RES+EFFESP+EG ++SW+VD GDEI      +C ++RPCNHD+
Sbjct: 67  AK-----------KSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDV 115

Query: 122 VYGGLCTQCGKEVSADAFDGVPLDVVG----------DMDLQISETEAIRSGEALKEHLR 171
           VY GLCT CG+EV             G          D +LQIS  EA +    L++ LR
Sbjct: 116 VYNGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLR 175

Query: 172 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNE 231
             +KL+LVVDLDQT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+  
Sbjct: 176 AAQKLVLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGG 235

Query: 232 DGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
                K P  RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYA++IAKI+DP   L
Sbjct: 236 -----KRPAPRKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290

Query: 292 FGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGD 351
           FGDRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGD
Sbjct: 291 FGDRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGD 350

Query: 352 INSNFLPKQSTGMLQLGRKTR--QKSQESQE---------LLTDIMDNEKKLQEKIDKEV 400
           INSNFLPKQ   MLQ+GR+++  ++  ES++         LLTDIM+ EK+LQEKID+EV
Sbjct: 351 INSNFLPKQQPTMLQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEV 410

Query: 401 KRQEEKLNHQLATA-EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXX 459
           KRQE KLN   A   E+ +  +SKEE TKKLE+SAS+EVQQ+NRP               
Sbjct: 411 KRQEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLV 470

Query: 460 XXXXXXXXXMGTLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLG 519
                       L+++H  YY  + + N  + N+  I+  LK +VFQ+CHFVFSGLIPL 
Sbjct: 471 DNDDELFYLKDRLADLHKRYYSTLKE-NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLN 529

Query: 520 TDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFE 579
           T++Q +DIVIWT+ FGAT+T+D+D  TTHLITK P T KARLAK FNP+IKI+HPDWIFE
Sbjct: 530 TNVQAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFE 589

Query: 580 CLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHML---TPQE-NL 635
           CL+ W++VD KPY LIV+ P+S+ +++ F+++L +++E  E    +  +L    P E ++
Sbjct: 590 CLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDI 649

Query: 636 NLFAAGTSWLNNDDDEDIP 654
           +LFA G SWLN++DDE+IP
Sbjct: 650 DLFAGGISWLNDEDDEEIP 668

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/661 (53%), Positives = 457/661 (69%), Gaps = 41/661 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWY---LVERASDTTGDDDNEH 57
           MTT ++ P+ LPYPI I +L  S G  + +G RL  YK+W    +V   +DT+       
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTS------- 53

Query: 58  DATXXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPC 117
                            KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C
Sbjct: 54  -------------TKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQAC 100

Query: 118 NHDIVYGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHL 170
            HD+ YGGLC  CGK V    S  A D     +     + +++ISE +A    E  ++ L
Sbjct: 101 THDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQL 160

Query: 171 RRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN 230
           R+ KKL+LVVDLDQT+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM 
Sbjct: 161 RKLKKLVLVVDLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG 220

Query: 231 EDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGE 290
                   PP RKCWYYVK+RPGLKEFF+K+AP FE+HIYTMATRAYA++IAKI+DP G+
Sbjct: 221 ------PKPPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGK 274

Query: 291 LFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVG 350
           LFGDRILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVG
Sbjct: 275 LFGDRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVG 334

Query: 351 DINSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ 410
           DINSNFLP+Q   ML LGR+ R+K++E +ELLTDI+D EKKLQEKID+EVKRQEEKL+ +
Sbjct: 335 DINSNFLPRQQNSMLHLGRRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-K 392

Query: 411 LATAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMG 470
           +   ++P    SKE+L KKLE+SASLEVQQQNRP                          
Sbjct: 393 MTEEKQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSR 452

Query: 471 TLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIW 530
            L  +H  YY+ +S+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +W
Sbjct: 453 ILLQVHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALW 511

Query: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEK 590
           TS FGA +T+DID  TTH+ITK P T+KARLAK FNPEIK++HPDWIFECLVNWK+VDEK
Sbjct: 512 TSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEK 571

Query: 591 PYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDD 650
            Y L+++ P+S+EEL +F+K+L+  ++  +   Q++      + +NL A   SWL+NDDD
Sbjct: 572 AYELLIEQPVSEEELDDFKKKLENEKK--DAQIQEEVDRVSSDEINLLAGNDSWLDNDDD 629

Query: 651 E 651
           E
Sbjct: 630 E 630

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/659 (53%), Positives = 456/659 (69%), Gaps = 36/659 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L     D     + E    
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWEL----QDVITAPNEE---- 52

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H+
Sbjct: 53  ----------ASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHE 102

Query: 121 IVYGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRSGEALKEHLRR 172
           + YG LC  CGK V  D    +  GV    L V   + ++++SE +A    +  ++ LR 
Sbjct: 103 VTYGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRE 162

Query: 173 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNED 232
            KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM   
Sbjct: 163 RKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP- 221

Query: 233 GSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELF 292
               +PPP R+C YYVK+RPGL+EFFDKVAP FE+HIYTMATRAYA++IAKI+DPT  LF
Sbjct: 222 ----RPPP-RRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALF 276

Query: 293 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 352
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDI
Sbjct: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336

Query: 353 NSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLA 412
           NSNFLP+Q   ML +GR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N +++
Sbjct: 337 NSNFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KIS 394

Query: 413 TAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTL 472
              +P  + SKE+LTKKLE++ASLEVQQQNRP                           L
Sbjct: 395 EENQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEIL 454

Query: 473 SNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTS 532
            N+H TYY+ ++++ E  P++  ++P +K KVF  CHFVFSGLIPLGT+I+ +DIV+WT+
Sbjct: 455 LNVHRTYYEELAKT-EVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTN 513

Query: 533 TFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPY 592
            FGA ++SDID  TTH+ITK P T+KARLAK +NP+IKI+HPDWIFECLV W + DEKPY
Sbjct: 514 MFGAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPY 573

Query: 593 TLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDE 651
            LI++  +S +EL+ FQ+ L+KRQ   E+  ++       E LNL A    WL+NDDDE
Sbjct: 574 ELIIEQEVSSDELEEFQRNLKKRQ-MAEKAARESLQQETGEELNLLAGNDMWLDNDDDE 631

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/669 (51%), Positives = 448/669 (66%), Gaps = 42/669 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M+T IR P+ LPYPI + +L  S G  +  G RL  YK+W   E+   + GD+       
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDF-EQIVTSPGDE------- 52

Query: 61  XXXXXXXXXXXXXTKQLRESIEF---FESPYEGDLISWNVDVGDEIATANQVICEIKRPC 117
                         K  R+ I+    F+SP  G ++S N+ +GDE   +   + EIK+PC
Sbjct: 53  ----------SAGGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPC 102

Query: 118 NHDIVYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRSGEALKEHL 170
            HD+ YGGLC QCG+ V  +   G  LD          +M+++ISE +A    ++ ++ L
Sbjct: 103 THDVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQL 162

Query: 171 RRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN 230
           R  +KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM 
Sbjct: 163 REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG 222

Query: 231 EDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGE 290
                   PP RKCWYYVK+RPGL++FF  +AP FE+HIYTMATR YA++IAKI+DP G 
Sbjct: 223 ------PKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGT 276

Query: 291 LFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVG 350
           LFGDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+G
Sbjct: 277 LFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIG 336

Query: 351 DINSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ 410
           DINSNFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +
Sbjct: 337 DINSNFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QK 395

Query: 411 LATAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMG 470
           L+  + P    SKE++ KKLE++ASLEVQQQNRP                          
Sbjct: 396 LSEEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTD 455

Query: 471 TLSNIHNTYYQMISQ----SNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSD 526
            L  +H+ YY  + +    + E  P++  +IPSLK+ VF+ C+FVFSGLIPL T+I R+D
Sbjct: 456 ILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRAD 515

Query: 527 IVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKK 586
           IV+WT+TFGA +T +IDY TTHLITK P T KARLA  FN +IKI+HPDWIFEC+VNWK+
Sbjct: 516 IVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKR 575

Query: 587 VDEKPYTLIVDSPISDEELQNFQKQL---QKRQEYLEENQQQQHMLTPQENLNLFAAGTS 643
           VDEKPY LIV+ P+S E L+NF+K+L   +K +  ++ N   Q   T  + + L     S
Sbjct: 576 VDEKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDS 635

Query: 644 WLNNDDDED 652
           WL+NDD+ D
Sbjct: 636 WLDNDDEMD 644

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/637 (53%), Positives = 441/637 (69%), Gaps = 38/637 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L     D     + E    
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWEL----QDIITAPNEE---- 52

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H+
Sbjct: 53  ----------APKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHE 102

Query: 121 IVYGGLCTQCGKEVSAD-------AFDGVPLDVV-GDMDLQISETEAIRSGEALKEHLRR 172
           + YGGLC  CGK V  D             L V   + ++++SE +A    +  ++HLR 
Sbjct: 103 VTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLRE 162

Query: 173 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNED 232
            KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM   
Sbjct: 163 HKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGP- 221

Query: 233 GSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELF 292
               +PPP RKC YYVK+RPGL+EFFDK+AP FE+HIYTMATRAYA++IAKI+DP GELF
Sbjct: 222 ----RPPP-RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELF 276

Query: 293 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 352
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDI
Sbjct: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336

Query: 353 NSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLA 412
           NSNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++ 
Sbjct: 337 NSNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KIN 394

Query: 413 TAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTL 472
              +P    SKE+LTKKLE++ASLEVQQQNRP                           L
Sbjct: 395 EENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNIL 454

Query: 473 SNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTS 532
            N+H TYY  +++  +P P++  ++P +K +VF+ CHFVFSGLIPLGT+++++DIV+WTS
Sbjct: 455 LNVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTS 513

Query: 533 TFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPY 592
            FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK+IHPDWIFECLV W +V+EKPY
Sbjct: 514 MFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPY 573

Query: 593 TLIVDSPISDEELQNFQKQLQKRQE---YLEENQQQQ 626
            L  +  +S EEL+ F+K+L K+++    L E+ QQ+
Sbjct: 574 ELTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQE 610

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/660 (51%), Positives = 450/660 (68%), Gaps = 41/660 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60
           M+T IR P+ LPYPI I +L  S G  + +G RL+ YK+W LV+  +   G+++      
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVIT-APGEEE------ 53

Query: 61  XXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120
                         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD
Sbjct: 54  ---------AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHD 104

Query: 121 IVYGGLCTQCGKEVS--ADAFDGV---PLDVV-GDMDLQISETEAIRSGEALKEHLRRDK 174
           + YGGLC QCG+ V   A A DGV    L V   +  +++SE +A   G++ +  LR  +
Sbjct: 105 VTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREAR 164

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           KL+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM     
Sbjct: 165 KLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK-- 222

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGD 294
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYA++IAKI+DP G+LFGD
Sbjct: 223 ----PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278

Query: 295 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 354
           RILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 279 RILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 338

Query: 355 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 414
           NFLP Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+EKI++EVKRQE+++ H+L   
Sbjct: 339 NFLPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDE 397

Query: 415 EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 474
           + P       ++ KKLE++ASLEVQQQNRP                           L  
Sbjct: 398 KLPDTR----DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLK 453

Query: 475 IHNTYYQMISQSN---EPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWT 531
           +H+ YY  + + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT
Sbjct: 454 VHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWT 513

Query: 532 STFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKP 591
           + FGA++T+++DY TTHLIT+ P T KARLAK FNP IKI+HPDWIFECLV W++V+E P
Sbjct: 514 NMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESP 573

Query: 592 YTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDE 651
           Y LIV+ P+ +E L+NF++ L + Q+ ++   Q       + +L L     SWL+ DDDE
Sbjct: 574 YELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDS-----RSSLLLLDGNGSWLDYDDDE 628

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/664 (48%), Positives = 435/664 (65%), Gaps = 47/664 (7%)

Query: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFW----YLVERASDTTGDDDNE 56
           + T ++    LPYPI + +L    G ++ +G RL  Y++W     LV+    T       
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKTK------ 56

Query: 57  HDATXXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRP 116
                             KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ 
Sbjct: 57  ------------------KQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQD 98

Query: 117 CNHDIVYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKK 175
           CNHDI YGGLC QCG  V   D    + +  V + ++++SE +A     +    LR +KK
Sbjct: 99  CNHDITYGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKK 157

Query: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235
           L+LVVDLDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y       
Sbjct: 158 LVLVVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG----- 212

Query: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295
              PP RK WYYVK+RPGLKEFF+ V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDR
Sbjct: 213 -PKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDR 271

Query: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355
           ILSRDENGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSN
Sbjct: 272 ILSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSN 331

Query: 356 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNH-QLATA 414
           FLP+Q   +L LGR  R+K QE ++L++DI+DNEKKL+EKID+EVKRQEE ++H      
Sbjct: 332 FLPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNT 390

Query: 415 EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXXXXXXXXXXXMGTLSN 474
            +     +KE+++KKLE+SASLEVQQQNRP                           L  
Sbjct: 391 RKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLR 450

Query: 475 IHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTF 534
           +H  Y+   +++ +  P++  ++P +K KVFQ CHFVFSGLIPL TD++++DIV+WT  F
Sbjct: 451 VHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMF 510

Query: 535 GATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTL 594
           GAT++SDI+Y TTH+IT    T+KARLAK FNP+IKI+HPDW+FECLV W++V E PY L
Sbjct: 511 GATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYEL 570

Query: 595 IVDSPISDEELQNFQKQLQKRQEY-------LEENQQQQHMLTPQENLNLFAAGTSWLNN 647
           ++  P+ +++++ F+++L K+           E+  + + +L   +  +L A   SWL+N
Sbjct: 571 LIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEEVLG--DEFHLLAGNDSWLDN 628

Query: 648 DDDE 651
           DDDE
Sbjct: 629 DDDE 632

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 54/133 (40%), Gaps = 34/133 (25%)

Query: 165 ALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVL 224
           A KE  R  +K  L++DLD+T++H                           +    + V+
Sbjct: 313 APKEIKRFGRKKCLILDLDETLVHSSF-----------------------KYVDSADFVI 349

Query: 225 PLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKI 284
           P+   N+   V           YV  RPG+ EF  +V+ L+E+ ++T +   Y   +  I
Sbjct: 350 PVTIDNQTHHV-----------YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNI 398

Query: 285 VDPTGELFGDRIL 297
           +DP   +   R+ 
Sbjct: 399 LDPANTIIHHRLF 411

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 38/129 (29%)

Query: 173 DKKLI----LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMY 228
           +KKLI    LV+DLD+T++H                  F+ L+         + VLP+  
Sbjct: 296 EKKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-------DFVLPVNI 332

Query: 229 MNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPT 288
             +  +V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+DP 
Sbjct: 333 DEQIHNV-----------YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPG 381

Query: 289 GELFGDRIL 297
            +L   R+ 
Sbjct: 382 RQLIHHRLF 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 47/166 (28%)

Query: 150 MDLQISETEAIRSGEALKEHLRR---------DKKLILVVDLDQTIIHCGVDPTIAEWKN 200
           MD +I +  A++ G++    L           + K  LV+DLD+T++H            
Sbjct: 195 MDDEIIDIAALQPGQSHAPGLVTLLPPKDPVFEGKKCLVLDLDETLVHS----------- 243

Query: 201 DPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDK 260
                +F+ LR         + V+P+   ++  +V           YV  RPG+ EF ++
Sbjct: 244 -----SFKYLRTA-------DFVIPVEIDDQVHNV-----------YVIKRPGVDEFLER 280

Query: 261 VAPLFEMHIYTMATRAYAIQIAKIVDPTG----ELFGDRILSRDEN 302
           V  L+E+ ++T +   Y   +  I+DP G     LF D   + D N
Sbjct: 281 VGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 57/131 (43%), Gaps = 34/131 (25%)

Query: 167 KEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPL 226
           K+ ++   K  LV+DLD+T++H       + +K  PN                 +  LP+
Sbjct: 335 KDEIKFKHKKCLVLDLDETLVH-------SSFKYLPN----------------ADFNLPV 371

Query: 227 MYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
              ++  +V           YV  RPG+ EF +KV  LFE+ I+T +   Y   +   +D
Sbjct: 372 NIDDQIHNV-----------YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLD 420

Query: 287 PTGELFGDRIL 297
           P G+    R+ 
Sbjct: 421 PKGKSIHHRLF 431

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 529 IWTSTFGATSTSDIDYLTT---HLITKNPSTYKARLAKKFNP-EIKIIHPDWIFECLVNW 584
           ++TS         +DYL+T   H+IT +P      + K+FN  E+  +   W+ EC V  
Sbjct: 138 LYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQAVLVLKRFNKFEVLTVSSAWLAECFVRQ 197

Query: 585 KKVDEKPYTLIVDSPISDEEL 605
           + V E  Y  +V S +S+EE+
Sbjct: 198 EYVSEAAY--LVGSEMSNEEV 216

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 520 TDIQRSDIVIWTSTFGATSTSDIDYL---TTHLITKNPS--TYKARLAKKFNPEIKIIHP 574
           T   R++ ++++    A   S  D +   TTHLI+ +P+     A +A   +  IK ++P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 575 DWIFECLVNWKKVDEKPYTLIVDSPISDEELQ 606
            W+ +C +  K VDEK +  I+DS +S E+ +
Sbjct: 193 AWLCQCFLEVKYVDEKNF--ILDSSLSPEDAE 222

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 3/95 (3%)

Query: 494 MEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKN 553
           + +IP  K+K+F       +     G   QR  I   T   G TST+++    THL+   
Sbjct: 335 LTLIP-YKRKMFDKNQLTLTFTNYFGQ--QRYYIQQLTRFLGGTSTTELSKKNTHLLFGF 391

Query: 554 PSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVD 588
           P   K   A K+     +++  W+  C     K+D
Sbjct: 392 PYGKKYETALKWTDNCSVVNHRWLENCYEKGSKLD 426

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 532 STFGATSTSDIDYLTTHLITKNPS--TYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDE 589
           +  G T+   I  LTTHLIT +P+     A +A +    I  ++P W+ +C  +   V+E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 590 KPYTLIVDSPISDEE--LQNFQKQLQKRQEYLEENQQQQH 627
             + + + S   D +  LQ+    +++ Q     N   QH
Sbjct: 205 SDHLINIQSSAEDSKNRLQDLWNMVEESQPLRTLNILNQH 244

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 500 LKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKA 559
            K+K+F+    + +     G   QR  I   T   G  +++D+    THLI  +P   K 
Sbjct: 337 FKKKIFERSQLILAYTNYFGP--QRYYIQRLTRLMGGIASTDLSKKNTHLIFGSPHGKKY 394

Query: 560 RLAKKFNPEIKII-HPDWIFECLVNWKKVD 588
             A +  P I +  +  W+ +C ++ +K+D
Sbjct: 395 DFAMR-RPNILVTTNHSWLEDCYISGEKLD 423

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 34/118 (28%)

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           +K  L++DLD+T++H                           +    + VLP+   ++  
Sbjct: 226 QKKCLILDLDETLVHSSF-----------------------KYMHSADFVLPVEIDDQVH 262

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
           +V           YV  RPG+ EF ++V+ L+E+ ++T +   YA  +   +DP G +
Sbjct: 263 NV-----------YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%)

Query: 523 QRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLV 582
           QR+ I   T+  G  +T+ + ++   L+   P   K + A+K+  ++ I+ P+W+ EC  
Sbjct: 360 QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYK 419

Query: 583 NWKKVDEKPY 592
             KK+D K +
Sbjct: 420 ANKKLDPKLF 429

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 35/115 (30%)

Query: 172 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNE 231
           +DKK  L++DLD+T++H                 +F+ LR         + VLP+   ++
Sbjct: 243 KDKKC-LILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQ 278

Query: 232 DGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
             +V           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 279 VHNV-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 75/188 (39%), Gaps = 26/188 (13%)

Query: 479 YYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATS 538
           ++ M S      PN   +    K+K+F++   + +     G   QRS I   T   G  S
Sbjct: 331 FFHMWSICEFVPPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGIS 388

Query: 539 TSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDS 598
           T+++    THL+++ P   K   AKK+    ++I+  W+           E+ Y   +  
Sbjct: 389 TTELSKRNTHLVSRMPVGKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQ 437

Query: 599 PISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAG----------TSWLNND 648
             +  E Q+F+       + L    Q  + L   E+L    A           T   N+D
Sbjct: 438 DPNSSEFQDFKID---EDDILLTLGQYNYKLKQLEDLQALKADDIMNSNNGDMTPIKNDD 494

Query: 649 DDEDIPDT 656
           D+ED  DT
Sbjct: 495 DNEDYIDT 502

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 509 HFVFSGLIPLGT-DIQRSDIVIWT---STFGATSTSDIDYLTTHLIT---KNPSTYKARL 561
           HF  +  I + T  ++ S+ + ++   ++ G T T  I+  TTHLI     +P+    + 
Sbjct: 131 HFFRNFQICISTYSMKFSEYIFYSELINSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 562 AKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVD 597
             + N  IK ++P W+ +C    K +DE P+ +  D
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITED 226

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                 +F+ L+         + VLP+   ++  +
Sbjct: 312 KKCLVLDLDETLVHS----------------SFKYLKGA-------DFVLPVDIDDQIHN 348

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           V           YV  RPG+ EF  KV  LFE+ I+T +   Y   +  I+D
Sbjct: 349 V-----------YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 35/123 (28%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  L++DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 281

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGD 294
           V           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D T ++   
Sbjct: 282 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHH 329

Query: 295 RIL 297
           R+ 
Sbjct: 330 RLF 332

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 34/118 (28%)

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           +K  L++DLD+T++H                           +    + VLP+   ++  
Sbjct: 221 QKKCLILDLDETLVHSSF-----------------------KYMHTADFVLPVEIDDQVH 257

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
           +V           YV  RPG+ EF  +V  L+E+ ++T +   YA  +   +DP G +
Sbjct: 258 NV-----------YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 34/112 (30%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  L++DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 280

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           V           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 281 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 10/164 (6%)

Query: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539
           + M S      P+   ++  L+ K+F     + S    LG   QR  I       G  ST
Sbjct: 316 FFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGAST 373

Query: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVD-------EKPY 592
           +++    TH+++  P   K + A +++   K+++  W+ EC    KK+D       E P 
Sbjct: 374 TELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIPV 433

Query: 593 TLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLN 636
              + + +    L+++++   K QE  EE +Q   +   QEN +
Sbjct: 434 RGGLKNVLGQLSLEDYEENTGK-QELHEEKEQLSTITDTQENFD 476

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 7/94 (7%)

Query: 247 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRDE----N 302
           YV  RPG+  F    + LFE+ I+T +   Y   +  I+D T +L   R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 303 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPN 336
           G+   K+LA+L     S ++++D+    + + PN
Sbjct: 276 GNY-IKNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 518 LGTDIQRSDIVIWTS---TFGATSTSDIDYLTTHLITKNPSTYKARLAKK-FNPEIKIIH 573
           L    + S+ +++T    + G T   +I+  TTH+IT NP      + K+     IK I+
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 574 PDWIFECLVNWKKVDEKPYTLIVDSPISDE 603
           P W+  C+   + +DE  + ++   P +D+
Sbjct: 193 PTWLIHCVKESQLIDESEHEIV---PFTDD 219

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 6/97 (6%)

Query: 502 QKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARL 561
           ++VF+ C    +G      +  R +IV+    F    T   D   TH++ +N S  K   
Sbjct: 88  RRVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIE 145

Query: 562 AKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDS 598
            + F    K++ P WI  C+   K +  + Y++IV S
Sbjct: 146 FRNF----KVVQPGWIGACVRIGKMLSWREYSVIVRS 178

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 33/123 (26%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  L++DLD+T++H              NNP+F               +LP+    EDG 
Sbjct: 312 KKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIEI--EDGQ 346

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGD 294
           +           YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D    L   
Sbjct: 347 IHN--------VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINH 398

Query: 295 RIL 297
           R+ 
Sbjct: 399 RLF 401

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 247 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 34/112 (30%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                  F+ LR         + VLP+   N D  
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLRTA-------DFVLPV---NIDDQ 273

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 274 VHN--------VYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                 +F+ LR         + VLP+   ++  +
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVLPVDIDDQIHN 319

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 320 V-----------YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 38/132 (28%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N+  +
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQIHN 276

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPT----GE 290
           V           YV  RPG+ EF   V  L+E+ ++T +   Y   +  ++D T      
Sbjct: 277 V-----------YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHR 325

Query: 291 LFGDRILSRDEN 302
           LF D   + D N
Sbjct: 326 LFRDSCYNYDGN 337

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 40/149 (26%)

Query: 140 DGVPLDVVGDMDLQISETEAIRSGEAL--KEHLRRDKKLILVVDLDQTIIHCGVDPTIAE 197
           DG PLD+     LQ  +  A      L  K  + + KK  LV+DLD+T++H         
Sbjct: 211 DGEPLDL---SQLQPDQAHAPGCNTLLLPKADMFKGKK-CLVLDLDETLVHS-------- 258

Query: 198 WKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEF 257
                   +F+ LR         + V+P+   N+  +V           YV  RPG+ EF
Sbjct: 259 --------SFKYLRTA-------DFVIPVEIDNQVHNV-----------YVIKRPGVDEF 292

Query: 258 FDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
             ++  L+E+ ++T +   Y   +  I+D
Sbjct: 293 LRRITELYEVVVFTASVSRYGDPLLDILD 321

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 247 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 34/114 (29%)

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           +K  L++DLD+T++H                  F+ L          + VLP+   ++  
Sbjct: 214 QKKCLILDLDETLVHSS----------------FKYLHTA-------DFVLPVEIDDQVH 250

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP 287
           +V           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP
Sbjct: 251 NV-----------YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W
           (REAL)
          Length = 1075

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 17/142 (11%)

Query: 472 LSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWT 531
           + N+   +Y    Q   P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQQFVPAAQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 532 STFGATSTSDIDYLTTHLITKNPSTYKARLAKKF--NPEIKIIHPD--WIFECLVNWKKV 587
              G  ST ++    THLITKN    K ++AKK+  +P+  II  +  W+ EC +N  K+
Sbjct: 400 EILGGLSTPELTRKNTHLITKNAIGKKFKVAKKWSLDPQNAIIVTNHLWLEECYMNNSKL 459

Query: 588 DEKPYTLIVDSPISDEELQNFQ 609
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 34/110 (30%)

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LV+DLD+T++H                  F+ L ++  F      VLP+   N+  +V  
Sbjct: 285 LVLDLDETLVHSS----------------FKYL-NIADF------VLPVDIDNQVQNV-- 319

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP 287
                    YV  RPG+ EF   V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 ---------YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 34/117 (29%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                  F+ +R         + VLP+   ++  +
Sbjct: 228 KKCLVLDLDETLVHSS----------------FKYVRTA-------DFVLPVEIEDQIHN 264

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 265 V-----------YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 35/127 (27%)

Query: 165 ALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVL 224
           A K+ + ++KK  LV+DLD+T++H                           +    + VL
Sbjct: 298 AKKDPVFKNKKC-LVLDLDETLVHSSF-----------------------KYIDTADFVL 333

Query: 225 PLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKI 284
           P+   ++   V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  I
Sbjct: 334 PVTIDDQTHQV-----------YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDI 382

Query: 285 VDPTGEL 291
           +D +  +
Sbjct: 383 LDSSKSI 389

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 35/115 (30%)

Query: 172 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNE 231
           R +K  LV+DLD+T++H                 +F+ L          + V+P+   N+
Sbjct: 306 RGRK-CLVLDLDETLVHS----------------SFKYLHTA-------DFVIPVEIDNQ 341

Query: 232 DGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
             +V           YV  RPG+ EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 342 VHNV-----------YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 34/113 (30%)

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           +K  LV+DLD+T++H                  F+ L+         + VLP+   ++  
Sbjct: 312 RKKCLVLDLDETLVHSS----------------FKYLKSA-------DFVLPVDIDDQIH 348

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           +V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  ++D
Sbjct: 349 NV-----------YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakly
           similar to uniprot|P38850 Saccharomyces cerevisiae
           YHR154w ESC4 Establishes Silent Chromatin
          Length = 1099

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 25/164 (15%)

Query: 489 PEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTH 548
           P+ N +  +P  ++K+F+      +     G   QR+ +       G ++T ++    TH
Sbjct: 356 PDTNAI-CLPRRRRKLFRKQDLAVTYTNYFGE--QRTYLQQLIELLGGSATMELSKQNTH 412

Query: 549 LITKNPSTYKARLAKKF---NPEIKIIHPDWIFECLVNWKKV-----------DEKPYTL 594
           LI   P   K  +A K+     +I I    W+ EC ++ KKV           D+  Y+L
Sbjct: 413 LICNLPFGKKYEVAMKWKESGSKIVICSHRWLEECYISGKKVPVDEAYTRLERDDNTYSL 472

Query: 595 IV--------DSPISDEELQNFQKQLQKRQEYLEENQQQQHMLT 630
            +        DS  S +E  + ++      EYL+ +Q + H LT
Sbjct: 473 TLGQQLSPKLDSENSSDEETDIEESQVFALEYLKTSQSRAHDLT 516

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 247 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291
           YV  RPG+ EF  +VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 5/96 (5%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L +QC  EV    + G  +++  +MD+   +T A  SG+ +   +     RR   +    
Sbjct: 288 LASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIPHEVINGLYRRPDHVKAFN 347

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSF 216
            L  T I CG    ++   +  NNP++ TL  +KS 
Sbjct: 348 KLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSI 383

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L ++C  EV    + G  +++  +MD+   +T A  SG+ +   +     RR  ++    
Sbjct: 288 LASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYRRPDRVKAFN 347

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 215
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 348 QLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKS 382

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 34/113 (30%)

Query: 174 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 233
           ++  LV+DLD+T++H                 +F+ L          + V+P+   N+  
Sbjct: 321 RRKCLVLDLDETLVH----------------SSFKYLHTA-------DFVIPVEIDNQVH 357

Query: 234 SVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           +V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 358 NV-----------YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KNAG0H01910 Chr8 complement(337293..338855) [1563 bp, 520 aa] {ON}
           Anc_2.300 YNL029C
          Length = 520

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 241 VRKCWYYVKVRPGLKEFFD-KVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSR 299
           V++  +Y ++ P ++ F D    P FEM  +      + I I ++      LF    LS 
Sbjct: 198 VKQYEWYWRLEPSVQFFCDLSYDPFFEMKKHG-KKYGFTIMIPELYWTIPNLF-RTTLSY 255

Query: 300 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVW 331
               +LT  SL K+F +D S VV IDD+GD +
Sbjct: 256 LREYNLTVGSLWKVFTSDNS-VVSIDDKGDAY 286

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 54/129 (41%), Gaps = 40/129 (31%)

Query: 163 GEALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEEL 222
           G+A K       K  LV+DLD+T++H                 +F+ L          + 
Sbjct: 271 GDAFKH------KKCLVLDLDETLVHS----------------SFKYLHTA-------DF 301

Query: 223 VLPLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIA 282
           VLP+   ++  +V           YV  RPG+ EF  +V  L+E+ ++T +   Y   + 
Sbjct: 302 VLPVDIDDQIHNV-----------YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLL 350

Query: 283 KIVDPTGEL 291
            ++D +  +
Sbjct: 351 DVLDKSNNI 359

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 34/109 (31%)

Query: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237
           LV+DLD+T++H                 +F+ L+         + VLP+   ++  +V  
Sbjct: 314 LVLDLDETLVHS----------------SFKYLKSA-------DFVLPVDIDDQIHNV-- 348

Query: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
                    YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 ---------YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L + C  EV    + G  +++  +MD+   +T A  SG+ +   +     RR+ ++    
Sbjct: 380 LASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDGIPHEVINGLYRREDRVKAFN 439

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 215
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 440 KLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKS 474

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%)

Query: 546 TTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600
           TTH I  +     A L +  N  I I+ P+WI  C V  + V  + + L  D  I
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYLDADKSI 266

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539
           + M S  +   P+   I   LKQ V ++   + S     G  +QRS I   T   G  ST
Sbjct: 324 FNMWSLDSFTLPSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVST 381

Query: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPE-IKIIHPDWIFEC 580
           + +    THL+++     K  LAK++  +  ++++  W+ EC
Sbjct: 382 TSLTKRNTHLVSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 16/127 (12%)

Query: 480 YQMISQSNEPEPNLMEIIP--SLKQKV----------FQNCHFVFSGLIPLGTDI---QR 524
           +++ISQ+N  + NL+ +    S+ Q +          FQ   F  + L P  T+    QR
Sbjct: 306 FEIISQTNAHKGNLIWMFHMWSMSQFIEPKENIIFEPFQPVIFKRNELRPAYTNYFGRQR 365

Query: 525 SDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFN-PEIKIIHPDWIFECLVN 583
           S I       G  ST++     THLI+++    K + A K+    + +++  W+ EC   
Sbjct: 366 SYIQRLVELLGGVSTTEFSKRNTHLISRSNVGKKFKTAMKWGESSVIVVNHLWLEECYKL 425

Query: 584 WKKVDEK 590
            KK+D K
Sbjct: 426 NKKLDPK 432

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 251 RPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP-----TGELFGDRILSRDENGSL 305
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 306 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 344
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%)

Query: 546 TTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDS 598
           TTH +  +  +    LA+  N  I ++ P+WI  C +  + V  + + L VDS
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDS 263

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 38/132 (28%)

Query: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234
           K  LV+DLD+T++H                 +F+ LR         + V+P+   N+  +
Sbjct: 239 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQVHN 275

Query: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPT----GE 290
           V           YV  RPG+ +F   V  L+E+ ++T +   Y   +  ++D        
Sbjct: 276 V-----------YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHR 324

Query: 291 LFGDRILSRDEN 302
           LF D   + D N
Sbjct: 325 LFRDSCYNYDGN 336

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 16/97 (16%)

Query: 501 KQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLT-----THLITKNPS 555
           +  +F+ C    +G      +  R +IV+   TF       + YL      TH++ ++  
Sbjct: 40  RTPIFRGCRVHVNGHTDPDREELRREIVMHGGTF-------VHYLARPSDVTHIVAEHVP 92

Query: 556 TYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPY 592
             K RL        K++ P W+  CL + + V  KPY
Sbjct: 93  VAKRRLWH----ACKVVRPAWVSACLCSGELVPWKPY 125

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 247 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVD 286
           YV  RPG+ +F + V+ +FE+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 251 RPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP-----TGELFGDRILSRDENGSL 305
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 306 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 344
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {ON}
           Anc_6.48 YLR260W
          Length = 646

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L ++C  +++   + G  + +  ++D+   +T A  SG+ +   +     RR  ++    
Sbjct: 281 LASECSIDIAYTEYIGHGIKIAQELDIDKYDTIACASGDGIPHEIMNGLYRRPDRVKAFN 340

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVL 224
            L  T I CG    ++   +  NNP++ TL  +KS  +  +++L
Sbjct: 341 KLAITQIPCGSGNAMSVSCHWTNNPSYATLCLIKSIEVRVDVML 384

>YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}
           RTT107Protein implicated in Mms22-dependent DNA repair
           during S phase; involved in recruiting the SMC5/6
           complex to double-strand breaks; DNA damage induces
           phosphorylation by Mec1p at one or more SQ/TQ motifs;
           interacts with Mms22p and Slx4p; has four BRCT domains;
           has a role in regulation of Ty1 transposition
          Length = 1070

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 17/142 (11%)

Query: 472 LSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWT 531
           + N+   +Y    Q   P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQKFTPVSQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 532 STFGATSTSDIDYLTTHLITKNPSTYKARLAKKF--NPEIKIIHPD--WIFECLVNWKKV 587
              G  ST ++    THLITK+    K ++AKK+  +P+  II  +  W+ +C +N  K+
Sbjct: 400 EILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMNNSKL 459

Query: 588 DEKPYTLIVDSPISDEELQNFQ 609
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKI-IHPDWIFECLVNWKKVDE 589
            S FG T    +    TH+IT + +    +  +KF+    I + P+W+ +CL   + + E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 590 KPYTLIVD 597
             Y + V+
Sbjct: 206 DEYLINVN 213

>Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L ++C  EV    + G  +++  DM++   +T    SG+ +   +     RR   +    
Sbjct: 288 LASRCSIEVVYTKYPGHAVEIAEDMNIDKYDTVVCASGDGIPHEVMNGLYRRPDHVKAFN 347

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 215
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 348 KLAITQIPCGSGNAMSVSCHWTNNPSYSTLCLIKS 382

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539
           + M S  +   P    ++  L+  VF     + S    LG   QR  I       G  ST
Sbjct: 316 FHMWSLQSFVLPQFKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVST 373

Query: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYT 593
           +++    THL+T  P   K   A ++    KI +  W+ +C   ++K  + P+ 
Sbjct: 374 TELTKKNTHLLTCLPLGQKYEAALRWEGTCKIANHLWLEDC---YRKQTQVPFV 424

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 11/109 (10%)

Query: 242 RKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP-----TGELFGDRI 296
           +  W   K RPG   F   ++  +E+ +++     Y+ +IA+ +DP     +  LF +  
Sbjct: 210 KHGWRTAK-RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHC 268

Query: 297 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 344
           + +D    +  K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 269 VYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 139 FDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVVDLDQTIIHCGVDP 193
           + G  +++  +MD++  +T A  SG+ +   +     RR  ++     L  T I CG   
Sbjct: 395 YSGHAIEIAKNMDIEKYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITEIPCGSGN 454

Query: 194 TIAEWKNDPNNPNFETLRDVKS 215
            ++   N  NNP++ TL  +KS
Sbjct: 455 AMSVSCNWTNNPSYATLFIIKS 476

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 522 IQRSDIVIWTSTFGATSTSD-IDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFEC 580
           + ++ I    S  GA +  D +   TTH I     +    L K  N  I ++ P+W+  C
Sbjct: 186 VTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

Query: 581 LVNWKKVDEKPYTLIVD 597
            +  + V  + + L  D
Sbjct: 246 ELERRIVGVRGFYLDAD 262

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 126 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHL-----RRDKKLILVV 180
           L ++C  EV    + G  +++  +MD+   +T A  SG+ +   +     +R   +    
Sbjct: 297 LASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFN 356

Query: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSF 216
           ++  T I CG    ++   +  NNP++ TL  +KS 
Sbjct: 357 NIAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSI 392

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%)

Query: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539
           + M+S      P    ++     K+F     V +    LG   QR  I       G +ST
Sbjct: 313 FYMLSMQQFIAPTAKLVLSPRYPKLFTEKELVLAFTNYLGQ--QRYYIQRLVDLLGGSST 370

Query: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVD 588
           +++    THLI+  P   K   A K+N  I + H  W+ +C    KK+D
Sbjct: 371 TELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLD 418

>Skud_8.218 Chr8 (374359..377589) [3231 bp, 1076 aa] {ON} YHR154W
           (REAL)
          Length = 1076

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 523 QRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKF--NPEIKIIHPD--WIF 578
           QR  I       G  ST ++    THLITKN    K ++AKK+  +P+  II  +  W+ 
Sbjct: 391 QRFYIQRLVEILGGLSTPELTRKNTHLITKNTIGKKFKVAKKWSLDPQNAIIVTNHMWLE 450

Query: 579 ECLVNWKKVDEKPYTLIVDSPISDEELQNFQ 609
           +C +   K++ +           D + QNF+
Sbjct: 451 QCYMKNAKLNPR-----------DSKFQNFK 470

>Suva_15.353 Chr15 (607037..610276) [3240 bp, 1079 aa] {ON} YHR154W
           (REAL)
          Length = 1079

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 56/142 (39%), Gaps = 17/142 (11%)

Query: 472 LSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWT 531
           + N+   +Y    Q   P      I      K+F +     +     G+  QR  I    
Sbjct: 342 VGNVSWLFYMFALQKFTPVSQCKLIHQPFHAKLFTSKELTVAYTNYFGS--QRFYIQRLV 399

Query: 532 STFGATSTSDIDYLTTHLITKNPSTYKARLAKKF--NPEIKIIHPD--WIFECLVNWKKV 587
              G  ST ++    THLITKN    K ++AKK+  +P+  II  +  W+  C +   K+
Sbjct: 400 EILGGFSTPELTRKNTHLITKNTIGKKFKVAKKWSLDPQSAIIVTNHMWLELCYLTNSKL 459

Query: 588 DEKPYTLIVDSPISDEELQNFQ 609
           + K           D   QNF+
Sbjct: 460 NPK-----------DSRFQNFK 470

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 48/112 (42%), Gaps = 22/112 (19%)

Query: 170 LRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMY- 228
           L+ +K+  L++DLD+T+IH                      R++ S T+    ++ + + 
Sbjct: 187 LKTNKRKKLILDLDETLIHSMS-------------------RNISSSTISNYHLIEVKFP 227

Query: 229 --MNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA 278
              +   S   P       YYV  RP    F + V+  +++ I+T + + YA
Sbjct: 228 TPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa]
           {ON} weakly similar to uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 1162

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 2/91 (2%)

Query: 523 QRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLV 582
           QR  I    +  G  +TS++    THL+ + P   K   AK +  +  I +  W+ EC  
Sbjct: 363 QRFYIQRLVNALGGFTTSELSRRNTHLLCRFPFGKKFETAKNWGDKCVITNYLWLEECYR 422

Query: 583 NWKKVDEKPYTLIVDSPISDEELQNFQKQLQ 613
              ++D  P T        + ELQ    Q+Q
Sbjct: 423 QSTRLD--PLTPCFQQLPVEGELQRTLGQMQ 451

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 251 RPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDP-----TGELFGDRILSRDENGSL 305
           RPG + F   ++  +E+ +++     Y+ + A+ +DP     +  LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 306 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 344
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,195,740
Number of extensions: 3511488
Number of successful extensions: 23915
Number of sequences better than 10.0: 273
Number of HSP's gapped: 24254
Number of HSP's successfully gapped: 306
Length of query: 734
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 617
Effective length of database: 40,065,477
Effective search space: 24720399309
Effective search space used: 24720399309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)