Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4488.837ON36436416210.0
Smik_13.4898.837ON37237214520.0
YMR276W (DSK2)8.837ON37338214140.0
Suva_13.4648.837ON36637013810.0
CAGL0M02937g8.837ON37338010941e-148
NCAS0C004308.837ON36937710791e-146
KAFR0B039008.837ON37938310671e-144
Kpol_1068.118.837ON38138610411e-140
TDEL0B006008.837ON36937310391e-140
SAKL0D01540g8.837ON36537210371e-140
ZYRO0G14124g8.837ON36938210061e-135
TPHA0I002208.837ON37738310041e-135
Kwal_27.102758.837ON3793869981e-134
NDAI0K004408.837ON4044079881e-132
KLLA0D01859g8.837ON3713729781e-131
KLTH0C03938g8.837ON3763859661e-129
TBLA0D032308.837ON3753769321e-124
ABL129W8.837ON3453649031e-120
KNAG0J002908.837ON3673888921e-118
Ecym_46088.837ON4064108891e-117
TBLA0B032408.837ON2842271573e-11
Kpol_1036.628.311ON77481163e-07
SAKL0H15818g8.311ON77731154e-07
KLTH0G12540g8.311ON77711102e-06
KLLA0F17974g8.311ON77711083e-06
CAGL0B01589g8.311ON77561083e-06
TPHA0C008908.311ON77711059e-06
NCAS0B035208.311ON77481059e-06
ZYRO0D05962g8.311ON77561032e-05
NDAI0J010708.311ON77481032e-05
KAFR0E005301.480ON379751113e-05
TDEL0G017504.16ON7749988e-05
YEL037C (RAD23)1.480ON398661079e-05
NDAI0H002704.16ON7749971e-04
AFR358W1.480ON413791071e-04
TDEL0F043808.311ON7756961e-04
YDR139C (RUB1)8.311ON7748962e-04
Suva_10.32singletonON6249942e-04
NDAI0G003301.480ON427661052e-04
Skud_5.531.480ON397661052e-04
Suva_5.321.480ON409661042e-04
Ecym_35721.480ON443771042e-04
Smik_5.561.480ON397661033e-04
CAGL0L01309g1.480ON392661015e-04
SAKL0D11814g1.480ON400661015e-04
Kwal_YGOB_Anc_5.7015.701ON12849930.001
KLTH0E01078g5.701ON12849930.001
Skud_9.205.701ON12549930.001
Smik_11.3575.701ON12549930.001
Smik_9.215.701ON12449930.001
SAKL0E14894g5.701ON12849930.001
KLLA0A00616g5.701ON12849930.001
ZYRO0G06622g5.701ON12849930.001
TPHA0E002405.701ON12849930.001
TPHA0D046005.701ON12849930.001
TBLA0E021105.701ON12849930.001
CAGL0G02475g5.701ON12849930.001
Kpol_1043.695.701ON12849930.001
KAFR0D022305.701ON12849930.001
KAFR0H002205.701ON12849930.001
Suva_11.3305.701ON12849930.001
Skud_11.3335.701ON12849930.001
YIL148W (RPL40A)5.701ON12849930.001
YKR094C (RPL40B)5.701ON12849930.001
KLLA0E22133g1.480ON38366980.001
TDEL0B022005.701ON12849920.001
NDAI0E050305.701ON12849920.001
NCAS0A032105.701ON12849920.001
NCAS0G002405.701ON12849920.001
Ecym_40195.701ON12849920.001
AFR285C5.701ON12849920.001
KNAG0L021205.701ON12849920.001
Kwal_27.101521.480ON38146970.002
KAFR0C030008.142ON39740970.002
Suva_9.405.701ON14449920.002
KAFR0I027801.480ON21458930.003
KNAG0J028804.16ON15356910.003
Ecym_84084.16ON15356910.003
TPHA0K022504.16ON15349910.003
Suva_10.34singletonON15156910.003
KNAG0C065805.701ON14949900.003
Ecym_41818.386ON15249890.005
ZYRO0C04026g8.386ON15249890.005
KLTH0F08734g8.386ON15049890.005
TPHA0C023908.386ON15049890.005
KLTH0E05852g4.16ON40949930.005
Kwal_55.206074.16ON23156910.005
SAKL0H13926g8.386ON15449890.005
TBLA0G006704.16ON22956910.005
NDAI0D049304.16ON22956910.005
KAFR0I014704.16ON22956910.005
Kwal_23.33118.386ON15049890.005
NCAS0C029408.386ON15249890.006
AGL128W8.386ON15249890.006
KLTH0C03410g1.480ON39146930.006
YLR167W (RPS31)8.386ON15249890.006
Suva_10.33singletonON25456910.006
NDAI0F003005.701ON18777900.006
NDAI0G022808.386ON15249880.006
KLLA0D18304g8.386ON15049880.007
KAFR0H020008.386ON15249880.007
SAKL0H25784g4.16ON30556910.007
CAGL0G08173g8.386ON15249880.007
SAKL0H24772g8.142ON41443920.008
Suva_10.304.16ON38156920.008
Skud_12.294.16ON38156910.008
YLL039C (UBI4)4.16ON38156910.008
ACL062C4.16ON38256910.008
KLLA0E00749g4.16ON38156910.008
NCAS0G041201.480ON39267910.008
TDEL0F051008.386ON15049870.008
KNAG0A027308.386ON15049870.008
Kpol_1070.64.16ON53356920.009
ZYRO0G07854g4.16ON46056910.009
NCAS0C058504.16ON38856910.009
Smik_12.184.16ON46056910.009
CAGL0D05082g4.16ON53356910.009
Kpol_1030.58.386ON15249870.010
Kpol_1024.168.386ON15249870.010
NDAI0B01850singletonON40344900.012
Suva_10.2668.386ON15249860.012
Skud_12.2348.386ON15249860.012
Smik_12.2298.386ON15249860.012
TBLA0H031808.386ON15249860.013
TBLA0D022108.142ON56338890.017
NCAS0B045908.142ON44742890.017
CAGL0L06028g8.142ON50538890.018
Kpol_370.61.480ON40454880.022
TPHA0O004401.480ON36954860.033
AGL185W8.311ON5049760.047
YGL181W (GTS1)8.142ON39638820.12
Smik_7.918.142ON39938810.14
TDEL0B046908.142ON44238810.17
Ecym_42448.311ON5034690.36
TBLA0B021601.480ON40467780.38
Suva_7.818.142ON40138770.45
ZYRO0D08140g6.343ON7358700.46
ZYRO0F05192g1.480ON38472760.69
TBLA0F041406.343ON7355680.82
TDEL0C025901.480ON36846731.4
Skud_7.908.142ON39638694.0
NCAS0C040908.142ON39647694.1
TPHA0H004008.142ON46638677.3
Kpol_541.508.142ON51138678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.448
         (364 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   629   0.0  
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   563   0.0  
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   549   0.0  
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   536   0.0  
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   426   e-148
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   420   e-146
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   415   e-144
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   405   e-140
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   404   e-140
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   404   e-140
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   392   e-135
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   391   e-135
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   389   e-134
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   385   e-132
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   381   e-131
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   376   e-129
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   363   e-124
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   352   e-120
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   348   e-118
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   347   e-117
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    65   3e-11
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    49   3e-07
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    49   4e-07
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    47   2e-06
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    46   3e-06
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    46   3e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    45   9e-06
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    45   9e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    44   2e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    44   2e-05
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    47   3e-05
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    42   8e-05
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    46   9e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    42   1e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    46   1e-04
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    42   1e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    42   2e-04
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    41   2e-04
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    45   2e-04
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    45   2e-04
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    45   2e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    45   2e-04
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    44   3e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    44   5e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    44   5e-04
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    40   0.001
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    40   0.001
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     40   0.001
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    40   0.001
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     40   0.001
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    40   0.001
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    40   0.001
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    40   0.001
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    40   0.001
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    40   0.001
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    40   0.001
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    40   0.001
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    40   0.001
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    40   0.001
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    40   0.001
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    40   0.001
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    40   0.001
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    40   0.001
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    40   0.001
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    42   0.001
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    40   0.001
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    40   0.001
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    40   0.001
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    40   0.001
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    40   0.001
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    40   0.001
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    40   0.001
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    42   0.002
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.002
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     40   0.002
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    40   0.003
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    40   0.003
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    40   0.003
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    40   0.003
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    40   0.003
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    39   0.003
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    39   0.005
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    39   0.005
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    39   0.005
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    39   0.005
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    40   0.005
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    40   0.005
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    39   0.005
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    40   0.005
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              40   0.005
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    40   0.005
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    39   0.005
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    39   0.006
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    39   0.006
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    40   0.006
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    39   0.006
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    40   0.006
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        39   0.006
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    39   0.006
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    39   0.007
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    39   0.007
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    40   0.007
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    39   0.007
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    40   0.008
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    40   0.008
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    40   0.008
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    40   0.008
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    40   0.008
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    40   0.008
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    40   0.008
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    38   0.008
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    38   0.008
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    40   0.009
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    40   0.009
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             40   0.009
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    40   0.009
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    40   0.009
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    38   0.010
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    38   0.010
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    39   0.012
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    38   0.012
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    38   0.012
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    38   0.012
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    38   0.013
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.017
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.017
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.018
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    39   0.022
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    38   0.033
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    34   0.047
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.12 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.14 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.17 
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    31   0.36 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    35   0.38 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.45 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    32   0.46 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    34   0.69 
TBLA0F04140 Chr6 complement(1022911..1023132) [222 bp, 73 aa] {O...    31   0.82 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    33   1.4  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   4.0  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     31   4.1  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   7.3  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    30   8.1  

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/364 (86%), Positives = 315/364 (86%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKPD                      PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDAS 240
           NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDAS
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDAS 240

Query: 241 EEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNTAPTGMPAFDPALLASM 300
           EEGANTNAVP               PFASLLNPALNPFANAGNTAPTGMPAFDPALLASM
Sbjct: 241 EEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNTAPTGMPAFDPALLASM 300

Query: 301 FXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL 360
           F            EDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL
Sbjct: 301 FQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL 360

Query: 361 NGDV 364
           NGDV
Sbjct: 361 NGDV 364

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/372 (78%), Positives = 300/372 (80%), Gaps = 8/372 (2%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MSLNIHIKSGQDKWEV+VAPE TV QFKEAISKAN +PVANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKP                       PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADN----SAASAFPAPG 236
           NPQLQAMGPQARQMLQSPMFRQMLTNP+M+RQSMQFARMMDPNA       AASAFPAPG
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPAPG 240

Query: 237 GDASEEGANTNAVPXXXXX----XXXXXXXXXXPFASLLNPALNPFANAGNTAPTGMPAF 292
           GDA EE ANTN                      PFASLLNPALNPFA+AGN   TGMPAF
Sbjct: 241 GDAPEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFASAGNATGTGMPAF 300

Query: 293 DPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 352
           DPALLASMF            ED+RPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 301 DPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360

Query: 353 QGALDSLLNGDV 364
           QGALDSLLNGDV
Sbjct: 361 QGALDSLLNGDV 372

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/382 (77%), Positives = 301/382 (78%), Gaps = 27/382 (7%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MSLNIHIKSGQDKWEV VAPE TVLQFKEAI+KAN IPVANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           HIQDGHSVHLVKSQPKP                       PNMSSGQSAGFNPLADLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPN----ADNSAASAFPAPG 236
           NPQLQAMGPQARQMLQSPMFRQMLTNP+M+RQSMQFARMMDPN    +   AASAFPAPG
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPAPG 240

Query: 237 GDASEE--------------GANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAG 282
           GDA EE               A TNA                 PFASLLNPALNPFANAG
Sbjct: 241 GDAPEEGSNTNTTSSSNTGNNAGTNA------GTNAGANTAANPFASLLNPALNPFANAG 294

Query: 283 NTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNV 342
           N A TGMPAFDPALLASMF            ED+RPPEERYEHQLRQLNDMGFFDFDRNV
Sbjct: 295 NAASTGMPAFDPALLASMF---QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNV 351

Query: 343 AALRRSGGSVQGALDSLLNGDV 364
           AALRRSGGSVQGALDSLLNGDV
Sbjct: 352 AALRRSGGSVQGALDSLLNGDV 373

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/370 (77%), Positives = 300/370 (81%), Gaps = 10/370 (2%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MSLN+++KSGQDKWEV+VAPE TVLQFKEAIS+AN IPVANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXX-XXXXXXPNMSSGQSAGFNPLADLTS 119
           HIQDGHSVHLVKSQP+P                        PNMSSGQSAGFNPLADLTS
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMM+NPIFQSQMNEMLSNPQMLDFMIQ
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDP----NADNSAASAFPAP 235
           SNPQLQAMGPQARQMLQSPMFRQMLTNP+M+RQSMQFARMMDP     +   AASAFPAP
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFPAP 240

Query: 236 GGDASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNT-APTGMPAFDP 294
           GGDA EE  +T+A P                 ASLLNPALNPFANAGN+ A TGMPAFDP
Sbjct: 241 GGDAPEETTDTDAAPSSNAGANAAANPF----ASLLNPALNPFANAGNSAAATGMPAFDP 296

Query: 295 ALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQG 354
           ALLASMF            ED+RPPEERYE QLRQLNDMGFFDFDRNVAALRRSGGSVQG
Sbjct: 297 ALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQG 356

Query: 355 ALDSLLNGDV 364
           ALDSLLNGDV
Sbjct: 357 ALDSLLNGDV 366

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 267/380 (70%), Gaps = 23/380 (6%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ IHIKSGQ+KW+V++ P  T+L  KE I+K + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
           +I+D H++H+VKS    +                       N++SGQ+ GFNPLADLT A
Sbjct: 61  NIKDDHAIHMVKS--GGNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGA 118

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG   N++ +QDE+LRMMENPIFQSQMNEMLSNP+MLDFMIQS
Sbjct: 119 RYAGYANLPSADMFGPDGGI--NNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQS 176

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMD-----PNADNSAASAFPAP 235
           NPQLQAMGPQARQMLQSP FRQMLTNP M+RQSMQFARMM+     P AD + ASAFPAP
Sbjct: 177 NPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPAP 236

Query: 236 GGDASEEGA----NTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFA-------NAGNT 284
           GGD +E       NT+                  PFA+L++PA NPFA       N    
Sbjct: 237 GGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMGNMNNQQGG 296

Query: 285 APTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAA 344
           A    PAFDP LLAS+             ED+RPPEERYE QLRQLNDMGFFDFDRNVAA
Sbjct: 297 AGVQQPAFDPTLLASLL---GGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAA 353

Query: 345 LRRSGGSVQGALDSLLNGDV 364
           LRRSGGSVQGALD+LLNGDV
Sbjct: 354 LRRSGGSVQGALDALLNGDV 373

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 222/377 (58%), Positives = 263/377 (69%), Gaps = 21/377 (5%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS++IH+KSGQ+ W+V++ P  T+LQ KE I+K + +P  NQRLI+SGKILKDDQTV+ Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            I DG S+H+VKS                           PNM++G++ GFNPL+DLTSA
Sbjct: 61  KILDGLSIHMVKS----GGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSA 116

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNPQMLDF+IQ+
Sbjct: 117 RYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQA 175

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM----DPNADNSA--ASAFPA 234
           NPQLQAMGPQARQ+LQ+PMFRQMLTNP+M+RQSMQ AR M    DPN +  A  +S FPA
Sbjct: 176 NPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPA 235

Query: 235 PGGD---ASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANA-GNTAPTGM- 289
           PGGD      E   +                   PFASL NPA+NPFA    NT   G  
Sbjct: 236 PGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMANTNAAGSG 295

Query: 290 --PAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 347
             PAFDP+  ASMF            ED+RPPEERYEHQLRQLNDMGFFDFDRNVAALRR
Sbjct: 296 NPPAFDPSFFASMF---QPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 352

Query: 348 SGGSVQGALDSLLNGDV 364
           SGG+V+ AL++LLNGDV
Sbjct: 353 SGGNVESALNALLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  415 bits (1067), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 260/383 (67%), Gaps = 23/383 (6%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ IHIKSGQ+KW+V      ++   KE ISK + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQ---PKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178

Query: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM----DPNADNSAASAFP 233
           IQSNPQLQAMGPQARQMLQSPMFRQML NP+M+RQSMQFARMM    DP A  +  SAFP
Sbjct: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238

Query: 234 APG-GDASEEGANTNAVPXXXXXXXXXXXXXXX-------PFASLLNPALNPF----ANA 281
           APG   AS    NTNA                        PF +L NPA NPF    +N 
Sbjct: 239 APGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSNT 298

Query: 282 GNTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRN 341
             + P   PAFDPALLASM             +D+RPPEERYE QLRQLNDMGFFDFDRN
Sbjct: 299 NGSQPQ-QPAFDPALLASML-GMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRN 356

Query: 342 VAALRRSGGSVQGALDSLLNGDV 364
           VAALRRSGGSVQGALD+LLNGDV
Sbjct: 357 VAALRRSGGSVQGALDALLNGDV 379

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  405 bits (1041), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 257/386 (66%), Gaps = 27/386 (6%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           M + IHIKSGQ+KWEV V    TVLQ KE I+K + IPV NQRLIYSGKILKDDQ ++ Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXP---NMSSGQSAGFNPLADL 117
            IQD HS+HLVKS                           P   N+++GQS GFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNAD---NSAASAFP 233
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNPEM+RQSMQ A MM  N     N+AAS+FP
Sbjct: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFP 238

Query: 234 APGGDASEEGANTNA-VPXXXXXXXXXXXXXXXPFASLLNPALNPF-------------- 278
           APG   +   A TN                   PFASL NPA+NPF              
Sbjct: 239 APGETDTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAAAAAGA 298

Query: 279 ANAGNTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDF 338
              G    TG PAFDP+L ASMF            +D+RPPEERYE QLRQLNDMGFFDF
Sbjct: 299 GATGAAGATGTPAFDPSLFASMF---QPPQQQQQEQDNRPPEERYESQLRQLNDMGFFDF 355

Query: 339 DRNVAALRRSGGSVQGALDSLLNGDV 364
           DRNVAALRRSGGSVQGALD+LL+ DV
Sbjct: 356 DRNVAALRRSGGSVQGALDALLSNDV 381

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  404 bits (1039), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 256/373 (68%), Gaps = 13/373 (3%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ + +K GQ KWEV+V PE TV +FK+ I+K + IP ANQRLIYSGKILKDDQ V+SY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXX--XXXXXPNMSSGQSAGFNPLADLT 118
            IQDGH++HLVKS                              N++SGQ+ GFNPL+DLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 SARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMI 178
           SARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM+DFMI
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 179 QSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASA-FPAPGG 237
           QSNPQLQAMGPQARQ+LQSP FRQMLTNP+M+RQSMQF+ MM+P+  N AA+A FPAPG 
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGD 238

Query: 238 DASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNP----FANAGNTAPTGM--PA 291
             +E  +                     PFA++ NP  NP    F N G  A        
Sbjct: 239 STTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAADNQQNQP 298

Query: 292 FDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS 351
           FDP++LAS+             +D+RPPEERYE QLRQLNDMGFFDF++NVAALRRSGGS
Sbjct: 299 FDPSMLASLL--GGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGS 356

Query: 352 VQGALDSLLNGDV 364
           VQGALDSLLNGDV
Sbjct: 357 VQGALDSLLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  404 bits (1037), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 224/372 (60%), Positives = 256/372 (68%), Gaps = 15/372 (4%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ +HIKSGQ+KW+V++ P  TV++ KEAISK + IP ANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQ-PKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTS 119
            I D H+VHLV+S  PKP                        N+SSGQ+ GFNPLADLT 
Sbjct: 61  KIADDHAVHLVRSGGPKP-AASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTG 119

Query: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177

Query: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGG-- 237
            NPQLQAMGP+AR++LQS  FRQM+TNP+M+RQSMQFARM        A  AFPAPG   
Sbjct: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAFPAPGTAT 237

Query: 238 -DASEEG--ANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNTAPTG-MPAFD 293
             AS EG  A T A P               PFASL N   NPFA   +  P G  P FD
Sbjct: 238 QTASTEGGPAGTTASP-STTGNGSANSEAANPFASLFNGQANPFA---SMFPNGRAPQFD 293

Query: 294 PALLASMFXXXXXX-XXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 352
           P+LL+S               +D+RPPEERYE QLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 294 PSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSV 353

Query: 353 QGALDSLLNGDV 364
           QGALD+LLNGDV
Sbjct: 354 QGALDALLNGDV 365

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  392 bits (1006), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/382 (57%), Positives = 252/382 (65%), Gaps = 34/382 (8%)

Query: 2   SLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61
           ++ + IKSGQ+KWEV V PE TV  FKE ISK + IP ++QRLIYSGKILKDDQT+  Y+
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXP--------------NMSSGQ 107
           +QDGHSVHLVKS   P                       P              N+S+GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 SAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEM 167
           S GFNPLADLTSARYAG+ ++PSADMFGPDGGA N    NQ++LL M++NPIFQSQMNEM
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMP--NQEDLLNMLDNPIFQSQMNEM 180

Query: 168 LSNPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDP-NADN 226
           LSNPQM+DFMIQSNPQLQAMGPQARQM QSP FRQMLTNP+M+RQSMQFARMM+P   +N
Sbjct: 181 LSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEN 240

Query: 227 SAASAFPAPGGDASE----EGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAG 282
            AA+AFPAPG + +E     GAN +                  PFA+            G
Sbjct: 241 DAANAFPAPGNENTEGESAAGAN-DGGNPAAAATNAGAPPAGNPFAA---------LLGG 290

Query: 283 NTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNV 342
                     DP LLASM             +D+RPPEERYE QLRQLN+MGFFDFDRNV
Sbjct: 291 GGPLQQPGGLDPQLLASML---GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNV 347

Query: 343 AALRRSGGSVQGALDSLLNGDV 364
           AALRRSGGSVQGALDSLLNGDV
Sbjct: 348 AALRRSGGSVQGALDSLLNGDV 369

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  391 bits (1004), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 218/383 (56%), Positives = 256/383 (66%), Gaps = 25/383 (6%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+++ IKSGQ+KW+VAV P  T+L+FKE ISKA+ IP  NQRLIYSGKILKD +TV+SY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  HIQDGHSVHLVKS---QPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADL 117
            IQDGHS+HLVKS                               N++SGQ+ GFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           TSARYAGY L MPSADMFGPDGG  N    NQD++L M+ENP+FQSQMNEMLSNPQM+++
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMP--NQDDMLSMLENPVFQSQMNEMLSNPQMVEY 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAA-----SA 231
           MI SNPQLQA+GPQAR+M QSP FRQMLTNP+M+RQSM+ ARMM              S+
Sbjct: 179 MINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSS 238

Query: 232 FPAPGGDASEEG-ANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNTAPTG-- 288
           FPAPG  ++E   A  NA                 PFA+L NP +NPFA  GN A  G  
Sbjct: 239 FPAPGETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLGNPAAAGST 298

Query: 289 -------MPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRN 341
                   P F+P++LASM             ED+RPPE RYE QLRQLNDMGFF+FDRN
Sbjct: 299 GAPGTPQYPGFNPSMLASML----QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRN 354

Query: 342 VAALRRSGGSVQGALDSLLNGDV 364
           +AALRRSGGSVQGALD+LLN DV
Sbjct: 355 IAALRRSGGSVQGALDALLNNDV 377

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 262/386 (67%), Gaps = 29/386 (7%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ +H+KSGQ KW+V+V  + TV QFK AI++ + I   NQRLIYSGKILKDDQT++SY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXX----XXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLAD 116
            I DGH+VHLVKS  K                             ++SSGQ+ GFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176
           LTSARYAGYLN+PSAD FGPDGG  +  + N D++LRM+ENP+ QSQMNEMLSNPQM+DF
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTS--APNSDDMLRMLENPVMQSQMNEMLSNPQMIDF 178

Query: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAAS--AFPA 234
           +IQ +PQLQ+MGPQARQMLQSP FRQM+TNPEM+RQSMQF+ ++    D SAA   AFPA
Sbjct: 179 LIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPA 238

Query: 235 PG---GDASEEGANTNAVPXXXXXXXXXXXXXXXPFASLL----------NPALNPFAN- 280
           PG    DAS + A+TN                  PFASLL          +   NPF + 
Sbjct: 239 PGTADSDASAQPASTNT----STADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSM 294

Query: 281 AGNTAP--TGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDF 338
            G  AP   G+PAFDPA+L+++             +D+RPPEERYE QLRQLNDMGFF+F
Sbjct: 295 LGQQAPGAGGLPAFDPAMLSALL-GGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEF 353

Query: 339 DRNVAALRRSGGSVQGALDSLLNGDV 364
           DRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 354 DRNVAALRRSGGSVQGALDALLNGDV 379

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/407 (53%), Positives = 259/407 (63%), Gaps = 49/407 (12%)

Query: 2   SLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61
           +++IHIKSGQ+ W+V++    ++   K+ I+K + IP  NQRLIYSGKILKDDQ VD Y+
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           IQDGHSVHLV+S  K                         N+S+GQ+ GFNPLADLTSAR
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPS----NISAGQTGGFNPLADLTSAR 118

Query: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM--------DPNADNSAASAF 232
           NPQLQAMGPQARQM QSPMFRQMLTNP+M+RQSMQ A MM          NA ++AAS+F
Sbjct: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSF 237

Query: 233 PAPGGD---------------ASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLNP---- 273
           PAPGGD                + +  +T                   PFASL NP    
Sbjct: 238 PAPGGDDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPFASLFNPTANN 297

Query: 274 -----ALNPFA----NAG------NTAPTG-MPAFDPALLASMFXXXXXXXXXXXXEDSR 317
                A NPF     NAG      N   TG +P FDP++ AS+F            +D+R
Sbjct: 298 DSTGLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQDTR 357

Query: 318 PPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364
           PPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 243/372 (65%), Gaps = 14/372 (3%)

Query: 3   LNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHI 62
           +++H+KSGQ+ W V +    T+  FKE IS  + +P  NQRLIYSGKILKD +TV+SY I
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSARY 122
           QDGHSVH+VKS                            N+S+GQ+ GFNPLADLT ARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNP 182
           AG  N+PSADMFGPDGG  +++  N + +L+M+ENPIFQSQMNEMLSNPQM+DF+IQ NP
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 183 QLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDASEE 242
           QLQA+GP+AR MLQSP FRQM+T+P+M+RQSMQ A  M  + D  AASAFPAPG  +   
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPD-GAASAFPAPGSASGAG 242

Query: 243 GAN---TNAVPXXXXXXXXXXXXXXXPFASLLN------PALNPFANAGNTAPTG-MPAF 292
           GAN   TN                  PFA L         A NPFA      P G  P F
Sbjct: 243 GANETSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPFA---GLFPGGQQPQF 299

Query: 293 DPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 352
           +  LLASMF             D+RPPEERYE QLRQLNDMGFFDFDRNVAALRR+GGSV
Sbjct: 300 NQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSV 359

Query: 353 QGALDSLLNGDV 364
           QGALD+LLNGDV
Sbjct: 360 QGALDALLNGDV 371

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/385 (54%), Positives = 252/385 (65%), Gaps = 30/385 (7%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+ +HIKSGQ+KW+VA+ P  T+ QFK AI+  + I   NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXP----------NMSSGQSAG 110
            I D HSVHLVKS                           P          N+S+GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSN 170
           FNPL+DLTSARYAG+LN+PSAD FGPDGG     + N D++LRM+ENP+ QSQMNEMLSN
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGM--TSAPNSDDVLRMLENPVMQSQMNEMLSN 178

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAAS 230
           PQM+DF+IQ +PQLQ+MGPQAR +LQSP FRQM+TNP+M+RQSMQF+ M+  ++     S
Sbjct: 179 PQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDSAAGGGS 238

Query: 231 AFPAPGGDASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLN---------PALNPFAN- 280
           +FPAPG  A  +  +  A                 PFASLL          PA NPF + 
Sbjct: 239 SFPAPGTPAEADAPSQPAA----NPSAAPSAGTANPFASLLGGQAGASGASPAANPFLSM 294

Query: 281 -AGNTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFD 339
             G +A T  PA DP +L+S+             +D+RPPEERYEHQLRQLNDMGFF+FD
Sbjct: 295 LGGGSAGT-PPALDPMVLSSIL--GGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFD 351

Query: 340 RNVAALRRSGGSVQGALDSLLNGDV 364
           RNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 352 RNVAALRRSGGSVQGALDALLNGDV 376

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  363 bits (932), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/376 (50%), Positives = 244/376 (64%), Gaps = 20/376 (5%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           M++++HIKSGQ+ W+V +    T+  FK+ I+  + IP  NQRLIYSGKILKDDQT++SY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            IQDGHS+H+VKS                             MS+G+ +GFNPL+DLTSA
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDAS 240
           NPQLQ++GPQAR M QSPMFRQMLTNP+M+RQSM+ A+MM+     ++AS+FPAPG   +
Sbjct: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDSTT 238

Query: 241 EEGANTNAVPXXXXX----------------XXXXXXXXXXPFASLLNPALNPFANAGNT 284
                +  +                                PFA+L +P++NP+A  G  
Sbjct: 239 TTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNPYAALGGG 298

Query: 285 APTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAA 344
                  F+PA  A               ED+RPPEERYEHQLRQLNDMGFFDFD+NVAA
Sbjct: 299 NGNANNMFNPAAFAQA--LQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAA 356

Query: 345 LRRSGGSVQGALDSLL 360
           LRRSGGSVQGA+++LL
Sbjct: 357 LRRSGGSVQGAVNALL 372

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  352 bits (903), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 192/364 (52%), Positives = 233/364 (64%), Gaps = 19/364 (5%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           M++ I +KSGQ++WEV+V    +V + K+ I+K + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSA 120
            I DGH++HLVKS                            ++S+GQS GFNPLADLT A
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178

Query: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGGDAS 240
           +P LQAMGP AR+MLQSP FRQMLTNP+++RQ M   +M    A     + FPAPG  A+
Sbjct: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ-MSRLQMGMGGAGAEQGTDFPAPGSAAT 237

Query: 241 EEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFANAGNTAPTGMPAFDPALLASM 300
            + A                         L   A NP   A       MP  DPA+L+S+
Sbjct: 238 PDAAAPAPN-------------PLAAILGLQPGAANPLGAAPADRGLAMPPLDPAMLSSL 284

Query: 301 FXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL 360
           F             D+RPPEERYE QLRQLNDMGFFDFDRNVAALRR+GGSVQGALD+LL
Sbjct: 285 F---GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALL 341

Query: 361 NGDV 364
           NGDV
Sbjct: 342 NGDV 345

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 208/388 (53%), Positives = 239/388 (61%), Gaps = 45/388 (11%)

Query: 1   MSLNIHIKSGQDKWEVAVAPE---CTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTV 57
           M + + +K GQ++W+VAVA E    TV QFKE ++    +PV NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  DSYHIQDGHSVHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSS--GQSAGFNPLA 115
           + Y I DGH+VHLVKS                              S   GQ  GFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDSNNQ----DELLRMMENPIFQSQMNEMLSN 170
           DLTSARYAGY L MPSADMFGPDGG  +          +E+L M+ENPIFQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM---------- 220
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNP+M+RQSMQF++MM          
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 221 DPNADNSAASAFPAPGGDASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLN----PALN 276
           DPN       AFPAPGGD  + GA TN                  PF+SL      PA  
Sbjct: 241 DPN-------AFPAPGGD--DTGAPTNT----STNASAAGPAGANPFSSLFGGAPAPAAQ 287

Query: 277 PFANAGNTAPTGMPAFDPALLASMFXXXXXXXXXXXXEDSRPPEERYEHQLRQLNDMGFF 336
           PF +A        P FD A                  +D+RPPEERYE QLRQLNDMGF 
Sbjct: 288 PFQSA--------PGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFS 339

Query: 337 DFDRNVAALRRSGGSVQGALDSLLNGDV 364
           DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 340 DFDRNVAALRRAGGSLQGALDALLNGDV 367

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  347 bits (889), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 193/410 (47%), Positives = 243/410 (59%), Gaps = 50/410 (12%)

Query: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
           MS+++H+KSGQ+KW+V+  P  ++   K+ I++ + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  HIQDGHSVHLVK-----------SQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSA 109
            I DGHS+HLV+           +                            N+++GQ  
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178

Query: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAA 229
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNP+++RQ  +F   MD  A N  +
Sbjct: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQS 236

Query: 230 SA-FPAPG-GDASEEGANTNAVPXXXXXXXXXXXXXXXPFASLLNPALNPFA-------- 279
           +  FPAPG  + S   +  NA                 P  SL N   NPFA        
Sbjct: 237 TNDFPAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAMFAPPAN 296

Query: 280 -------NAGNTAPTGMPA------------------FDPALLASMFXXXXXXXXXXXXE 314
                  NAG T  T  PA                   DPA+L+++             E
Sbjct: 297 SGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTE 356

Query: 315 DSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364
           D+RPPEERY+ QL QLN+MGF DFDRNVAALRRSGGSVQGAL++LLNGDV
Sbjct: 357 DNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 105/227 (46%), Gaps = 14/227 (6%)

Query: 3   LNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHI 62
           ++++IK  ++K+ +    +  +      I     IP  NQRLIYSG+IL  ++T+  Y+ 
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHS-VHLVKSQPKPDXXXXXXXXXXXXXXXXXXXXXXPNMSSGQSAGFNPLADLTSAR 121
           +DGH  + ++  + K +                        ++S    G   +  +T+  
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT- 120

Query: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQ-MLDFMIQS 180
                   S D +G     + +D   + ELL+++++P    Q NEML N Q +L F+IQ+
Sbjct: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQT 170

Query: 181 NPQLQAMGPQ-ARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADN 226
           NP L+ M    ARQ+L+ P  ++   +   + Q +   R    +A+N
Sbjct: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANN 217

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 24 VLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V   KE + +   IP + QRLI+ GK + D+QTVDS  + DG  +HLV
Sbjct: 23 VYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 1  MSLNIHIKSGQDKWEVAVAPEC--TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVD 58
          M L +   +G+   E+ ++ E    V + KE + +   IP + QRLI+ GK ++DDQTVD
Sbjct: 1  MELKVKTLTGK---EIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVD 57

Query: 59 SYHIQDGHSVHLV 71
          S ++  G  +HLV
Sbjct: 58 SANLSSGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
          M L +   +G++   V V P+  V + KE + +   IP   QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGKE-IPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 HIQDGHSVHLV 71
          ++  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
          M L +   +G++   V V    TV   KE + +   IP + Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGKE-ISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 HIQDGHSVHLV 71
           +QDG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V V+ E  V   KE + +   IP + QRLI+ GK + +D T+ +  + DG  +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 3  LNIHIKSGQDKWEVAVAPECT--VLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60
          + I +K+   K E+A+  + +  V   K+ + +   IP + QRLI+ GK + D+QTV+S 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 HIQDGHSVHLV 71
          ++ DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 24 VLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V + KE + +   IP + QRLI+ GK + D+QTV S ++ DG  +HLV
Sbjct: 23 VYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V +  E  + + KE + +   IP + QRLI+ GK + D QTV S  + DG  +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 31/48 (64%)

Query: 24 VLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V + KE + +   IP + QRLI+ GK + D+Q+V S ++ DG  +HLV
Sbjct: 23 VYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 3  LNIHIKS-GQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61
          +NI  K   ++K  V +    T+L  K  ++   S  +   +LI+SGK+LKDDQTV S  
Sbjct: 1  MNIIFKDFKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCG 60

Query: 62 IQDGHSVHLVKSQPK 76
          ++D   V ++ S+ K
Sbjct: 61 LKDNDQVIMMISKKK 75

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  T+L+ K  ++++ S   +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1  MSLNIHIKS-GQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDS 59
          M++ IH K   +++  + ++P  T+ + K+ +++A     +  ++I+SGK+L+D  T++ 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YHIQDGHSVHLVKSQPKPD 78
            ++DG  V  + S+ K +
Sbjct: 61 CKLKDGDQVIFMISKKKAE 79

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 33/56 (58%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V +  +  + + K+ + +   IP + QRLI+ GK + D QT+++  + DG  +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 24 VLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          V   KE + +   IP + QRLI+ GK + D  TV   H+ +G  +HLV
Sbjct: 23 VYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 8  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 40/66 (60%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  T+L  K  +++A +   +  ++IYSGK+L+D QTV+   +++G  +  
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 71 VKSQPK 76
          + S+ K
Sbjct: 71 MISKKK 76

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  T+ + K  ++++ S   +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 40/66 (60%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  T+ + K  +++++S   +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MISQKK 76

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MSLNIHIKS-GQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDS 59
          M + I+ K   ++K  + ++P  T+ + K+ ++K      +  ++I+SGK+L+D  T+D+
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YHIQDGHSVHLVKSQPK 76
            ++DG  V  + S+ K
Sbjct: 61 CKLKDGDQVIFMISKKK 77

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  T+ + K  ++++ S   +  +LIYSGK+L+D +TV    ++DG  V  
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSQPK 76
          + SQ K
Sbjct: 71 MVSQKK 76

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 41/66 (62%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K+ + +    +++  KEA+S+  S   +  +LI+SGK+LKD  +V+S + +DG+ V  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSQPK 76
          + S  K
Sbjct: 71 MVSAKK 76

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + + P  TVLQ K+ ++   S      +LI+SGK+L+D +T++   ++DG  V  
Sbjct: 11 KEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQVIF 70

Query: 71 VKSQPK 76
          + S+ +
Sbjct: 71 MISKKR 76

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 19 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 19 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 18 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          ++K  + +A + T+   KE I++      +  +LIY+GKIL+D +TV   ++++G  V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VKSQPK 76
          + S+ K
Sbjct: 70 MISKTK 75

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSV 68
          TV + K+ +++      +  +LIYSGKIL+DD+T+  Y ++DG  V
Sbjct: 23 TVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 320 EERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           E  Y  Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 38 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 23 TVLQFKEAISKANSIPVANQR--LIYSGKILKDDQTVDSYHIQD-GHSVHLVKSQPKP 77
          TV   K  I K++ +        LIYSGK+L+DD T++S H++D    V L++ +P P
Sbjct: 23 TVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDNAQIVMLIRRRPSP 80

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 126 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 202 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 278 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 354 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSV 68
          T+ + K+ +++      +  +LIYSGKIL+DD+T+  Y + DG  V
Sbjct: 23 TISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1   MSLNIHIKSGQDK------WEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDD 54
           + L+IHIK    K        + V    T+   K  I     IP   QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTVDSYHIQDGHSVHLV 71
           +T+  Y+IQ   ++HLV
Sbjct: 113 RTLSDYNIQKESTLHLV 129

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364
           R+ HQLR L ++G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++ K L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 3  LNIHIKS-GQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61
          +NI  K   ++K  +A+    TVL  K  +++  S   +  +LIYSGK+L+D +T++   
Sbjct: 2  INITFKDFKKEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCG 61

Query: 62 IQDGHSV 68
          ++DG  V
Sbjct: 62 LKDGDQV 68

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 169 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 245 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 323 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 399 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16  VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
           + V    T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL--NGD 363
           +Y  +LR+L +MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           +Y  QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGD 363
           +Y  QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           +Y  +LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLVKSQPK 76
          TVL  K+ I+       +  +LIYSGK+L++D T+    ++DG  V  + S+ K
Sbjct: 23 TVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIFMISKKK 76

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLVKSQPK 76
          TVL  K+ +++      +  +LIYSGK+L+D  +++   ++DG  V  + S+ K
Sbjct: 23 TVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIFMISKKK 76

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 33.9 bits (76), Expect = 0.047,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1  MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGK 49
          M L +   +G++  ++ VAPE  V + KE + +   IP + QRLI+ GK
Sbjct: 1  MLLKVKTLTGKE-IQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  +LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 31.2 bits (69), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGK 49
          + V PE  V   KE + +   IP A QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 11 QDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDG-HSVH 69
          ++K  + +  + T+   K  I+   +  +   +LIYSGKILK+D T+ +  ++D  H + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LVKSQPK 76
          ++  + K
Sbjct: 71 MISKKKK 77

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 31.6 bits (70), Expect = 0.46,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 27/58 (46%)

Query: 13 KWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          K  V    E  V  FK+ +S     P +  +L+  G ILKD  ++D Y I D   + L
Sbjct: 13 KIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 3  LNIHIKS-GQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61
          +NI  K   ++K  + + P  +V   K  ++   S   +  +LIYSGK+L+D + +    
Sbjct: 2  INIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESG 61

Query: 62 IQDGHSVHLVKS 73
          ++DG  V  + S
Sbjct: 62 LKDGDQVIFMIS 73

>TBLA0F04140 Chr6 complement(1022911..1023132) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.8 bits (68), Expect = 0.82,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%)

Query: 16 VAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHL 70
          V   PE TV  FK+ ++    + V+   +     +L+D  T+D Y I +G ++ L
Sbjct: 16 VKCLPEDTVHDFKQVLAAQLKMDVSKISVSRGKNVLRDHITLDDYEIHNGTNLEL 70

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSV 68
          +VL  K  +++         +LIYSGK+L+D +++    ++DG  V
Sbjct: 23 SVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 314 EDSRPPEERYEHQLRQLNDMGF-FDFDRNVAALRRSGGSVQGALDSL 359
            DSR    +Y  QL +L DMG+  D  R   AL R+ G +  +LD +
Sbjct: 190 HDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           +Y   ++ L  MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 322 RYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL 359
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,808,455
Number of extensions: 1274266
Number of successful extensions: 4009
Number of sequences better than 10.0: 183
Number of HSP's gapped: 4025
Number of HSP's successfully gapped: 256
Length of query: 364
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 253
Effective length of database: 40,753,473
Effective search space: 10310628669
Effective search space used: 10310628669
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)