Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4448.829ON38438417970.0
YMR272C (SCS7)8.829ON38438417520.0
Smik_13.4858.829ON38438417430.0
Suva_13.4608.829ON38438417020.0
TDEL0B006808.829ON38338514090.0
SAKL0D01760g8.829ON38138113230.0
KLLA0D01639g8.829ON38138113150.0
NCAS0C004708.829ON42638413180.0
ZYRO0G13948g8.829ON38438513130.0
KLTH0C04114g8.829ON37837912771e-176
Kwal_27.103328.829ON37837912671e-174
AAL183W8.829ON37738012351e-169
NDAI0K004708.829ON38638712321e-169
CAGL0F03399g8.829ON38038412011e-164
TBLA0D031808.829ON40038511801e-161
Kpol_541.98.829ON37438411681e-159
Ecym_27128.829ON38138211471e-156
KNAG0J003208.829ON37338411231e-153
KAFR0B038508.829ON37738311201e-152
TPHA0C047108.829ON37738210201e-137
Kpol_1069.48.829ON2772607101e-91
Kpol_505.142.166ON123761863e-16
TDEL0F012102.166ON126701784e-15
Skud_14.2212.166ON1201051774e-15
Kwal_26.84612.166ON123851713e-14
ZYRO0B09812g2.166ON1831101736e-14
NCAS0G025702.166ON121711642e-13
SAKL0E10626g2.166ON123881634e-13
KNAG0I020402.166ON119761634e-13
TBLA0B013102.166ON123781626e-13
CAGL0L03828g2.166ON1211051616e-13
Suva_14.2282.166ON120761616e-13
AFL223W2.166ON165851648e-13
KLTH0D09284g2.166ON123901618e-13
NDAI0F027302.166ON121761601e-12
TPHA0F017902.166ON182761622e-12
Smik_14.2162.166ON120941563e-12
KLLA0F23672g2.166ON123761554e-12
YNL111C (CYB5)2.166ON1201051545e-12
KAFR0B045502.166ON126971512e-11
Ecym_54202.166ON145741382e-09
KLLA0B14795gna 1ON556501419e-09
Kwal_47.18167na 2ON227601351e-08
TDEL0D00190singletonON552911382e-08
TDEL0H02180na 2ON203451322e-08
ZYRO0C18524gsingletonON554471338e-08
Kpol_1014.54.304ON596591338e-08
KLTH0A04026gna 2ON2331191299e-08
KLLA0F27577gna 2ON172691251e-07
Ecym_4346na 2ON209501262e-07
SAKL0F08316gna 2ON178541214e-07
NDAI0D04700na 3ON625451275e-07
KLTH0C11858gsingletonON555741267e-07
Kwal_23.2823na 1ON560431258e-07
KAFR0I005204.304ON586611241e-06
NDAI0D047104.304ON616611241e-06
Suva_13.1054.304ON591521241e-06
NCAS0A02770na 3ON609581232e-06
Skud_13.924.304ON591521222e-06
YML054C (CYB2)4.304ON591521222e-06
Smik_13.924.304ON591521222e-06
ADL085Cna 2ON2731251192e-06
NCAS0A027804.304ON602471213e-06
KNAG0E038604.304ON604541213e-06
KLTH0D06930g2.536ON204771145e-06
CAGL0K10736g4.304ON593521195e-06
SAKL0G16852g4.304ON580611185e-06
TPHA0B018204.304ON576571177e-06
SAKL0F16610gsingletonON564501178e-06
KLLA0D02640g4.304ON589471179e-06
TDEL0D011404.304ON584491161e-05
KLTH0C11770gsingletonON618521133e-05
TPHA0G035502.536ON218521059e-05
ZYRO0B02090g2.536ON194811059e-05
ZYRO0D16654gna 2ON190531049e-05
ZYRO0B13728g4.304ON598521081e-04
KAFR0A047406.106ON483461071e-04
CAGL0K03069g2.536ON194441022e-04
Kwal_14.807singletonON578541043e-04
NDAI0I016206.106ON441751025e-04
NDAI0H013702.536ON22456970.001
AAR153C6.106ON47873980.001
TBLA0I015302.536ON22153950.002
Skud_7.2266.106ON50974970.002
YGL055W (OLE1)6.106ON51074960.002
Smik_7.2256.106ON51074960.003
Ecym_30806.106ON47969940.004
CAGL0I00418g6.106ON49073940.005
ZYRO0C05016g6.106ON48369930.006
KNAG0F032506.106ON48948930.006
Kpol_348.122.536ON21753900.007
SAKL0A07326g6.106ON48046920.008
Kwal_26.80462.536ON19853890.010
NCAS0F008702.536ON18977890.010
TBLA0C06220singletonON49446910.011
TPHA0B027006.106ON48869890.018
KLLA0E18459g2.536ON14881850.019
NCAS0D032506.106ON49748880.024
KLLA0C05566g6.106ON47746870.035
KLTH0H06798g6.106ON48846870.037
KAFR0A018902.536ON16150830.038
Ecym_2214na 4ON53155860.043
TDEL0A031102.536ON20053840.044
TDEL0G036506.106ON48346860.048
KNAG0C057802.536ON18078820.059
Kpol_478.176.106ON48468840.070
SAKL0G10274gna 5ON52271840.077
KLTH0G06358gna 5ON51371830.097
KLLA0C10692gna 5ON52066830.10
AAL078Wna 5ON59276830.11
YMR073C (IRC21)2.536ON20148800.13
SAKL0A04774gna 4ON56884820.15
TDEL0E03250na 5ON53690820.15
ZYRO0G16742gna 5ON54390810.17
SAKL0A09570g2.536ON21144790.19
AFL079Wna 4ON53870800.21
Suva_13.2502.536ON20148780.22
Kwal_23.5693na 5ON51346800.22
Kwal_14.18456.106ON28846790.25
Smik_13.2522.536ON20148750.52
Ecym_3180na 5ON62146770.64
KLLA0E19471gna 4ON57355760.67
Skud_13.2292.536ON20148740.69
KLTH0H04488gna 4ON57455741.1
Suva_7.2166.106ON47040741.4
KNAG0C043807.427ON25487684.4
KLTH0B03014g5.219ON85762695.3
TPHA0O012601.357ON69290695.4
TPHA0E015405.465ON21688676.7
TBLA0D045807.182ON39587677.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.444
         (384 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   696   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   679   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   676   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   660   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   547   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   514   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   511   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      512   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   510   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   496   e-176
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   492   e-174
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   480   e-169
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   479   e-169
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   467   e-164
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   459   e-161
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   454   e-159
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   446   e-156
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   437   e-153
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   436   e-152
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   397   e-137
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   278   1e-91
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    76   3e-16
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    73   4e-15
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    73   4e-15
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    70   3e-14
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    71   6e-14
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    68   2e-13
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    67   4e-13
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    67   4e-13
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    67   6e-13
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    67   6e-13
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    67   6e-13
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    68   8e-13
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    67   8e-13
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      66   1e-12
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    67   2e-12
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    65   3e-12
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    64   4e-12
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    64   5e-12
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    63   2e-11
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    58   2e-09
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    59   9e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    57   1e-08
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 58   2e-08
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                55   2e-08
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    56   8e-08
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    56   8e-08
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    54   9e-08
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    53   1e-07
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    53   2e-07
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    51   4e-07
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             54   5e-07
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    53   7e-07
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    53   8e-07
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    52   1e-06
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    52   1e-06
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    52   1e-06
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               52   2e-06
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    52   2e-06
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    52   2e-06
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    52   2e-06
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    50   2e-06
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     51   3e-06
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    51   3e-06
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    49   5e-06
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    50   5e-06
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    50   5e-06
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    50   7e-06
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    50   8e-06
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    50   9e-06
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    49   1e-05
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    48   3e-05
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    45   9e-05
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    45   9e-05
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    45   9e-05
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    46   1e-04
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    46   1e-04
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    44   2e-04
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    45   3e-04
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    44   5e-04
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      42   0.001
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    42   0.001
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    41   0.002
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    42   0.002
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    42   0.002
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    42   0.003
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    41   0.004
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    41   0.005
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    40   0.006
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    40   0.006
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    39   0.007
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    40   0.008
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    39   0.010
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    39   0.010
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             40   0.011
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    39   0.018
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    37   0.019
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     39   0.024
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    38   0.035
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    38   0.037
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    37   0.038
Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar t...    38   0.043
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    37   0.044
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    38   0.048
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    36   0.059
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    37   0.070
SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {...    37   0.077
KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {...    37   0.097
KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {...    37   0.10 
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    37   0.11 
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    35   0.13 
SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON} unipro...    36   0.15 
TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {O...    36   0.15 
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    36   0.17 
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    35   0.19 
AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; N...    35   0.21 
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    35   0.22 
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    35   0.22 
Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W ...    35   0.25 
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    33   0.52 
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    34   0.64 
KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]...    34   0.67 
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    33   0.69 
KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON} conser...    33   1.1  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    33   1.4  
KNAG0C04380 Chr3 (862078..862842) [765 bp, 254 aa] {ON} Anc_7.42...    31   4.4  
KLTH0B03014g Chr2 (235495..238068) [2574 bp, 857 aa] {ON} weakly...    31   5.3  
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    31   5.4  
TPHA0E01540 Chr5 (313509..314159) [651 bp, 216 aa] {ON} Anc_5.46...    30   6.7  
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    30   7.7  

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/384 (89%), Positives = 344/384 (89%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK
Sbjct: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEPLTKTA             YHMGVALKNMNQLFACFLFCVGVFVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               VCYDECHFFLHHSKLPPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SWFWDEVFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/384 (86%), Positives = 337/384 (87%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MSTNTSKTLELFS+KTV+EHNTA DCWVTYQNRKIYDVT+FL EHPGGDESILDYAGKD+
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEA RLLTNK+HKVEVQLSADG EFDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK LP EEKLSIATDY NDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEPLTKTA             YHMGVALKNMNQLFACFLFCVGVFVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           YGLHRFLFHFDDWLPESN+AFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               VCYDECHFFLHHSKLPPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SWFWDEVFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/384 (85%), Positives = 338/384 (88%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MS NTSKTLELFS+KTVE+HNTAKDCWVTYQNRKIYDVTKFL EHPGGDESILDYAGKD+
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           TE+MKD+DVHEHSDSAYEILEDEYLIGYLATDEEA RLLTNK+HKVEVQLS+DG EFDST
Sbjct: 61  TEVMKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDST 120

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LP EEKLSIATDYGNDYKKHKFLDLNRPLLMQIL SDFKKDFYVDQIHRPRHYGK
Sbjct: 121 TFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGK 180

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEPLTKTA             YHMGVALKNMNQLFACFLFCVGVFVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           YGLHRFLFHFDDWLPESN+AFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               VCYDECHFFLHHSKLPPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SWFWDEVFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/384 (83%), Positives = 337/384 (87%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MSTNTSKTLELFS+KTVEEHNTAKDCWVTYQNRKIYDVTKFL EHPGG+ESILDYAGKD+
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           TE+MKDSDVHEHS+SAYEILEDEYL+GYLATDEEATRLLTNK+HKVEVQLSADG EFDST
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDST 120

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LPTEEKLSIATDYG+DYKKHKFLDLN+PLLMQILRSDF +DFYVDQIHRPRHYGK
Sbjct: 121 TFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGK 180

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEPLTKTA             YHMGVALKNMN LFACFLF VG+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIE 240

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y LHRFLFHFDDWLPESN+AFATHFLLHGCHHYLPMD YRLVMPP+LFVILCAPFYKLVF
Sbjct: 241 YSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVF 300

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               VCYDECH+F+HHSKLPPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SWFWD+VFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDDVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/385 (69%), Positives = 296/385 (76%), Gaps = 3/385 (0%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MS + SKTLELFSRK V EHN A DCWVT  NRKIYDVTKFL EHPGG + ILDYAGKD+
Sbjct: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDE-YLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDS 119
           TE++KDS +HEHS+SAYEILED  YL+GY+AT+ E   LLTN SHKVEV+L+    +FDS
Sbjct: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLAT--LDFDS 118

Query: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179
           TTFVK+LPTEEKLSIATDY  DYK+H FLDL +PLL Q++   F KDFYVDQIHRPRHYG
Sbjct: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178

Query: 180 KGSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLI 239
           KGSAPLFGNFLEPL+KT+             YH+GVA KNMN +F  F FC+G FVWTLI
Sbjct: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238

Query: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299
           EYGLHRFLFHFDDWLPESNV F  HFLLHG HHYLPMDKYRLVMPPTLFVILC PFYKLV
Sbjct: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298

Query: 300 FALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP               VCYD  H+FLHHSKLP FMR            NYQLGFGV
Sbjct: 299 FGLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGV 358

Query: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384
           TSWFWD+VFGTYL P +P+S+MKY+
Sbjct: 359 TSWFWDKVFGTYLSPTSPISQMKYD 383

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/381 (65%), Positives = 293/381 (76%), Gaps = 1/381 (0%)

Query: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           + SKTL L S+  + +HNT +DCWV+  NRK+Y+VT FL EHPGGD+ ILD+AG+D+TEI
Sbjct: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61

Query: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFV 123
           MKD  VHEHS+SAYEI+ D YL+GYLA +EE  +LLTN+ H VEV+L+ +  +FDSTTFV
Sbjct: 62  MKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLN-ESTQFDSTTFV 120

Query: 124 KNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183
           K LPTE+KLSIATDY +DYKKHKFLDL++PLL Q++  +F KDFY+DQ+HRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180

Query: 184 PLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243
           PLFGNFLEPL+KT              YH+ VAL NMN+ FA FLF +GVFVWTLIEY L
Sbjct: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240

Query: 244 HRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303
           HRFLFH D +LPE  +AFA HFLLHG HHYLPMD+YRLVMPPTLFV+LC PFYKLVF+LL
Sbjct: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300

Query: 304 PXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWF 363
           P                CYD  H+FLHH+KLPP+MR            NY+LGFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 364 WDEVFGTYLGPDAPLSKMKYE 384
           WD+VFGTYLG DAPLSKMKYE
Sbjct: 361 WDKVFGTYLGSDAPLSKMKYE 381

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/381 (65%), Positives = 286/381 (75%), Gaps = 1/381 (0%)

Query: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           ++S+ L L+S+  +E+HN   DCWV+   RKIY+VT+FL EHPGG E ILDYAG D+T++
Sbjct: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61

Query: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFV 123
           MKD   HEHS+SAYEI+++ YL+GYLAT+EE  +LLTNK H VEV L  +  EFDST FV
Sbjct: 62  MKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNN-EFDSTVFV 120

Query: 124 KNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183
           K LPTE+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 184 PLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 181 PLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240

Query: 244 HRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300

Query: 304 PXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWF 363
           P               VCYD  H+FLHHS+LPP+MR            NY+LGFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 364 WDEVFGTYLGPDAPLSKMKYE 384
           WD+VFGTYLG +APLS MKY+
Sbjct: 361 WDKVFGTYLGENAPLSNMKYD 381

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  512 bits (1318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/384 (63%), Positives = 290/384 (75%), Gaps = 4/384 (1%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MS+N SKTLELFS+  V +HNT +DCWVT  +RKIYDV+KFL +HP GD+SIL +AGKD+
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           TE++KD  + + +D    +L+D+YLIGY+ATD E  +LLTNK HKVEV+L+     FDST
Sbjct: 107 TELLKDEKIDQQTD----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LPTE+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
            SAPLFGNFLEP TKTA             YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               +CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVT 402

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SW+WD+ FGTYL PD+PLSKMKY+
Sbjct: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/385 (63%), Positives = 289/385 (75%), Gaps = 2/385 (0%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MST  S TL+LFS++ + +HN  KDCWV+   RKIY+VT+FL EHPGG E IL YAG+D+
Sbjct: 1   MSTK-SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDI 59

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLS-ADGKEFDS 119
           TE++KD DVHEHS+SAYEIL+D YL+GYLAT EEAT+LLTNK H+VEV L+  +  +FDS
Sbjct: 60  TEVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDS 119

Query: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179
           TTFV  LP EEKL+IATDYG DYKKHKFLDLNR LL Q++  +F KDFY+DQ+HRPRHYG
Sbjct: 120 TTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYG 179

Query: 180 KGSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLI 239
           KGSAPLFGNFLEP++KT              +H  V   NMN+LF+ FLFC+G+FVWTLI
Sbjct: 180 KGSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLI 239

Query: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299
           EY LHRFLFH D+WLP++N A   HFLLHG HHYLPMD+YRLVMPPTL ++L AP YK V
Sbjct: 240 EYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTV 299

Query: 300 FALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGV 359
           F LLP               VCYD  H+FLHH+KLP +MR            NYQLGFGV
Sbjct: 300 FGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGV 359

Query: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384
           TSWFWD VFGTYLGPDAPL+ MKY+
Sbjct: 360 TSWFWDNVFGTYLGPDAPLAHMKYD 384

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 282/379 (74%), Gaps = 3/379 (0%)

Query: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
           +KTL L+S+  +E+HNT  DCWV+  +RKIY+VT FL EHPGG E I +YAGKDVTEIMK
Sbjct: 3   TKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIMK 62

Query: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKN 125
           D   HEHS  AYE+L++EY +GYLAT EE  +LL N  H VEV+L  D   +DST FV  
Sbjct: 63  DGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEED---YDSTVFVPE 119

Query: 126 LPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185
           +P EEKLSI TDY  DY +HKFLDLNRPLLMQ+L SDF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 186 FGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245
           FGNFLEPL+KTA             YHM  AL+NMN + A FLFC+GVFVWTLIEYGLHR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 246 FLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPX 305
           FLFH D +LP + VA+  HFLLHG HHYLPMD+YRLVMPPTLFV+LC PFYKLVFALLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 306 XXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 365
                         +CYD  H+FLHH+KLP +MR            NY+LGFGVTSWFWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 366 EVFGTYLGPDAPLSKMKYE 384
           +VFGTYLG +APLS+MK++
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  492 bits (1267), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 234/379 (61%), Positives = 284/379 (74%), Gaps = 3/379 (0%)

Query: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
           +KTL L+S   V+EHN+A DCWVT QNRKIYDVTKFL +HPGG + I++YAGKD+TE+MK
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62

Query: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKN 125
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV  
Sbjct: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119

Query: 126 LPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185
           +P EEKLSI TDY  DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 186 FGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245
           FGNFLEPL+KT+             YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 246 FLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPX 305
           FLFH D +LP + VA+  HFLLHG HHYLPMD+YRLVMPPTLF++LC PFYKLVFALLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 306 XXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 365
                         VCYD  H+FLHH+KLP  ++            NY+LGFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 366 EVFGTYLGPDAPLSKMKYE 384
           +VFGTYL  +APLS+MK++
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  480 bits (1235), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 278/380 (73%), Gaps = 4/380 (1%)

Query: 5   TSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIM 64
            SKTL L+S+ T+++H     CWV+  NRKIYDV++FL EHPGGD+ ILDYAGKD+T ++
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61

Query: 65  KDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVK 124
           KD  +HEH+++AYEIL++ YL+GYLAT+EE  +LLTN+ H +EV      +  D+TTFVK
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT----PENLDTTTFVK 117

Query: 125 NLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAP 184
            LP EE LS+ATD+G DY KH FLDLN+PLLMQ+LR +F +DFY+DQIHRPRHYGKGSAP
Sbjct: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177

Query: 185 LFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLH 244
           LFGNFLEPL+KT              Y++  AL+NM    A   F  GVFVWTLIEY LH
Sbjct: 178 LFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237

Query: 245 RFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLP 304
           RFLFHFDD +PESN+AF  HFLLHG HHYLPMDKYRLVMPP LFV+LCAPFY+LVF++ P
Sbjct: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297

Query: 305 XXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWFW 364
                          VCYD  H+FLHH KLPPFMR            NY+LGFGVTSW+W
Sbjct: 298 EYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 357

Query: 365 DEVFGTYLGPDAPLSKMKYE 384
           D+VFGTYL  ++P+S+ K E
Sbjct: 358 DKVFGTYLASNSPVSRPKCE 377

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  479 bits (1232), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/387 (60%), Positives = 285/387 (73%), Gaps = 4/387 (1%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHP--GGDESILDYAGK 58
           MS NTSKTLELFS+  V  HNT+ DCW+T+Q+RKIYDVTKFL ++P     + +L++AGK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 59  DVTEIMKDSDVHEHSDSAYEILE-DEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEF 117
           D+T+ +KD  +    + ++ IL+ D+YLIGYLATD E   LLTNK HKVEVQL+     F
Sbjct: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119

Query: 118 DSTTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRH 177
           DSTTFVK+LPTE+KLSIATD   D +KHKFLDL++PLL QIL  +F KDFY+DQIHRPRH
Sbjct: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179

Query: 178 YGKGSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWT 237
           YG  SAPLFGN LEPLTKT+             YH+ VAL NMN +FA  LF +G++VWT
Sbjct: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239

Query: 238 LIEYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYK 297
           LIEY +HRFLFHFD+ LPE N+ +  HFLLHGCHHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299

Query: 298 LVFALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGF 357
           +VF LLP               VCYD CH+FLHHSK+PP +R            NYQLG+
Sbjct: 300 VVFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGY 359

Query: 358 GVTSWFWDEVFGTYLGPDAPLSKMKYE 384
           GVTSW+WD++FGTYL PD+P+SKMKYE
Sbjct: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  467 bits (1201), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 230/384 (59%), Positives = 275/384 (71%), Gaps = 6/384 (1%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           ++ ++SKTLELF +  + +HN+  DCWV+   RKIYDV+K+L +HP   +++        
Sbjct: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
            +    +D+ +   +  + + D+YL+GYLAT +E  +LLTNKSHKVEV+L+AD   FDST
Sbjct: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADN-TFDST 116

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LPTE+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLE  TKTA             Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 177 GSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           A LP               +CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVT 356

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           SWFWD+VFGTYLGPDAPLSKMKYE
Sbjct: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/385 (55%), Positives = 276/385 (71%), Gaps = 2/385 (0%)

Query: 2   STNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
           ++++  T ELFS ++V++HNT KDCWV YQNRKIYDV+++L ++P G+  I+D+AGKD+T
Sbjct: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75

Query: 62  EIMKDSDVHEHSDSAYEILE--DEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDS 119
              K+ + + H    Y+ +   D+YL+GYLA +EEA +LL+N SHKVEV+L+     +DS
Sbjct: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135

Query: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179
           TTFVK LP+E+   IATDY  D+ +H FLDL +PL+ Q+ R+ F + FY+DQIHRPRH+G
Sbjct: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195

Query: 180 KGSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLI 239
             SAPLFGNFLEPLTKTA             YH+ VA  NMN +FA FLFCVGVFVWTLI
Sbjct: 196 NKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255

Query: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299
           EY LHRFLFH D+ +P+  + +  HF +HGCHHYLPMD YRLVMPPTLF+ILC PFYKLV
Sbjct: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315

Query: 300 FALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGV 359
           F++LP               VCYDE H++LHHS++P FMR            NYQL FGV
Sbjct: 316 FSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGV 375

Query: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384
           +++FWD+VFGTYL PD+PLS MKYE
Sbjct: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 271/384 (70%), Gaps = 10/384 (2%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MS   SKTLELF++   EEHNT  DCWV+ + R IYDV+ +L ++   D SIL++AGKD+
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           T++ K  +        ++ + DEYL+GYLAT+EE  RLLTNK HKVEV L  DG  +DST
Sbjct: 61  TKLTKTRE--------FKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQ-DGT-YDST 110

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
            FVK LP EEK ++ATD G D++ H FLDLN+P+L Q+L  +F +DFY+DQ+HRPRHYGK
Sbjct: 111 VFVKELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGK 170

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEP++ T              YH+ VAL NMN +FA FLFC+G+FVWTLIE
Sbjct: 171 GSAPLFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIE 230

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y LHRFLFH DDW+P+ N+ +  HFLLHG HHYLPMD+YRLV+PP LF++LC P YKLVF
Sbjct: 231 YCLHRFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVF 290

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP               +CYD  H+F+HH KLP FMR            NYQLGFGV+
Sbjct: 291 GLLPLYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVS 350

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           ++FWD+VFGTYLGPD+P S M+Y+
Sbjct: 351 NYFWDKVFGTYLGPDSPASIMRYK 374

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/382 (57%), Positives = 272/382 (71%), Gaps = 2/382 (0%)

Query: 3   TNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           +++ KTL L+S+   E+H     CWV+   RKIY+V+KFL E+P G + +LD+AG+DVT+
Sbjct: 2   SSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQ 61

Query: 63  IMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTF 122
           ++KD    E +D A+++L D YLIGYLAT EE  +LLTN +H VEV+  A+G   DS  F
Sbjct: 62  LLKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVK-PANGNRVDSG-F 119

Query: 123 VKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGS 182
           VK LPTEEKL+IATD+  DY+KH FLDL++PL MQ+L  +F K+FY+DQ+HRPRHYGK S
Sbjct: 120 VKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKES 179

Query: 183 APLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYG 242
           APLFGNFLEPL+KT+             Y++  AL N++   A FLF VGVFVWTLIEYG
Sbjct: 180 APLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYG 239

Query: 243 LHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFAL 302
           LHRFLFHFDD +PESN+ F  HFLLHG HHYLPMDKYRLVMPP LF+ LC PFYKLVF++
Sbjct: 240 LHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSI 299

Query: 303 LPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSW 362
           LP               V YD  H+FLHH KLPPFMR            NY+LGFGVTSW
Sbjct: 300 LPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSW 359

Query: 363 FWDEVFGTYLGPDAPLSKMKYE 384
           +WD+VF TYL P APLS+ KY+
Sbjct: 360 YWDKVFNTYLSPTAPLSRAKYD 381

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  437 bits (1123), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 265/384 (69%), Gaps = 11/384 (2%)

Query: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
           MS+N S+TLEL S+ TV  HN   D WV  Q RK+ D++ ++ E P  +E +L  AGKD+
Sbjct: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           T+          S     +  D++L+GYLATD E   LL+NK HKVEV+L   G+ FDS+
Sbjct: 60  TD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEG-GETFDSS 109

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LPTE+KLSIATD   DY+KH FLDL +PL+ Q+L   F KDFYVDQIHRPRHYGK
Sbjct: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEP++KTA             Y +G +LK ++ +FA  LF +G FVWTLIE
Sbjct: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y +HRFLFHFDDWLPE+NVAF  HFLLHG HHYLPMD YRLV+PP LFV+LC PFYKLVF
Sbjct: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
            LLP               +CYD  H+FLHHSK+P FMR            NYQLGFGV+
Sbjct: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349

Query: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384
           +WFWD+VF TYLG DAP+S MKY+
Sbjct: 350 NWFWDKVFDTYLGKDAPISPMKYD 373

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  436 bits (1120), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 266/383 (69%), Gaps = 9/383 (2%)

Query: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            T+KTLELFS+K V  H   +DCWVT  +RKIYDVTKFL E+   D  +LDYAG D+T  
Sbjct: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT-- 59

Query: 64  MKDSDVHEHSDSAYEILE-DEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTF 122
             D  V+   D  Y+ L+ D YL+GY+AT +E  +LLTNK HKVEV L  D   FD  T 
Sbjct: 60  --DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATL 114

Query: 123 VKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGS 182
           V  LP EEKL+IAT+Y  D+KKHKFLDLN+PLL QIL+  F ++FYVDQI+RPRHYG+ S
Sbjct: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174

Query: 183 APLFGN-FLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEY 241
           APLFGN FLEP +KTA             +   VALKNMN   A FLFCVGVFVWTL+EY
Sbjct: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234

Query: 242 GLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFA 301
            LHRFLFHFD++LPE+N+AFA HFLLHG HHYLPMD YRLV+PP LF+ILCAP YK VF 
Sbjct: 235 CLHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFL 294

Query: 302 LLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTS 361
           LLP               V YD CH+ LHHSKLPPFMR            NY+LG+G+TS
Sbjct: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354

Query: 362 WFWDEVFGTYLGPDAPLSKMKYE 384
           WFWD+VFGTYL  DAP S MK++
Sbjct: 355 WFWDKVFGTYLSKDAPASVMKFD 377

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 256/382 (67%), Gaps = 12/382 (3%)

Query: 3   TNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGG--DESILDYAGKDV 60
           +N SKTLELFS +  + HNT  DCWV+ ++R IYDV+KF+ E+     ++++L  AGKD+
Sbjct: 4   SNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDI 63

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120
           +++++          +++ ++D+YL+GYLA   E  RLLTNK HKVEV L  DG  +DST
Sbjct: 64  SDLLETK--------SFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLK-DGT-YDST 113

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
            FVK LP+EE  +I+TDY  D+  H FLDL +PLLMQ+L  +F ++FY+DQIHRPRHYGK
Sbjct: 114 VFVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGK 173

Query: 181 GSAPLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSA LFGN+LEP++ T              YH  V  ++M+ L A F + +G+FVWT IE
Sbjct: 174 GSAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIE 233

Query: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y LHRFLFH DDW+P+ N  +  HFLLHG HHYLPMD+YRLV+PP LFV+LC PFYK VF
Sbjct: 234 YCLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVF 293

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               + YD  H+F+HH KLP   R            NYQLGFGV+
Sbjct: 294 ALLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVS 353

Query: 361 SWFWDEVFGTYLGPDAPLSKMK 382
           ++FWD VFGTYLGPD+P S M+
Sbjct: 354 NYFWDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  278 bits (710), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 137/260 (52%), Positives = 167/260 (64%), Gaps = 1/260 (0%)

Query: 124 KNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183
           K   TEEKL + TDY  D+ ++ FL L+ PL  Q+L S+F +DFY+DQ+H+PRHYG  SA
Sbjct: 15  KTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESA 74

Query: 184 PLFGNFLEPLTKTAXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243
           P+FGNFLEP TKT              Y+  V+L+ ++ + A  LF +GVFVWTLIEY +
Sbjct: 75  PIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCM 134

Query: 244 HRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303
           HR+LFH DD +PE+ + F  HFLLHG HHYLPMDKYRLVMPP LF ILC PFY L FA+ 
Sbjct: 135 HRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIF 194

Query: 304 PXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWF 363
           P               VCYD  H+FLHH K+P FMR            N+QLGFGVTS F
Sbjct: 195 PRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSF 254

Query: 364 WDEVFGTYLGPDA-PLSKMK 382
           WD VFGTYL P   P ++ K
Sbjct: 255 WDRVFGTYLDPKTIPYARSK 274

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 76.3 bits (186), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          ++++ + + EHNT + CW+     K+YD TKFL EHPGGDE ILD AG+D TE  +D   
Sbjct: 3  KVYTYQEIAEHNTTESCWIVIDG-KVYDTTKFLDEHPGGDEIILDLAGQDATESFEDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A +IL+  Y+
Sbjct: 61 --HSDEALKILKKLYI 74

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 73.2 bits (178), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 11 LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVH 70
          ++S + + EHN+A+D W+     K+YDVTKF+ EHPGGDE ILD AG+D +E  +D    
Sbjct: 4  VYSYQQIAEHNSAEDIWIVVDG-KVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDIG-- 60

Query: 71 EHSDSAYEIL 80
           HS+ A +IL
Sbjct: 61 -HSEEALKIL 69

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 72.8 bits (177), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 7/105 (6%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           +++S + V EHN  ++CW+   + K+YDV++F  EHPGGDE I+D  G+D TE   D   
Sbjct: 3   KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADG 114
             HSD A  +L+D Y IG    D+ + R+   K+   E Q    G
Sbjct: 61  --HSDEALRLLKDLY-IG--DVDKTSQRVSLEKASSSENQSKGSG 100

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 5/85 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +L+S K + EHNT KD W+     K+YD TKF+ EHPGG+E ++D  G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 70 HEHSDSAYEILEDEYLIGYLATDEE 94
            HSD A ++L D Y +G +  D E
Sbjct: 61 --HSDDAVKMLADLY-VGDVDKDSE 82

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 7/110 (6%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           ++++ + V EHNT +D W+   + K+YDVTKF+ +HPGGDE ILD AG+D TE   D   
Sbjct: 59  KVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDIG- 116

Query: 70  HEHSDSAYEILEDEYLIGYL--ATDEEATRLLTNKSHKVEVQLSADGKEF 117
             HS+ A  +L+D +++G L  A+    +  + N +    V    +G  F
Sbjct: 117 --HSEDAVNMLKD-FIVGSLDPASRPAKSEKVANVAQTSGVTTGGEGNGF 163

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +++S + + EHN   D W+  +  K+YDV+KFL EHPGGDE I + AG+D TE   D   
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIG- 60

Query: 70 HEHSDSAYEIL 80
            HSD A +IL
Sbjct: 61 --HSDDALQIL 69

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 67.4 bits (163), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 5/88 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +LF+ + + EHNT  D W+     K+YD TKF+ EHPGG+E ++D  G+D T    D   
Sbjct: 3  KLFTYQEIAEHNTEGDLWMIIDG-KVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 70 HEHSDSAYEILEDEYLIGYLATDEEATR 97
            HSD A ++LE  Y IG L  D E  +
Sbjct: 61 --HSDDAIKLLEPLY-IGDLDKDSEPIK 85

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 67.4 bits (163), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          ++++ + V +H+T++D W+   NR +Y+VTKFL EHPGG+E +L+ AG D T    D   
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A +IL+  Y+
Sbjct: 61 --HSDDAMKILKTRYI 74

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +L+S + +  HNT +  W+  ++ K+YDVTKFL  HPGGDE IL+ AG+D T+  +D   
Sbjct: 3  KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDFEDIG- 60

Query: 70 HEHSDSAYEILEDEYLIG 87
            HS+ A E L D  L+G
Sbjct: 61 --HSNDALEFL-DALLLG 75

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
           to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 66.6 bits (161), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 7/105 (6%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           ++++ K V EHN   DCW+      +YDV+KFL EHPGGDE I ++ G D T    D   
Sbjct: 3   KVYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADG 114
             HSD A +IL+    IG    D  + R++ +      VQ S +G
Sbjct: 61  --HSDDALKILK-TLKIG--EVDPNSERVVIDNRESDMVQKSTEG 100

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 66.6 bits (161), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +++S + V EHN  ++CW+   + K+YDV++F  EHPGGDE I+D  G+D T+   D   
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A ++L+  Y+
Sbjct: 61 --HSDEALKLLKTLYI 74

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 52/85 (61%), Gaps = 5/85 (5%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           +L++ + + EHN+  D W+   N K+YD TKF  EHPGGDE ++D AG+D TE   D   
Sbjct: 42  KLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIG- 99

Query: 70  HEHSDSAYEILEDEYLIGYLATDEE 94
             HSD A ++LE  Y +G L  D E
Sbjct: 100 --HSDDAVKMLEGLY-VGDLDKDSE 121

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 66.6 bits (161), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 5/90 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +L+S K + EHNT  D W+   + K+YD TKF+ EHPGG+E +LD  G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTENDLWMII-DGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADIG- 60

Query: 70 HEHSDSAYEILEDEYLIGYLATDEEATRLL 99
            HSD A ++LED Y +G +  D E   ++
Sbjct: 61 --HSDDAVKMLEDLY-VGDVDKDSEPIAVV 87

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          ++++ + + +HN+  D W+  +  K+YDV+KFL EHPGG+E I + AG D TE  +D   
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATENFEDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A +IL+  Y+
Sbjct: 61 --HSDDALKILKKMYI 74

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           ++++ + + EHNT +  W+  +  K+Y+VTKFL EHPGGDE I D AG D TE  +D   
Sbjct: 61  KIYTYEEIAEHNTTESSWIVIEG-KVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDIG- 118

Query: 70  HEHSDSAYEILEDEYL 85
             HSD A ++L+  Y+
Sbjct: 119 --HSDQALKVLKTLYI 132

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           +++S + V EHN  ++ W+   + K+YDV+KF  EHPGGDE I+D  G+D TE   D   
Sbjct: 3   KVYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKS 103
             HSD A  +L+  Y+     T E  +   T+ S
Sbjct: 61  --HSDEALRLLKGLYIGDVDKTSERVSVETTSTS 92

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 64.3 bits (155), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
          +L + K V EH T  D W+     K+YD TKF+ EHPGGDE ++D  G+D T   +D   
Sbjct: 3  KLLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A ++LE  Y+
Sbjct: 61 --HSDDAIKLLEPMYV 74

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
           CYB5Cytochrome b5, involved in the sterol and lipid
           biosynthesis pathways; acts as an electron donor to
           support sterol C5-6 desaturation
          Length = 120

 Score = 63.9 bits (154), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 7/105 (6%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           +++S + V EHN  ++ W+   + K+YDV++F  EHPGGDE I+D  G+D TE   D   
Sbjct: 3   KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADG 114
             HSD A  +L+  Y IG    D+ + R+   K    E Q    G
Sbjct: 61  --HSDEALRLLKGLY-IG--DVDKTSERVSVEKVSTSENQSKGSG 100

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
           YNL111C
          Length = 126

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           ++++   V EH    DCW+     K+Y+V+KFL EHPGGDE I + AG D TE   D   
Sbjct: 3   QVYTYADVAEHVLPDDCWIAIDG-KVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKV 106
             HSD A +IL+    IG L  + E  +    K H+V
Sbjct: 61  --HSDDALKILK-TLCIGELDLNSEKVQ---PKKHQV 91

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 4/74 (5%)

Query: 12 FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHE 71
          F+ + + +HN+ +D W+   N K+YD +KF  EHPGGDE +LD  G+D T    D     
Sbjct: 5  FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDI---G 60

Query: 72 HSDSAYEILEDEYL 85
          H+D A ++L+  Y+
Sbjct: 61 HTDDAVKLLDHMYI 74

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 13  SRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           S K V+ HN   DCW+   N ++YD+TKFL +HPGG   ++++AG+D TE
Sbjct: 82  SVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATE 130

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 2  STNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
          ++ TS  L   S   V  H  A DCW++    K+YDV+ +L +HPGG + +L  AGKD T
Sbjct: 24 TSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (53%), Gaps = 13/91 (14%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHE 71
            S   + +HNT  DCW+   N ++YDVT FL  HPGG   +++ AG D TE         
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATEKF----YQI 129

Query: 72  HSDSAYEILEDEYL-IGYLA-------TDEE 94
           HSDS +E +++ ++ IG L        TDEE
Sbjct: 130 HSDSVFEKMKNNFIYIGKLKGSIDKTYTDEE 160

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 17 VEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
          V EHNTA DCW+    R +YDVT  L +HPGG + +L YAG D T
Sbjct: 30 VREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (65%), Gaps = 1/47 (2%)

Query: 15  KTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
           K V  HN   DCW+   N +IYDVT F+G+HPGG   +L+ AG+D T
Sbjct: 79  KEVMLHNNVNDCWIVL-NGEIYDVTSFIGKHPGGAARLLEVAGRDAT 124

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 5   TSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           + K+L++ + + V +HN+  DCWV   N  +YD+T F+ +HPGG + I+  AGKDV+ I
Sbjct: 84  SKKSLKIITPQEVIKHNSKDDCWVVI-NDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {ON}
           weakly similar to uniprot|P40312 Saccharomyces
           cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
           sterol and lipid biosynthesis pathways
          Length = 233

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

Query: 11  LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVH 70
           + SR+ +  H +A+DCW+      +YDV+++L +HPGG + +L  AGKD T   +  DV 
Sbjct: 33  VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDAT--AQFDDVG 89

Query: 71  EHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST--TFVKNLP 127
              +S    L     +G L      T L T +  +   + + +   +     T+VK++P
Sbjct: 90  HSMESLMFDLGSGACVGVLKARPVTTALSTPQKQQQASEFAPEHSSYWEQLWTWVKHVP 148

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 11 LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVH 70
          L +   V  H++  DCW T  + K+YD+T FL +HPGG + +L YAGKD T +  D   H
Sbjct: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIGH 62

Query: 71 EHSDSAYEI 79
               AY++
Sbjct: 63 SMESLAYDL 71

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 12 FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
           S   V  H +A DCW    N K+YD+T  L  HPGG +++L YAG+D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 9  LELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
          + + S   V +HN   DCW+     K+Y++T FL +HPGG   IL Y G+D T+
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATK 53

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 19  EHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           +HNT +DCWV   N+ +YD+T F+  HPGG   I   AGKDVT I
Sbjct: 112 KHNTPEDCWVVINNQ-VYDLTTFIQVHPGGPNIIRSNAGKDVTAI 155

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 17  VEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSA 76
           V +HN   DCW+   N ++YDVT FL  HPGG   I++ AG D T          HSDS 
Sbjct: 81  VMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAARIMEVAGNDATRKF----YSIHSDST 135

Query: 77  YEILEDEYL-IGYL 89
            E ++++ + IG L
Sbjct: 136 LEKMKEQLVYIGKL 149

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 20  HNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           HN   DCW+   N ++YDVT F+  HPGG + IL+ AG D TE
Sbjct: 89  HNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 3   TNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           +N + T  L   + V +H T  DCWV   N  +YD+T F+  HPGG + +   AGKDVT 
Sbjct: 74  SNEAITTRLILPEEVAKHKTPDDCWVVI-NGYVYDITSFIMSHPGGPDVLETNAGKDVTA 132

Query: 63  I 63
           I
Sbjct: 133 I 133

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 3   TNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
            N +    L S   V +H+T  DCWV   + K+YD+T F+  HPGG + I   AGKDVT 
Sbjct: 87  ANINDEKPLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTN 145

Query: 63  I 63
           I
Sbjct: 146 I 146

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HN+A DCWV   N  +YD+T+F+  HPGG + I   AG+DVT I
Sbjct: 91  ISPAEVAKHNSADDCWVVI-NGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAI 141

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           S T    S   V +HN+  DCW+   N ++YD+T F+  HPGG + I   AGKDV+ I
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HN A DCWV   N  +YD+T+F+  HPGG + I   AG+DVT I
Sbjct: 91  ISPAEVAKHNKADDCWVVI-NGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAI 141

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HN   DCWV   N  +YD+T+FL  HPGG + I   AGKDVT I
Sbjct: 91  ISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HN   DCWV   N  +YD+T+FL  HPGG + I   AGKDVT I
Sbjct: 91  ISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (44%), Gaps = 4/125 (3%)

Query: 9   LELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSD 68
           L   S + V +H +  DCW     R +YD+T  L  HPGG + +L YAG+D T    D  
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDVG 148

Query: 69  VHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKNLPT 128
            H      Y++    YL G +   E      +  S +    L + GK       V++L +
Sbjct: 149 -HSMESLIYDMAPGSYL-GEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGS 206

Query: 129 E-EKL 132
           + EKL
Sbjct: 207 QSEKL 211

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 17  VEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           V  HNT  DCW+   N  +YD+T F+  HPGG + I   AGKDVT I
Sbjct: 94  VARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
            S   V +HNT  DCWV  +   +Y++T+F+  HPGG   I   AGKDVT I K
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESIL-DYAGKDVTEIMKDSDVH 70
            ++  +++HNTA+DCW    N+++Y V+ +L  HPGG E +L   AGKD T +       
Sbjct: 129 VTKAQLQKHNTAEDCWCVL-NQRVYCVSSYLDFHPGGAEILLRTAAGKDATALFNKY--- 184

Query: 71  EHSDSAYEILEDEYLIG 87
            H    YE L +  L+G
Sbjct: 185 -HRWVNYERLLETCLVG 200

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HNT +DCWV      +YD+T F+  HPGG + I   AGKDVT I
Sbjct: 90  ISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 3   TNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           T T  + +    + V +HN  KDCWV      +YD+T+F+  HPGG   I + AGKDVT 
Sbjct: 72  TVTDSSKKPIDPQDVAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVTA 130

Query: 63  I 63
           I
Sbjct: 131 I 131

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 7   KTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           K  ++ + + V  HN   DCWV   N  +Y++T F+  HPGG   I+  +GKDVT++
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVI-NDSVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 16  TVEE---HNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTE 62
           TV+E   HN   DCW+   N  +YD+T+F+  HPGG   +++ AG+D TE
Sbjct: 89  TVDEVKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 17  VEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           V +H++ KDCWV  +   +Y++T F+  HPGG   I + AGKDVT+I
Sbjct: 95  VAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 15  KTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           K VE+HN   DCWV      +YD++ F+  HPGG   I   AGKDV+ I
Sbjct: 81  KEVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDVSAI 128

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V  HN   DCWV      +YDVT F+ +HPGG   I   AGKDV+ +
Sbjct: 119 VSATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVSAL 169

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDY-AGKDVTE 62
            S K V EHNT  DCW   +  K+Y +T +   HPGGD+ + ++ +G D TE
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDKILKNFCSGVDATE 193

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 39/81 (48%), Gaps = 17/81 (20%)

Query: 2   STNTSKTLELFSRKT---------------VEEHNTAKDCWVTYQNRKIYDVTKFLGEHP 46
           STN  +TL   SRK                +  HNT  DCW   Q  K+Y +T +   HP
Sbjct: 94  STNYPQTLVQISRKVPLYLIRPPLRVDKELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHP 152

Query: 47  GGDESILDY-AGKDVTEIMKD 66
           GG + +L Y AGKD T++  +
Sbjct: 153 GGVDILLRYCAGKDATKMFNE 173

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 9  LELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61
          L   S   + +H T  DCW+    R +Y+V   L  HPGG + +L Y G+D T
Sbjct: 27 LPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
            S   V +HN+  DCWV      +YD+T+F   HPGG   I   AGKDV+ I
Sbjct: 84  ISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVSAI 134

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DVT F+ EHPGG+  I +  GKD T +     V+ HS++AY IL
Sbjct: 407 VHDVTDFINEHPGGEPLIKEALGKDATRVF-SGGVYSHSNAAYNIL 451

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 2/44 (4%)

Query: 19  EHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILD-YAGKDVT 61
            HNTA+DCW T  N K+Y ++ +L  HPGG + ++D  +G+D T
Sbjct: 126 RHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           E    + V +H+   DCWV   N  +YD++ F+  HPGG   I   AGKDV+ I
Sbjct: 77  ESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           I+DVT +  EHPGG++ +    GKD T   +   V+ HS+SA+ +L D  +       + 
Sbjct: 365 IHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQ-GGVYRHSNSAHNVLADMRIAILKEKKDS 423

Query: 95  ATRLLTNKSHKVEVQ 109
           A   +  +  K + Q
Sbjct: 424 AINFVKRRGEKFDKQ 438

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESIL-DYAGKDVTEIMKD 66
           F+ K +++H +  DCW T  N K+Y +T +L  HPGG + +L + AGKD T +  +
Sbjct: 147 FNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLFNE 201

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ ++ EHPGG+  I    GKD T    +  V+ HS++A+ IL    +       + 
Sbjct: 403 VHDVSGYITEHPGGETLIQAALGKDATRAF-NGGVYMHSNAAHNILATMRVAVVKEGQDA 461

Query: 95  ATRLLTNKSHKVE 107
           ATR    +   +E
Sbjct: 462 ATRFAARRGEALE 474

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYA-GKDVTEI 63
            ++K + EH    DCW   + R +Y +++++  HPGG + +++   GKDV+ +
Sbjct: 144 INQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ ++ EHPGG+  I    GKD T+      V+ HS++A  +L D  +     +   
Sbjct: 433 VHDVSGYISEHPGGETLIKTALGKDATKAF-SGGVYRHSNAAQNVLADMRVAIIKESKNS 491

Query: 95  ATRLLTNKSHKVEV 108
           A R+ + +    E 
Sbjct: 492 AVRMASKRGEVYET 505

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ ++ EHPGG+  I    GKD T+      V+ HS++A  +L D  +     +   
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAF-SGGVYRHSNAAQNVLADMRVAVIKESKNS 492

Query: 95  ATRLLTNKSHKVEV 108
           A R+ + +    E 
Sbjct: 493 AIRMASKRGEIYET 506

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ ++ EHPGG+  I    GKD T+      V+ HS++A  +L D  +     +   
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAF-SGGVYRHSNAAQNVLADMRVAIIKESKNS 492

Query: 95  ATRLLTNKSHKVEV 108
           A R+ + +    E 
Sbjct: 493 AIRMASKRGEVYET 506

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DVT ++ EHPGG+  I    GKD T+   +  V+ HS++A+ IL    +       + 
Sbjct: 404 VHDVTGYITEHPGGETLIRASLGKDATKAF-NGGVYLHSNAAHNILATMRVAVVKDGQDA 462

Query: 95  ATRLLTNKS 103
           A+R +  + 
Sbjct: 463 ASRFVARRG 471

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ ++ EHPGG++ + +  GKD T+      V+ HS++A+  L    +       E 
Sbjct: 411 VHDVSGYITEHPGGEKLLKNALGKDATKAF-SGGVYRHSNAAHNTLATMRVAVMKDNKET 469

Query: 95  ATRLLTNKSHKVE 107
           A R    +  + E
Sbjct: 470 AMRFAQKRGERAE 482

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ +L EHPGG+  +    GKD T+   +  V+ HS++A+ +L    +      +++
Sbjct: 407 VHDVSGYLTEHPGGETLLKAALGKDATKAF-NGGVYRHSNAAHNVLATMRVAVVKEGEQQ 465

Query: 95  ATRLLTNKS 103
           A R    + 
Sbjct: 466 AIRFAARRG 474

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILED 82
           I+DVT F+ EHPGG   + D  GKD T       V+ HS++A+ +L +
Sbjct: 414 IHDVTGFVEEHPGGAPLLNDALGKDATTAFT-GGVYRHSNAAHNVLAN 460

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 11  LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDY-AGKDVTE 62
           + ++K V +H    DCW   +  K+Y ++ +   HPGGD+ +++  +G+D T+
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCTK 193

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DV+ ++ EHPGG+  I   AGKD T+   +  V+ HS++A+ +L
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESIL-DYAGKDVTEI 63
            ++  + +H   +DCW    N+K+Y ++ +L  HPGG + ++   AGKD T +
Sbjct: 123 INKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 17  VEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESIL-DYAGKDVTEIMKDSDVHEHSDS 75
           ++ H +  DCW  Y+  K+Y V+ +L  HPGG + I  + AGKD T +        HS  
Sbjct: 118 LQRHTSRTDCWTIYKG-KVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN----QYHSWV 172

Query: 76  AYEILEDEYLIGYLATD 92
             E L +  LIG    +
Sbjct: 173 NAEKLLETCLIGIFVNE 189

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++D+T ++  HPGG + I +  GKD T +  +  V+ HS++A  +L
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVF-NGGVYNHSNAANNVL 459

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV  ++ EHPGG   I    GKD T    +  V+ HS++A  +L +  +   + ++E 
Sbjct: 411 VHDVKGYITEHPGGQLLIKSALGKDATSAF-NGGVYRHSNAATNVLANLRVAVIVESEES 469

Query: 95  ATRLLTNKS 103
           A +    + 
Sbjct: 470 ALKFAARRG 478

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 14  RKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHS 73
           R   E     KD +    NRK+Y +  +L  HPGG+  +   AGKDVT +        H 
Sbjct: 71  RVNKEALKANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNKY----HR 126

Query: 74  DSAYEILEDEYLIG-YLATDE 93
              YE L +   IG Y+ + E
Sbjct: 127 WVNYERLLETCFIGMYVGSAE 147

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILED 82
           I+D++ ++ EHPGG+  I    GKD T   +   V+ HS +A  +L +
Sbjct: 421 IHDISNYIPEHPGGESLIKQALGKDATRAFQ-GGVYRHSTAAQNVLSE 467

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DV+ ++ EHPGG+  I    GKD T+   +  V+ HS++A+ IL
Sbjct: 404 VHDVSGYITEHPGGETLIQASLGKDATKAF-NGGVYLHSNAAHNIL 448

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DV+ ++ EHPGG+  I    GKD T+   +  V+ HS++A+ +L
Sbjct: 412 VHDVSNYITEHPGGETLIQAALGKDATKAF-NGGVYLHSNAAHNVL 456

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 12  FSRKTVEEHNTAK-DCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60
            ++K ++ H  +K D W  Y+  K+Y ++++L  HPGG E IL+   K+V
Sbjct: 84  INKKILQRHQISKEDFWGVYKG-KVYSLSRYLEYHPGGIEIILNNCKKNV 132

>Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar to
          Ashbya gossypii AFL079W
          Length = 531

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIM 64
           L SR  +EE        V Y+N  + +V K++  HPGGD++I    G+D T  M
Sbjct: 3  SLLSRSEIEELIAQGRSIVIYRNL-VLNVDKWIKYHPGGDKAIFHMIGRDATAEM 56

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDY-AGKDVTEI 63
             R+ +++H T  DCW   + R +Y +T +   HPGG + +    AGKD TE+
Sbjct: 125 IDRELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEM 176

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DV+ ++ EHPGG+  +    GKD T+   +  V+ HS++A+ +L
Sbjct: 407 VHDVSGYITEHPGGETLLQAALGKDATKAF-NGGVYRHSNAAHNVL 451

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 7   KTLELFSRKTVEEHN---TAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63
           + L   + K ++ H    +  D W  Y+  K+Y ++ +L  HPGG E I+D+A +D  +I
Sbjct: 94  RPLMAINSKILKNHQDYLSKHDFWAVYKG-KVYCLSYYLDFHPGGIEIIIDHATRDPPDI 152

Query: 64  MKDSDVHEHSDSAYEILE 81
               D +    SA ++LE
Sbjct: 153 RGAFDRYHRWVSAEKLLE 170

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           +++V  ++ +HPGG   I    GKD T    +  V+ HS++A  +L D + +  L   +E
Sbjct: 407 VHNVKNYINDHPGGKTLIKSALGKDATSAF-NGGVYRHSNAAQNVLAD-FRVALLDDGKE 464

Query: 95  ATRLLTNK 102
           +   L  K
Sbjct: 465 SALKLAAK 472

>SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 522

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           E F++    E+ T K   V  +   ++DVT F+ +HPGG   +    GKD T    +  V
Sbjct: 395 ENFAKLAQSEYRTNKRALVAIEG-IVHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAV 452

Query: 70  HEHSDSAYEIL 80
           + HS +A  +L
Sbjct: 453 YSHSRAARNLL 463

>KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 513

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 10  ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDV 69
           E+F R   +E    +   V  +   ++DVT F+ +HPGG   +    GKD T+    + V
Sbjct: 386 EVFVRMAKQEFQEHRRALVAIEG-VVHDVTPFIHDHPGGVALVETSIGKDATQAFNGA-V 443

Query: 70  HEHSDSAYEIL 80
           + HS +A  +L
Sbjct: 444 YLHSQAARNLL 454

>KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 520

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 11/66 (16%)

Query: 23  AKDCWVTYQNRKIY--------DVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSD 74
           AKD ++  +NRK Y        DVT F+ +HPGG   +    GKD T+    + V+ HS+
Sbjct: 399 AKDEYI--KNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFNGA-VYRHSN 455

Query: 75  SAYEIL 80
           +A  +L
Sbjct: 456 AARNLL 461

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 5   TSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIM 64
           T +     +RK  EE   A    +      I+DVT F+ +HPGG   ++   GKD T   
Sbjct: 470 TPEQFATVARKDYEEKEKA----LVAIEGIIHDVTPFMHDHPGGMALVVASVGKDATPAF 525

Query: 65  KDSDVHEHSDSAYEIL 80
             + V+ HS +A  +L
Sbjct: 526 NGA-VYAHSTAARNLL 540

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKD 59
            +RK V++H   +D      N K+YD++ +L  HPGG + ++ +   D
Sbjct: 125 INRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON}
          uniprot|Q8NKG9 Saccharomyces kluyveri Putative delta 8-
          sphingolipid desaturase
          Length = 568

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 11 LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVH 70
          + SR  +E+        V Y+   + ++ K++  HPGGD++I    G+D T+ MK     
Sbjct: 4  IISRGEIEDRIARGQAIVIYEGL-VLNLEKWIKFHPGGDKAIHHMIGRDATDEMKAY--- 59

Query: 71 EHSDSAYEILEDEYLIGYLATDEE 94
           H D   EI   ++ IG +  + E
Sbjct: 60 -HCDETVEIFR-KWRIGRIDQEWE 81

>TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
           S T + F+    +++   K   V  +   ++DVT F+  HPGG   +    GKD T+   
Sbjct: 413 SMTPQQFTELAKQQYANNKRALVVIEG-IVHDVTPFIHSHPGGTALVKISIGKDATQAFN 471

Query: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEA 95
            + V+ HS +A  +L     I  L++ E+ 
Sbjct: 472 GA-VYLHSQAARNLLA-TMRIAMLSSSEQV 499

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 6   SKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
           S T   F +  +E+    K   V  +   ++DVT F+ +HPGG   +    GKD T    
Sbjct: 420 SMTSNQFVKLAIEQFAENKRALVVIEG-IVHDVTPFIHDHPGGTALVQLSVGKDATHAF- 477

Query: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEA 95
           +  V+ HS +A  +L     I  L++ E  
Sbjct: 478 NGAVYFHSKAARNLLA-TMRIAKLSSSERV 506

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 19  EHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILD-YAGKDVT 61
           +H T  DCW   +  K+Y ++ +   HPGG E +L+  AG+D T
Sbjct: 143 KHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; No
          homolog in Saccharomyces cerevisiae
          Length = 538

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 9  LELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSD 68
          + + S+  VEE     +  V Y++  +  + K++  HPGGD++I    G+D T+ M    
Sbjct: 1  MAVLSKSEVEERIANGEVIVIYKS-AVLKLDKWIKYHPGGDKAIYHMVGRDATDEMNAY- 58

Query: 69 VHEHSDSAYE 78
             HSD + +
Sbjct: 59 ---HSDESVQ 65

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKD 59
            +R+ V++H   +D +    N K+YD++ +L  HPGG + +L +   D
Sbjct: 125 INREIVKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DVT F+ +HPGG   +    GKD T+    + V+ HS +A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAFNGA-VYSHSQAARNLL 454

>Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W
           (OLE1) - 1:1 [contig 236] PARTIAL
          Length = 288

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DV+ ++ EHPGG+  I     KD T+   +  V+ HS++A+ +L
Sbjct: 212 VHDVSNYITEHPGGETLIKAALNKDATKAF-NGGVYLHSNAAHNVL 256

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKD 59
            +R  V++H   +D      N K+YD++ +L  HPGG + +L +   D
Sbjct: 125 INRAIVKKHCKDEDELWCVINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEIL 80
           ++DVT F+ +HPGG   ++   GKD T     + V+ HS +A  +L
Sbjct: 524 VHDVTPFIHDHPGGVALVVCAIGKDATPAFNGA-VYAHSTAARNLL 568

>KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]
          {ON} conserved hypothetical protein
          Length = 573

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 10 ELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIM 64
           + SR+ + +        V Y++  + ++ K++  HPGGD+SI    G+D T+ M
Sbjct: 3  RVLSRRDIADRIAKGQTIVIYED-SVLNLDKWIKFHPGGDKSIYHMIGRDATDEM 56

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 12  FSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKD 59
            +++ V+ H   +D      N K+YD++ +L  HPGG + +L   G +
Sbjct: 125 INKEIVKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSE 172

>KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON}
          conserved hypothetical protein
          Length = 574

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 11 LFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEIMK 65
          +  R  +EE        V Y    +  + K++  HPGGD++I    G+D T+ MK
Sbjct: 4  ILERSEIEERICRGQAIVIYDG-NVLRLDKWIKYHPGGDKAIHHMIGRDATDEMK 57

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 35  IYDVTKFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSD 74
           ++DV+ ++ EHPGG+  I    GKD T+      V+ HS+
Sbjct: 430 VHDVSGYISEHPGGETLIKTALGKDATKAF-SGGVYRHSN 468

>KNAG0C04380 Chr3 (862078..862842) [765 bp, 254 aa] {ON} Anc_7.427
           YBL095W
          Length = 254

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 22/87 (25%)

Query: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQ---ILRSDFKKDFYVDQI----- 172
           TF+K  P E       D  N     K L   +PL++Q   +L    K   Y + I     
Sbjct: 24  TFIKAWPDESSTISLKDPSNSPSVDKLLHRKQPLVLQRSDVLNKIAKSTLYQELISNPSV 83

Query: 173 ------------HRPRHYGKGSAPLFG 187
                       HRP H G+G  PLFG
Sbjct: 84  EHLAQSEKIPSGHRPYHVGQG--PLFG 108

>KLTH0B03014g Chr2 (235495..238068) [2574 bp, 857 aa] {ON} weakly
           similar to uniprot|Q07895 Saccharomyces cerevisiae
           YLR001C Hypothetical ORF
          Length = 857

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 68  DVHEHSDSAYEILEDEYLI-GYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKNL 126
           D  EH+ +A  ++   Y++ G + TD +   L T   +   +Q+   G+E DS+ F  NL
Sbjct: 507 DYLEHNITALNLIMKNYILNGLIYTDSKEQTLETRNFYNELIQVEILGRESDSSQFAMNL 566

Query: 127 PT 128
            T
Sbjct: 567 ST 568

>TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1.357
           YHR015W
          Length = 692

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 40  KFLGEHPGGDESILDYAGKDVTEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLL 99
           + L +    D+SI+D       + ++D+D   +S +    +ED+  I      +   R  
Sbjct: 286 ELLTDEDAKDKSIVDQISSKSNDDVEDNDNIGYSITQKNKIEDDVSIAATVNGDSERRND 345

Query: 100 TNKSHKVEVQLSADGKEFDSTTFVKNLPTE 129
            N  +K++       K F ++ F+KNLP +
Sbjct: 346 ANNENKLK-------KVFPNSVFIKNLPID 368

>TPHA0E01540 Chr5 (313509..314159) [651 bp, 216 aa] {ON} Anc_5.465
           YOR131C
          Length = 216

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 11/88 (12%)

Query: 110 LSADGKEFDSTTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNR-----PLLMQILRSDFK 164
           +S   K  D   F+K LPTEE  ++A+      +    L++       PLL  + +++  
Sbjct: 41  ISLHDKSVDILDFIKWLPTEEARAVASSNIASVENKAMLEMVPQPGLIPLLKYLHQNNIS 100

Query: 165 KDFYVDQIHRPRHYGKGSAPLFGNFLEP 192
           K+     +  P HY         NF+EP
Sbjct: 101 KNICTRNLIGPVHY------FISNFIEP 122

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFVKNLPTE 129
           +  SD+ Y I  DE    Y    +  T LL+   H V          FD+TT +  LP+E
Sbjct: 250 NNQSDNIY-ISNDE---KYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSE 305

Query: 130 EKLSIATDYGNDYKKHKFLDLNRPLLM 156
             L++  D   ++   KF+D N P+ M
Sbjct: 306 TDLTLYKDMIINF---KFMDFNVPINM 329

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,335,739
Number of extensions: 1672644
Number of successful extensions: 4514
Number of sequences better than 10.0: 147
Number of HSP's gapped: 4567
Number of HSP's successfully gapped: 147
Length of query: 384
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 273
Effective length of database: 40,753,473
Effective search space: 11125698129
Effective search space used: 11125698129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)