Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.4078.773ON45845823740.0
Smik_13.4468.773ON45845822450.0
YMR238W (DFG5)8.773ON45845822150.0
Suva_13.4228.773ON45845821500.0
NDAI0K008408.773ON45944818160.0
SAKL0B05412g8.773ON45145117890.0
NCAS0C008108.773ON45143717830.0
CAGL0M05049g8.773ON45342617730.0
KAFR0B034908.773ON45145017490.0
TBLA0B033208.773ON45044617350.0
Kpol_1030.208.773ON45145217250.0
TDEL0B033608.773ON43643517090.0
KLLA0F24926g8.773ON45145316580.0
TPHA0J016008.773ON46146216510.0
Kwal_55.202668.773ON45744316500.0
KNAG0J007008.773ON46344016390.0
KLTH0E04048g8.773ON45443616190.0
ZYRO0F12210g8.773ON45343515970.0
Ecym_14748.773ON45445415130.0
AFR530W8.773ON45945615030.0
NCAS0A08740singletonON43440314690.0
ACL200WsingletonON46344914420.0
ACL201WsingletonON44844714200.0
NCAS0A08730singletonON63138714250.0
TBLA0C03850singletonON56738213650.0
ACL202WsingletonON45040013360.0
KLTH0D08008g2.570ON44840012421e-168
SAKL0D13574g2.570ON45145112411e-168
KLLA0E07723g2.570ON45045412121e-164
NDAI0B015102.570ON44742612081e-163
YKL046C (DCW1)2.570ON44943611981e-162
Smik_11.2022.570ON44945111981e-161
TPHA0I024702.570ON45241211911e-160
Suva_11.1802.570ON45043611911e-160
Skud_11.1832.570ON44944411871e-160
KAFR0A021702.570ON44945311841e-159
KAFR0I017402.570ON44842711781e-159
Kwal_26.82252.570ON44941611761e-158
NDAI0C006802.570ON45245011701e-157
TBLA0H02580singletonON44941911661e-157
NCAS0H029002.570ON45345811591e-156
NCAS0A127502.570ON44744911561e-155
CAGL0L01727g2.570ON44641711541e-155
TBLA0H02590singletonON45045511501e-154
KNAG0A071802.570ON46340411211e-150
Kpol_1056.42.570ON45042511181e-149
TBLA0H026002.570ON44937911081e-148
TDEL0B065802.570ON44741711011e-147
Ecym_45772.570ON45041510791e-144
ABR060W2.570ON45139910781e-143
ZYRO0E06380g2.570ON45342110601e-141
YKR089C (TGL4)5.690ON91085704.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.407
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   919   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   869   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   857   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   832   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   704   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   693   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   691   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   687   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   678   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   672   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   669   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   662   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   643   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   640   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   640   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   635   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   628   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   619   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   587   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   583   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            570   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   560   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   551   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            553   0.0  
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              530   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   519   0.0  
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   483   e-168
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   482   e-168
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   471   e-164
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   469   e-163
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   466   e-162
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   466   e-161
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   463   e-160
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   463   e-160
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   461   e-160
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   460   e-159
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   458   e-159
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   457   e-158
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   455   e-157
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   453   e-157
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    451   e-156
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   449   e-155
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   449   e-155
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   447   e-154
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            436   e-150
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   435   e-149
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   431   e-148
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   428   e-147
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   420   e-144
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   419   e-143
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   412   e-141
YKR089C Chr11 complement(605633..608365) [2733 bp, 910 aa] {ON} ...    32   4.8  

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/458 (97%), Positives = 445/458 (97%)

Query: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60
           MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA
Sbjct: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           TNVLQNNLNITK             LSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/458 (91%), Positives = 433/458 (94%)

Query: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60
           MI+ SSM MIP ICFT LSF  I HAM+LD+TSKTSICDATALIQDGMLDYY+GTRYGGA
Sbjct: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCEN+TYQELLYDALLAQTGSNYDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP +GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGN+TYLDVAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWET LT+ILNGAK+YFFKD+IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAP+TSDTIDDLIKTSAEAAAKSC+GG DG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360

Query: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGL+WGKQT+DGYYGLGEQM+ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           TNVLQNNLNI               LSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/458 (90%), Positives = 427/458 (93%)

Query: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60
           MIV+ S +MI  ICFTFLSF   +HAMDLDTTSKTSICDATALIQ GMLDYY+GTRYGG 
Sbjct: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCEN+TYQELLYDALLAQTGSNYDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP +GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTVSNACLFQIAARLGRYTGN+TYL+VAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT EWET LT+ILNGAK+YFFKD+IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAPFT DTIDDLIKTSAEAAAKSCNGGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGL+W KQT+DGYYGLGEQMSALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           TNVLQNNLNI K             LSVL GGAVWMLF
Sbjct: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/458 (86%), Positives = 423/458 (92%)

Query: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60
           MIV +SM++   +CFT LSF   + AMDLDTTS TSICDATALIQDGMLDYY+GTRYGG 
Sbjct: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+N+TYQ LLYDALLAQTG++YDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+PD G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGN+TYLDVAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGTSEW+T L Q+LNGA +YFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTID LIKTSAEAAAKSC+GGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360

Query: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGLDW K+T+DGYYGLGEQMSALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           T+VLQNNLNITK             LSVLIGGAVWMLF
Sbjct: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/448 (74%), Positives = 386/448 (86%), Gaps = 1/448 (0%)

Query: 12  FICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWW 71
           F  F  L  V  + A+DLD TSK SICDAT+LIQ GM+DYY GT+YGG VGMFQ PYYWW
Sbjct: 12  FHFFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWW 71

Query: 72  HAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AGEAFGGM+ENW+LC+N+TY+++L  ALLAQTGSNYDYIPANQ+MVEGNDDQG+WG+T+
Sbjct: 72  EAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTL 131

Query: 132 MGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVS 191
           MGA ERNFTDPD+G PGWLAM QAVFNTM +RWDS HCGGGLRWQIFTWNSGYNYKNT+S
Sbjct: 132 MGAAERNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTIS 191

Query: 192 NACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITK 251
           NACLFQ+AARLGRYTGN+TYL+VAE+VF WLVDVGYV+L+DTANVFDGAEID+NCTD+T+
Sbjct: 192 NACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQ 251

Query: 252 IEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFF-KDTIMYESACQDYSTC 310
           IEWTYNHG+VLGG AYMYNATNG+S+WE+R+T++L GA  YFF  + IM+E+ACQ+Y+TC
Sbjct: 252 IEWTYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTC 311

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQ 370
           N DQR+FKSIFSRMLGLTSV+APFTSDT+D LIKTSA AAAKSC GGTDGHTCGL+W K 
Sbjct: 312 NNDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKG 371

Query: 371 THDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNI 430
           +HDGYYGLGEQM ALEV+QNLLIHDRPAP   + GG+SKGDA AG+NS+TTNVL+N + I
Sbjct: 372 SHDGYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTI 431

Query: 431 TKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           T              L VL GGAVWM F
Sbjct: 432 TNGDRAGAAIVTAIILGVLTGGAVWMFF 459

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/451 (71%), Positives = 375/451 (83%), Gaps = 1/451 (0%)

Query: 9   MIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68
           MI  +       + I HA+DLDT+SK SIC AT+LIQ GMLDYY+GT+YGG VGMFQ PY
Sbjct: 1   MISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGML+N +LC+NETY++L+YDA++AQTG NYDYIPANQ+MVEGNDDQG+WG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTDP-DEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           IT+MGAVERNFT+P  EG PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 188 NTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NT++N CLFQIAARLGRYTGN TYL+VA +V+DWL DVG+VVL D ANVFDGA I+ NC+
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCS 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDY 307
            I KIEWTYNHG+VLGG AYMYNATNG+  W+TRLTQ+L+GA  +FF ++IMYE ACQ  
Sbjct: 241 SIVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGS 300

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDW 367
            TCN DQR+FKSIFSRMLGLTSV+APFT DTID LIK SAE AA+SC GGTDGHTCGLDW
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 368 GKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
               HDGYYGLGEQMSALE++QNLLI D P P+   NGG+S GD NAG+NSS+ NVL+NN
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENN 420

Query: 428 LNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           L+IT              L V+IGG+VWM+F
Sbjct: 421 LSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/437 (72%), Positives = 371/437 (84%), Gaps = 1/437 (0%)

Query: 23  ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
           +  ++DLD TSK SIC ATALIQ GMLDYY+G RYGGAVGMFQ PYYWW+ G AFGGMLE
Sbjct: 15  LVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGVAFGGMLE 74

Query: 83  NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
           N +LCEN T++ LL DAL+AQTG NYDYIP+NQ+MVEGNDDQG+WG+T+M AVERNFT P
Sbjct: 75  NMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAVERNFTAP 134

Query: 143 DE-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAAR 201
           ++ G PGWLAM QAVFNTMY+RWD +HCGGGLRWQIFTWNSGYNYKNT++NACLFQ+AAR
Sbjct: 135 NKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANACLFQMAAR 194

Query: 202 LGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIV 261
           LGRYTGN TYLDVAE+VFDW+VD+ Y+VLND ANVFDGA+ID NCTDIT +EWTYNHG+V
Sbjct: 195 LGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTLEWTYNHGVV 254

Query: 262 LGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIF 321
           LGG AYMYNATNG+S WETR+ +IL GA+ YFF+D +M ESACQ Y+TCN DQR FKSIF
Sbjct: 255 LGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNNDQRCFKSIF 314

Query: 322 SRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQ 381
           SRMLG TSV+APFT++TID LIK SAEAAA SC GG DGHTCGLDW K ++DGYYGLGEQ
Sbjct: 315 SRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGYYGLGEQ 374

Query: 382 MSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXX 441
           M+ALE++ NLLIHDRPAP   + GGTS+GDA+AG+NS+TTNVL+N L IT+         
Sbjct: 375 MNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQGDRAGAAIV 434

Query: 442 XXXXLSVLIGGAVWMLF 458
               L + +GGAVWMLF
Sbjct: 435 TAVILGIFVGGAVWMLF 451

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/426 (74%), Positives = 365/426 (85%)

Query: 33  SKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENETY 92
           +K SIC ATALIQ GMLDYY+GTRYGG VGMFQ PYYWW AG AFGGMLENWFLC+N+TY
Sbjct: 28  NKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTY 87

Query: 93  QELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEGKPGWLAM 152
           ++LL +AL+AQTG NYDYIPANQT VEGNDDQG+WG+T++ AVERNF+ P +GKPGWLAM
Sbjct: 88  KDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAM 147

Query: 153 VQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNSTYL 212
            Q +FNTMY+RWD + C GGLRWQIFTWNSGYNYKNT+SNACLFQIAARLGRYTGN+TYL
Sbjct: 148 SQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYL 207

Query: 213 DVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNAT 272
           DVAE+VFDWLV VGY+VL++  NV+DGA+++ NCTDIT IEWTYNHG+VLGGLAYMYNAT
Sbjct: 208 DVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNAT 267

Query: 273 NGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSRMLGLTSVMA 332
           NG+S W++RLT +L GA AYFF+D IMYESACQ Y TCN DQR FKSIFSRMLG TSV+A
Sbjct: 268 NGSSVWQSRLTSVLGGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLA 327

Query: 333 PFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSALEVIQNLL 392
           PFTSDTID L+K SA AAA SC+GGTDGHTCGLDW  +T+DGYYGLGEQMSALEVIQ LL
Sbjct: 328 PFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLL 387

Query: 393 IHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXXXXXLSVLIGG 452
           IH+RPAPY+  NGGTS GDA AG+NS+TTNVL+NNL IT              L ++IGG
Sbjct: 388 IHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGG 447

Query: 453 AVWMLF 458
           A WM+F
Sbjct: 448 AAWMMF 453

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/450 (70%), Positives = 375/450 (83%), Gaps = 3/450 (0%)

Query: 12  FICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWW 71
            I   F   + ++ A+DLDT+SKTSICDATALIQDGMLDYY+G RYGG VGMFQSPYYWW
Sbjct: 2   MITLLFPLLLTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWW 61

Query: 72  HAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AGEAFGGMLENWFLCEN+T++E++YDA+LAQTGS+YD++P NQTMVEGNDDQ +WG+T+
Sbjct: 62  EAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTI 121

Query: 132 MGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVS 191
           M AVERNFTDP +G PGWL M QA+FN M+SRWDS +CGGGLRWQIFTWNSGY+YK+T+S
Sbjct: 122 MDAVERNFTDPTDGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTIS 181

Query: 192 NACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYV-VLNDTANVFDGAEIDTNCTDIT 250
           N CLFQ+A+RLGRYTGN TYLDVAE V+DWLVDVG++ V N TA V+DGA+I  NCTDIT
Sbjct: 182 NVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDIT 241

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTC 310
            I+W+YNHGI+LGG AY YNATNG+S WE+R+T I+ GAK+ FF D IMYESACQDY TC
Sbjct: 242 TIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDTC 301

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQ 370
           N DQR+FKSIFSRMLG TSV+APFT+ TID LIK+SA A A SC+GGTDGHTCGL+W  +
Sbjct: 302 NNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDK 361

Query: 371 THDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTT--NVLQNNL 428
           T DG YGLGEQMSALEVIQNLLIHDRPAPY  S GG+S GDA+AG+N++T+  +VL+NNL
Sbjct: 362 TCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNL 421

Query: 429 NITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
            IT              L  + GGA+WMLF
Sbjct: 422 TITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/446 (71%), Positives = 370/446 (82%), Gaps = 1/446 (0%)

Query: 13  ICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWH 72
           +  + LSFV  + AMDLDT+SK SIC AT+LI  GMLDYY GT+YGG VGMFQ PYYWW 
Sbjct: 6   LILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWE 65

Query: 73  AGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVM 132
           AGEAFGGMLENW+LC+N+TY +LL+DAL AQTG +YDYIP NQTMVEGNDDQ IWG+TVM
Sbjct: 66  AGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVM 125

Query: 133 GAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSN 192
            AVERNFT+P EG PGWLAM QAVFNTM+SRWD+  CGGGLRWQIFTWNSGY+YKNT+SN
Sbjct: 126 DAVERNFTNPTEG-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISN 184

Query: 193 ACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKI 252
           ACLFQ+AARLGRYTGN+TYLDVA  VFDWL  VGYV +++ A V+DGA+I  NCTDITK 
Sbjct: 185 ACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKY 244

Query: 253 EWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNT 312
           +W+YN+G +LGG AYMYNATNG+S WETR+TQ+LNGAKAYFF+D IMYESACQ   TCN 
Sbjct: 245 QWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNN 304

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTH 372
           DQR+FKS+FSRMLG TSV+ P T D ID LI  SA+ AA++CNGGTDGHTCGL+W   TH
Sbjct: 305 DQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTH 364

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITK 432
           DGYYGLGEQMSALEVIQNLLIHDRPAPY   +GG+S+GDANAG+N ++ NVL N+L+I  
Sbjct: 365 DGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKT 424

Query: 433 XXXXXXXXXXXXXLSVLIGGAVWMLF 458
                        L++L+GGA+WMLF
Sbjct: 425 GDKVGAAILTAGVLAILVGGAIWMLF 450

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/452 (69%), Positives = 374/452 (82%), Gaps = 1/452 (0%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M ++  +     +F+    A+DLD  SK SIC AT+LIQ GMLDYY+GTRYGG VGMFQ 
Sbjct: 1   MVLLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQP 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AGEAFGGM+ENWFLC+N+TY +++YDALLAQTGSNYDY+PANQT VE    + +
Sbjct: 61  PYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-V 119

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           +G TVM A ERNFT P +GKP WLAM QAVFNTMY+RWDS +CGGGLRWQI+TWNSGYNY
Sbjct: 120 FGGTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNY 179

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KNTVSNACLFQIAARLGRYTGN TYL+VAE+VFDWLVDV +VVLND ANVFDGA I +NC
Sbjct: 180 KNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQD 306
           + + K+EW+YNHGIVLGGLAYMYNATNGTS+WE+ LT++LNGAK+ FFK+ IMYE ACQD
Sbjct: 240 SAVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQD 299

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLD 366
           ++TCNTDQR+FKSIFSRMLGLTSV+AP+TSDTI  LI+ SAE AAKSC+GGTDGHTCGL+
Sbjct: 300 HNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLN 359

Query: 367 WGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQN 426
           W   T+DG YGLGEQM ALE++ NLLI +RPAPY   NGGTS GD +AG+N+++T+VL N
Sbjct: 360 WNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSN 419

Query: 427 NLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           NL+I +             L VL+GG+VWMLF
Sbjct: 420 NLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/435 (71%), Positives = 364/435 (83%), Gaps = 2/435 (0%)

Query: 26  AMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
            +DLD +SK SIC ATALIQ GMLDYY+GTR GG VGMFQSPYYWW AGEAFGGM++NW+
Sbjct: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61

Query: 86  LCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEG 145
            CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P  G
Sbjct: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205
            PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNT+SNACLFQIAARLGRY
Sbjct: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181

Query: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           TGN TYL+VAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGL
Sbjct: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241

Query: 266 AYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ--DYSTCNTDQRTFKSIFSR 323
           A+MYNATNG+SEWETR+TQIL GA++YFFKD+IMYES CQ    STCN+DQR+FK+IFSR
Sbjct: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301

Query: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383
           MLGLTSV+ P T   +DDL+K SA AAA SC+GGTDGHTCGL+W KQ +DGYYGLGEQMS
Sbjct: 302 MLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMS 361

Query: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXXX 443
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I             
Sbjct: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421

Query: 444 XXLSVLIGGAVWMLF 458
             L VL+GG++WMLF
Sbjct: 422 VILMVLVGGSIWMLF 436

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/453 (68%), Positives = 363/453 (80%), Gaps = 3/453 (0%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M++ P     FL+ V +  A+DLDT+SK+SIC ATALIQ G+ DYY+G  YGG VGMF S
Sbjct: 1   MKISPLYSL-FLTVVSV-LAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+P+NQTMVEGNDDQG+
Sbjct: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118

Query: 127 WGITVMGAVERNFTDPDE-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
           W +TVM AVERNFT+P E G PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYN
Sbjct: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178

Query: 186 YKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKNT+SN CLFQ+AARLGRYTGN+TYL+VAE+VFDWLVD+ +VV+ + ANVFDGA ID N
Sbjct: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ 305
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+TR  QIL GA ++FF+D IMYES CQ
Sbjct: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
             + CNTDQR FK+IFSRMLG TSV+APFT+DTI  LI TSA AAAKSC+GGTDGHTCGL
Sbjct: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGL 358

Query: 366 DWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           +W     DG YGLGEQ  ALE+I  LL+HD PAP  ES GG+S GDA+AG+N STTNVLQ
Sbjct: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQ 418

Query: 426 NNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
            N+NIT              L VL+ G VWM+ 
Sbjct: 419 KNINITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/462 (66%), Positives = 369/462 (79%), Gaps = 13/462 (2%)

Query: 9   MIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68
           M        +S +  + A+ LD  SK S+C+ATALIQ GMLDYY GTRYGG VGMFQ PY
Sbjct: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGMLENW+LC+N+T++ L+ DAL+ Q GSNYDYIP+NQT+VEGNDDQG+WG
Sbjct: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           +TV+GAVERN  D D G PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKN
Sbjct: 121 LTVLGAVERNLPDRD-GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179

Query: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           T+SNACLFQIAARLGRYTGN+TYL+VAE+VFDW+VDV Y+VL D ANV+DGA  + NC+D
Sbjct: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYS 308
           I + EW+YNHG+VLGGLAYMYNATNGTS+WET LTQ+L+GA  YFFK+ IMYESACQ+  
Sbjct: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWG 368
           TCNTDQR+FKSIFSRMLG T V+AP+T+ T+D LI+TSA+AAA SC+GGTDG TCGL W 
Sbjct: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359

Query: 369 KQTHDGYYGLGEQMSALEVIQNLLI------------HDRPAPYKESNGGTSKGDANAGM 416
             T+DGYYGLGEQMSALE+I  LL+                +PY  S+GG S GDA+AG+
Sbjct: 360 DSTNDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGL 419

Query: 417 NSSTTNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           N+++TNVLQNNL+I               L+VL+GG+VWMLF
Sbjct: 420 NTTSTNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/443 (67%), Positives = 359/443 (81%), Gaps = 4/443 (0%)

Query: 20  FVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGG 79
           F     A+DLDT+SK SICDAT+LIQ G++DYY+G R+GG VGMFQ PYYWW AGE FGG
Sbjct: 15  FTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGG 74

Query: 80  MLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           M+ENWFLC+N+TY++ LYDA++AQ G +YD++P+NQ+MVEGNDDQG+WG+T+M AVERNF
Sbjct: 75  MMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNF 134

Query: 140 TDPDE-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQI 198
           T+P E G PGWLAMVQ VFNTM+SRWDS+HCGGGLRWQIFTWNSGYNYKNTVSNACLFQ+
Sbjct: 135 TNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQL 194

Query: 199 AARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTY 256
           AARLGRYTGN TYL  AE V++WLVD+G+V  N++  ANV+DGA ID NCTDI +IEW+Y
Sbjct: 195 AARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSY 254

Query: 257 NHGIVLGGLAYMYNAT-NGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQR 315
           N GIVLGG AYMYNAT NGTS+WE+RL QI+ G+   FF++ IMYE+ CQD   CN DQR
Sbjct: 255 NQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKCNQDQR 314

Query: 316 TFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGY 375
           +FKSIFSRML LT  +AP+T+D ID L+K SAE AAKSC GGTDGHTCGL+W K  HDG+
Sbjct: 315 SFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGW 374

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXX 435
           YGLGEQ  ALE IQ+ L   RPAPY   NGGTS GD  AG+N ++TNVL ++LNIT+   
Sbjct: 375 YGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNITQKDK 434

Query: 436 XXXXXXXXXXLSVLIGGAVWMLF 458
                     L+VL+GG++WM+F
Sbjct: 435 VGASIITAVLLAVLVGGSIWMIF 457

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/440 (69%), Positives = 356/440 (80%), Gaps = 7/440 (1%)

Query: 20  FVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGG 79
           F G S A+ LD      +C ATAL+ DG+LDYY GTRYGG VGMFQ PYYWWHAGEAFGG
Sbjct: 30  FTGAS-ALSLD-----PVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGG 83

Query: 80  MLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           M+ENWFLC+N TY+ LL DA +AQTG+NYDYIP NQTMVEGNDDQGIWG+T+M AVERNF
Sbjct: 84  MIENWFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNF 143

Query: 140 TDP-DEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQI 198
           T P  +G PGWLAM QAVFNTM++RWD++HCGGGLRWQIFTWNSGYNYKNT+SNACLF +
Sbjct: 144 TKPTKDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNL 203

Query: 199 AARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNH 258
           AARLGRYTGNSTYLDVA+QVFDW+V VGYVVL DTANVFDGA I+ NCT IT  EW+YNH
Sbjct: 204 AARLGRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNH 263

Query: 259 GIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFK 318
           G+VLGG A+MYNATNG+S WE R+ +IL GA  YFF+D+IM+ESACQD   CN DQRTFK
Sbjct: 264 GVVLGGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFK 323

Query: 319 SIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGL 378
           +IFSRML  T+V+ P T+ TID L+++SA+AAA+SC+GGTDGHTCGL+W     DG YGL
Sbjct: 324 AIFSRMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGL 383

Query: 379 GEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXX 438
           GEQMSALEV+  LL+HDRPAPY  + GG+S GDA+AG+NS+ TNV  N+LNI        
Sbjct: 384 GEQMSALEVMNYLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGA 443

Query: 439 XXXXXXXLSVLIGGAVWMLF 458
                  L  L GG++WMLF
Sbjct: 444 AIVTTVILGTLAGGSIWMLF 463

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/436 (67%), Positives = 351/436 (80%), Gaps = 4/436 (0%)

Query: 27  MDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           +DLDT+  +SICDAT+LIQ G++DYY GTR GG VGMFQ PYYWW AGE FGGMLENWFL
Sbjct: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78

Query: 87  CENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDE-G 145
           C+N+TY +++YDA++ Q G +YD++P+NQ+MVEGNDDQG+WG+TVM A ERNFT+P E G
Sbjct: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205
            PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNTVSNAC+FQ+AARLGRY
Sbjct: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198

Query: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           TGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+YN GIVLG
Sbjct: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258

Query: 264 GLAYMYNAT-NGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFS 322
           G AYMYNAT N TS W++RL QI+ G+  +FFKD +MYES CQD  TCN DQR+FKSIFS
Sbjct: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318

Query: 323 RMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQM 382
           RML LT  +AP+T++TID L++ SAE AAKSC GGTDGHTCGL+W    HDGYYGLGEQ 
Sbjct: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378

Query: 383 SALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXX 442
            ALE IQ+L+   RPAPY   NGG+S GD  A +NS++TNVLQ+++ IT           
Sbjct: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438

Query: 443 XXXLSVLIGGAVWMLF 458
              L+VL+GG++WM+F
Sbjct: 439 AVILAVLVGGSIWMIF 454

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/435 (67%), Positives = 344/435 (79%), Gaps = 2/435 (0%)

Query: 26  AMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
           A+DL    K S+C ATALIQ GMLDYY G +YGGA+GMFQ PYYWW AGEAFGGM++NW 
Sbjct: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78

Query: 86  LCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEG 145
            C+N T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+WG+TVM AVERNFTDP +G
Sbjct: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRY 205
           KPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNT+SN C FQ+AARLGRY
Sbjct: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198

Query: 206 TGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           T N TYL+VAE+VFDWL DVG+VVL D  NVFDGA  D NCT +T++EWTYNHGI+LGG 
Sbjct: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258

Query: 266 AYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ--DYSTCNTDQRTFKSIFSR 323
           AYMYNATNG+S+WE R+ QILNGA  YFF+D +MYES CQ  D S CN DQR+FKSIFSR
Sbjct: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318

Query: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383
           MLGLTSV+ P  SD +D L+  SAE AAKSC+GG DGHTCGL+W K + D  YGLGEQMS
Sbjct: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378

Query: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXXX 443
           ALEVIQN LIH+   PY+ES GG+SKGD+ AG+N++TTNVLQ  L I             
Sbjct: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITG 438

Query: 444 XXLSVLIGGAVWMLF 458
             L V++GG+VWMLF
Sbjct: 439 VVLMVVVGGSVWMLF 453

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/454 (62%), Positives = 335/454 (73%), Gaps = 2/454 (0%)

Query: 7   MRMI-PFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQ 65
           MR+I        L  V +   + LD  SK SIC AT  IQ G++DYY G+  GG VGMF 
Sbjct: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
            PYYWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIP+NQ+M EGNDDQG
Sbjct: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120

Query: 126 IWGITVMGAVERNFTDPDEGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGY 184
           IWG+ +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY
Sbjct: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180

Query: 185 NYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDT 244
           +YKNT++N CLFQ+AARLGRYTGNSTYLD+A + F WLVDV +VVL D ANVFDGA I  
Sbjct: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240

Query: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESAC 304
           NC DI  IEWTYNHG++LGG AYMYNATNG   WETRL QIL GA+A+FF++ IMYE AC
Sbjct: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300

Query: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCG 364
           QD   CN DQR+FKSIFSRML +TSV+APFT +TID L++ SA AAA SC+GG DG TCG
Sbjct: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCG 360

Query: 365 LDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVL 424
           LDW   + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL
Sbjct: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420

Query: 425 QNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
            + LNI               L +L+G A+WM+ 
Sbjct: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/456 (59%), Positives = 341/456 (74%), Gaps = 3/456 (0%)

Query: 6   SMRMIPFICFTFLSFVG-ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMF 64
           S  M   +   FL   G +S A+DLD +S+  +C  T  IQ G++DYY G++YGG VGMF
Sbjct: 4   SAGMTGLLVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMF 63

Query: 65  QSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQ 124
           Q PYYWW AGE FGGMLENW+LC+N+ Y+ +L ++++AQTG  +DYIPANQ+  EGNDDQ
Sbjct: 64  QPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQ 123

Query: 125 GIWGITVMGAVERNFTDPD-EGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSG 183
           G+W + +MGAVERNF DP+ EG PGWL MVQ VFN M +RWD+E+CGGGLRWQIF WN+G
Sbjct: 124 GVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNG 183

Query: 184 YNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEID 243
           Y YKNT++N CLFQ+AARLGRYTGN TYLDVA +VF WLVDV Y+VL D A VFDGA I 
Sbjct: 184 YTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIH 243

Query: 244 TNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESA 303
            NC+DI  IEW+YNHGI+L G AYMYNAT G+ EWE+ +T+IL GA  ++F+D IMYE A
Sbjct: 244 ENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERA 303

Query: 304 CQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTC 363
           CQDY+TC+ DQR+FKSIFSRML +TSV+APFT  TID+LI  SA AA+KSC  GT G+TC
Sbjct: 304 CQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTC 363

Query: 364 GLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNS-STTN 422
           GL+W K T+DG YGLGEQ SALE+IQN+LIH +  P     GG S+G+ +AG++  S   
Sbjct: 364 GLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPA 423

Query: 423 VLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           +L+   NIT              L +++G A+WM+F
Sbjct: 424 ILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/403 (67%), Positives = 321/403 (79%), Gaps = 12/403 (2%)

Query: 23  ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
           +  ++ L+ TS TSICDAT++I  G+LDYY+GTR+ G VGMFQ PYYWW AG AFGGMLE
Sbjct: 23  VGSSIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLE 82

Query: 83  NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
           NW+LC+N+T++ LL DA+L Q G +YDY+P NQTMVE NDDQG+WG+T+MGAVERNFTDP
Sbjct: 83  NWYLCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDP 142

Query: 143 DEGK--PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAA 200
            +GK  PGWLAM Q++FN MYSRWD+  CGGGLRWQI+ WN GYNYKNT+S ACLFQ+AA
Sbjct: 143 -QGKDVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAA 201

Query: 201 RLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTA-NVFDGAEIDTNCTDITKIEWTYNHG 259
           RLGRYTGNSTYL VA++ F W+VD+GY+ LN ++  VFDGA I++NC+DITK+EW+YNHG
Sbjct: 202 RLGRYTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHG 261

Query: 260 IVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ--DYSTCNTDQRTF 317
           IVLGG AYMYNAT  + EW     +ILNGA  YFF++  M E+ACQ  D   CN DQRTF
Sbjct: 262 IVLGGCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTF 320

Query: 318 KSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYG 377
           KSIFSRMLGLTSVMAPFTS+ ID LI  SAEAAA SC GG D  TCGL+W +  +DGYYG
Sbjct: 321 KSIFSRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYG 380

Query: 378 LGEQMSALEVIQNLLIHDRPAPY-----KESNGGTSKGDANAG 415
           LGEQ+SALEVIQNLLIH RP PY     K   GG SKGD  AG
Sbjct: 381 LGEQLSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/449 (59%), Positives = 324/449 (72%), Gaps = 3/449 (0%)

Query: 10  IPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYY 69
           +P      +  + +S+A+D+D  S  SICDAT LIQ G+LDYY+G R GG VG FQ PYY
Sbjct: 14  LPMYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYY 73

Query: 70  WWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGI 129
           WW AGEAFGGM+ENW+LC N  YQ+LL DA+++Q G N DY+P++Q M+EGNDDQGIWG+
Sbjct: 74  WWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGL 133

Query: 130 TVMGAVERNFTD-PDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
            VMGA ERNF D P E  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN+GY+YKN
Sbjct: 134 LVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKN 193

Query: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           T+SNACLFQIAARL R+TGNSTY DVAE VFDWLVD   V L + A V DGA I   C D
Sbjct: 194 TISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCED 253

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYS 308
            +K+EWTYNHG+VL G AYMYN TNG++ W  RL ++LNG+   FF + I+YE ACQD  
Sbjct: 254 HSKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNGS-LLFFPNGILYERACQDVQ 312

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWG 368
            CN DQR+F+SIFSRML LTSV+AP T   I+  I+ SAEAAAKSC+GG DGHTCG+ W 
Sbjct: 313 KCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWR 372

Query: 369 KQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ-NN 427
             T DG YGLGEQ+SALE+IQN LIH +P P   + G  SKGD +AG+  ++ N++  + 
Sbjct: 373 NYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLST 432

Query: 428 LNITKXXXXXXXXXXXXXLSVLIGGAVWM 456
             I               L   I G++WM
Sbjct: 433 RQIGLKDRVGAGFMTVVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 322/447 (72%), Gaps = 4/447 (0%)

Query: 12  FICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWW 71
           ++    L+ V +S+A+D+D  S  SICDAT LIQ G+LDYY+G + GG  G    PYYWW
Sbjct: 2   YVLLVILNIV-LSNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWW 60

Query: 72  HAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AGEAFGGM+ENW+LC N  YQ+LL DA+++Q G N DY+P++Q MVEGNDDQGIWG+ V
Sbjct: 61  MAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLV 120

Query: 132 MGAVERNFTD-PDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTV 190
           MGA ERNF D P E  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN GY+YKNT+
Sbjct: 121 MGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTI 180

Query: 191 SNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDIT 250
           SNACLFQIAARL R+TGNSTY DVAE VFDWLVDV  V L + A V DGA I   C D +
Sbjct: 181 SNACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHS 240

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTC 310
           ++EWTYNHG+VLGG AYMYN TNG++ W  RL ++LNG+   FF++ I+YE ACQD + C
Sbjct: 241 QLEWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNGS-LLFFENGILYERACQDVNKC 299

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQ 370
           N DQR+F+SIFSRML LTSV+AP T   I+  I+ SAEAAAKSC+GG DGHTCG+ W   
Sbjct: 300 NDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNY 359

Query: 371 THDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTN-VLQNNLN 429
           T DG YGLGEQ+SALE+IQN LIH +P P   + G  S+GD  AG+  S+ N +      
Sbjct: 360 TWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQ 419

Query: 430 ITKXXXXXXXXXXXXXLSVLIGGAVWM 456
           I               L   I G++WM
Sbjct: 420 IRLKDRVGAGFATVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/387 (63%), Positives = 315/387 (81%), Gaps = 3/387 (0%)

Query: 15  FTFLS-FVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHA 73
           F ++S F+G + ++ LD TS  SICDAT+L+Q G+LDYY+GT YGG VGMFQ+PYYWWH+
Sbjct: 16  FIYVSLFIGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHS 75

Query: 74  GEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMG 133
           G AFG M+ENW+LC+++TY+ L+ DA+LAQ G NYD++P NQTMVEGNDDQG+WG+ +M 
Sbjct: 76  GCAFGSMIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMD 135

Query: 134 AVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNA 193
           A ER F    +G+P WL M + +F +M++RWD+ +CGGGLRWQI++WN+GY+YKNTVS  
Sbjct: 136 AAEREFPQV-KGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTT 194

Query: 194 CLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVL-NDTANVFDGAEIDTNCTDITKI 252
           CLFQ+AARLGRYTGN TY+  A Q FDWL  VG+V+  N+   VFDGA+I TNCT+I K 
Sbjct: 195 CLFQLAARLGRYTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKY 254

Query: 253 EWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNT 312
           EW+YNHGIVLGG AYMYN T+G+S WETR +Q+LN A +YFF++ IM+E+ CQ  + CN 
Sbjct: 255 EWSYNHGIVLGGAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNN 314

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTH 372
           DQR+F+SIF+RMLG TS+MAPFT++TID L+KT+++AAA +C+GG DGHTCGL+W     
Sbjct: 315 DQRSFRSIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNF 374

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAP 399
           DG YGLGE+MSA+EVIQNLLIH RPAP
Sbjct: 375 DGNYGLGEEMSAMEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/382 (62%), Positives = 302/382 (79%), Gaps = 2/382 (0%)

Query: 27  MDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           +++DT SK SIC+AT+LIQDG+LDYY+G RYGG VG+FQ PYYWW +GEAFG +L NW+L
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 87  CENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEGK 146
           C+N+TY++L+YDA+LAQ G NYD++P NQTMVEGNDDQG++ +T++ A+ERNFT P +G 
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206
           P WL M Q VFN+MY RWD+  C GG+RWQI++WN+GY+YKN VS   LF IAARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 207 GNSTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           GN++Y  VA+ +FDWL  V YV+ +D    V DGA I+ NCTDIT+IEWTYN GI++ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 266 AYMYNATNGTSEWETRLTQILNGAKAYFF-KDTIMYESACQDYSTCNTDQRTFKSIFSRM 324
           AY+YNATNG+++WE   T++L GAK  FF K+ IMYE+ACQ  + CN DQR+FK++ +R 
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLARF 316

Query: 325 LGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSA 384
           LG TSV+AP+T  TI  +I  SA  AAKSCNGG DGHTCGL W K T+DGYYG+GEQMSA
Sbjct: 317 LGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMSA 376

Query: 385 LEVIQNLLIHDRPAPYKESNGG 406
           LE+IQNLLI+D P P    NGG
Sbjct: 377 LEIIQNLLINDYPPPLVAPNGG 398

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/400 (61%), Positives = 299/400 (74%), Gaps = 2/400 (0%)

Query: 21  VGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGM 80
           + + +A+D++  S  SIC+AT LIQ G+LDYY+G R GG VG FQ PYYWW AG+ FGGM
Sbjct: 9   IVLCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGM 68

Query: 81  LENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFT 140
           +ENW+LC+N  Y++LL +A+++Q G N DY+P +Q MVEGNDDQGIWG+ VM A ER+F 
Sbjct: 69  VENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFP 128

Query: 141 D-PDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIA 199
           D P +  PGWLA+ QAVFNTM++RWD ++C GGL WQI+ WN GY+YKNT+SN  LFQIA
Sbjct: 129 DAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIA 188

Query: 200 ARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHG 259
           ARL R+TGNSTY  VAE VFDWLVD   V L++ A V DGA + TNCTD T+ EWTYN+G
Sbjct: 189 ARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYG 248

Query: 260 IVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKS 319
           +VLGG AYMYN TNG+  W  RL ++LNGA   FF++ IMYE  CQD   CN DQR FKS
Sbjct: 249 VVLGGCAYMYNFTNGSPVWANRLNRVLNGA-LLFFENGIMYERTCQDVDRCNNDQRFFKS 307

Query: 320 IFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLG 379
           IF+RML LTSV+AP T   I+  I+ SAEAAAKSCNGG+DGHTCGL W   T DG  GLG
Sbjct: 308 IFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLG 367

Query: 380 EQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSS 419
           EQ+ ALE+IQN LIH +  P     G  SKGD  AG+NSS
Sbjct: 368 EQLCALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 226/400 (56%), Positives = 295/400 (73%), Gaps = 2/400 (0%)

Query: 24  SHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLEN 83
           S A+D D  ++ SI +ATAL+  G+LDYY G +YG  +GMF +PYYWW AG A+G +L+ 
Sbjct: 18  SQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDF 77

Query: 84  WFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPD 143
           W+  +N+TY  +L +ALL Q G N+DYIP NQ+  EGNDDQ  WG+ VM A ERNFT+P 
Sbjct: 78  WWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPP 137

Query: 144 EGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLG 203
           E +P WL + QAVFNTM  RWD E CGGGLRWQIFTWNSGY+YKNTVSN  LF +AARL 
Sbjct: 138 ETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLA 197

Query: 204 RYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           RYTGN+TY+D AE+VFDW+  +G +  ND + V+DGA++D NC+ ITK+ WTYN G+++ 
Sbjct: 198 RYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMS 257

Query: 264 GLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSR 323
           G AY+YN T G+  W TR  + LN +   FF ++I+YE  CQ+ +TCNTDQR+FK+ FSR
Sbjct: 258 GCAYLYNYT-GSETWHTRTFEFLNSSDI-FFNNSILYERTCQEANTCNTDQRSFKAYFSR 315

Query: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383
            LGLT+ + P   + I D I+ SA+ AA+SC+GGTDGHTCGL+W     DG +GLGEQM+
Sbjct: 316 FLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMA 375

Query: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
           ALE++QN+L  DRPAPY  + GG+S G+  AG  +S TN+
Sbjct: 376 ALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL 415

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  482 bits (1241), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/451 (50%), Positives = 311/451 (68%), Gaps = 4/451 (0%)

Query: 8   RMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSP 67
           ++I  +C + L +   + AMDLD     S+ +ATAL+  G++DYY G +YG  +GMF +P
Sbjct: 5   KLINVLCGSLLLY-SPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNP 63

Query: 68  YYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIW 127
           YYWW AG A+G ML+ W+  EN+TY +++  ALL QTG ++DY+P NQ+  EGNDDQ  W
Sbjct: 64  YYWWEAGGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFW 123

Query: 128 GITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G+ VM A ERNF++PD  +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+YK
Sbjct: 124 GLAVMAAAERNFSNPDPDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYK 183

Query: 188 NTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           N+VSN  LF IAARL RYTGN +Y+D AE+VFDW+ DVG +   D A V DG  ID NCT
Sbjct: 184 NSVSNGALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDY 307
            +T  +WTYNHG+++ G AY+YN T G+  W  R  + L+ +  +F   +I++E+ACQ  
Sbjct: 244 SVTPYQWTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQAS 302

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDW 367
           +TCNTDQR+FK+ FSR LGLT+ + P +   I + I++SA+ AA+SC+GG DGHTCG++W
Sbjct: 303 NTCNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINW 362

Query: 368 GKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
              + DG+YGLGEQM+ALE+IQN+   DRPAPY  + GG+S+GD+ AG  +  TN+    
Sbjct: 363 FNGSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNLTP-- 420

Query: 428 LNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           L IT                 ++  AVW++ 
Sbjct: 421 LTITAGSRAGAGIITAVIGISIVACAVWLVL 451

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  471 bits (1212), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 231/454 (50%), Positives = 300/454 (66%), Gaps = 6/454 (1%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           MR+   +      F  +S  +DLD     S+ +AT+L+  G++DYY G +YG  +GMF S
Sbjct: 1   MRVFKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFAS 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           P YWW AG A+G +L+ WF  EN+TY ++L  ALL QTG N+DY+P NQT+ EGNDDQ  
Sbjct: 61  PSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WG  VM A ERN+ +P + +P WL + QAVFNTM SRWD + CGGGLRWQIFTWNSGY+Y
Sbjct: 121 WGFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDY 180

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTAN--VFDGAEIDT 244
           KN+VSNA LF ++ARL RYTGNS+Y + AE+++DW+ D+  +V  +     V+DGA I+ 
Sbjct: 181 KNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEE 240

Query: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESAC 304
           NCTD  K +WTYN G++L G AY+YN T  +  W  R    LN +   FF ++IMYE+AC
Sbjct: 241 NCTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAAC 298

Query: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCG 364
           Q    CN DQR+FK+ FSR LGLT+ + P T DT+  L++ SA+ AA SC+GGTDGHTCG
Sbjct: 299 QGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCG 358

Query: 365 LDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVL 424
           L+W     DG YGLGEQM+ALEV+QNL   DRPAPY   +GGTS G+  AG   S TN+ 
Sbjct: 359 LNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNLA 418

Query: 425 QNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
              L I K                +IG  VW++ 
Sbjct: 419 P--LTIGKGDQAGAGIITAVIGITIIGSVVWLII 450

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  469 bits (1208), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 230/426 (53%), Positives = 296/426 (69%), Gaps = 5/426 (1%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M+ +  I F  L+F   ++A+ LD  +  S+ + TAL+  G++DYY+G +YG  VGMF +
Sbjct: 1   MKRVFNILF-LLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSN 59

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ WF  EN+TY +L+  ALL QTG N DYIP NQ+  EGNDDQ  
Sbjct: 60  PYYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAF 119

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI  M A ERNFT+P E  P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+Y
Sbjct: 120 WGIAAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDY 179

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KN+VSN  LF +AARL RYTGN +Y+D AE+ +DW+ DVG +       V+DG  I+TNC
Sbjct: 180 KNSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQD 306
           T IT  +W+YN G++L G AY+YN T G++ W  R   +L+ A + FF ++IMYE ACQ 
Sbjct: 240 TTITSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQP 297

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLD 366
             TCN DQR+FKS  +R LGLT+ +   T   I + + TSA A A SC+GGTDGHTCGL+
Sbjct: 298 TGTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLN 357

Query: 367 WGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQN 426
           W     DGYYGLGEQMSAL+V+ N  + DRPAPY  +NGG+S GD  AG  ++ TN+   
Sbjct: 358 WFDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP- 416

Query: 427 NLNITK 432
            L+ITK
Sbjct: 417 -LHITK 421

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  466 bits (1198), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 229/436 (52%), Positives = 296/436 (67%), Gaps = 4/436 (0%)

Query: 23  ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
            ++A++LD  +  S+ +AT+LI  G++DYY G +YG  VGMF  PYYWW AG A+G ML+
Sbjct: 18  FTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLD 77

Query: 83  NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
            WF  +N+TY + +  A++ Q G + DYIP NQ+  EGNDDQ  WGI  M A ERNFT+P
Sbjct: 78  YWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP 137

Query: 143 DEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
            E +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNTVSN  LF IAARL
Sbjct: 138 PENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 197

Query: 203 GRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262
            RYTGN TY+D AE+V++W+V V  +       V+DG  ID NCT +T  +WTYN G++L
Sbjct: 198 ARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 257

Query: 263 GGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFS 322
            G AY+YN T G+  W TR  + LN ++  FF D I+YE+ACQ  ++CNTDQR+FK+ F+
Sbjct: 258 AGSAYLYNFT-GSDLWHTRTKEFLNASQV-FFHDGIVYEAACQGPNSCNTDQRSFKAYFA 315

Query: 323 RMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQM 382
           R LG+T+ + P T + I   + TSA AAAKSC+GGTDGHTCGL+W   T DG YGLGEQM
Sbjct: 316 RFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQM 375

Query: 383 SALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXX 442
           SALEV+ N    D+PAPY   NGG+S GD  AG  +  TN+    LNITK          
Sbjct: 376 SALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAP--LNITKGSKAGAGIIT 433

Query: 443 XXXLSVLIGGAVWMLF 458
                 ++  A+W++F
Sbjct: 434 AVIGISIVACALWLVF 449

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  466 bits (1198), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 301/451 (66%), Gaps = 6/451 (1%)

Query: 8   RMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSP 67
           ++I F+   F +    ++A++LD  +  S+ +AT+L+  G++DYY G +YG  +GMF  P
Sbjct: 5   KVIGFLSVLFAT--RFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDP 62

Query: 68  YYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIW 127
           YYWW AG A+G ML+ WF  +N+TY + +  A++ Q G + DYIP NQ+  EGNDDQ  W
Sbjct: 63  YYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFW 122

Query: 128 GITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           GI  M A ERNFT+P E  P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YK
Sbjct: 123 GIAAMTAAERNFTNPPEDDPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYK 182

Query: 188 NTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NTVSN  LF IAARL RYTGN TY+D AE+V++W+V V  +       V+DG  ID NCT
Sbjct: 183 NTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCT 242

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDY 307
            +T  +WTYN G++L G AY+YN T G+  W TR  + LN ++  FF D I+YE+ACQ  
Sbjct: 243 KVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLNASQV-FFHDGIVYEAACQGP 300

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDW 367
           ++CNTDQR+FK+ F+R LG+T+ + P T   I   + TSA AAAKSC+GGTDGHTCGL+W
Sbjct: 301 NSCNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNW 360

Query: 368 GKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
              T DG YGLGEQMSALEV+ N    DRPAPY   NGG+S GD  AG  +  TN+    
Sbjct: 361 FNGTWDGMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP-- 418

Query: 428 LNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           LNITK                ++  A+W++F
Sbjct: 419 LNITKGSKAGAGIITAVIGISIVACALWLVF 449

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  463 bits (1191), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/412 (54%), Positives = 289/412 (70%), Gaps = 4/412 (0%)

Query: 20  FVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGG 79
           +  ++ A+ LD  +  S+ +ATAL+  G++DYY G +YG  +GMF  PYYWW AG A+G 
Sbjct: 18  YSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGGAWGC 77

Query: 80  MLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           ML+ WF  EN+TY +++  ALL Q G+  DY+P NQ+  EGNDDQ  WGI  M A ERNF
Sbjct: 78  MLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAAERNF 137

Query: 140 TDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIA 199
           T+P E +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKN+VSN  LF IA
Sbjct: 138 TNPAEDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIA 197

Query: 200 ARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHG 259
           ARL RYTGN +Y + AE+V+DW+VDV  +  +    V+DG + + NCT ITK +WTYN G
Sbjct: 198 ARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWTYNQG 257

Query: 260 IVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKS 319
           ++L G AY+YN T G+  W TR    L+ +   FF DTI+YE+ACQ+  TCNTDQR+FK+
Sbjct: 258 LILSGCAYLYNYT-GSELWHTRTKNFLSSSSV-FFNDTILYEAACQNQETCNTDQRSFKA 315

Query: 320 IFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLG 379
            FSR LG+T+ + P T D I   I  SA  AA+SC+GGTDGHTCG++W     DG YGLG
Sbjct: 316 YFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGKYGLG 375

Query: 380 EQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIT 431
           EQM+ALE++ N    DRPAPY  SNGG+S GD  AG  +S TN+  + LNIT
Sbjct: 376 EQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLNIT 425

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  463 bits (1191), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 295/436 (67%), Gaps = 4/436 (0%)

Query: 23  ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
            ++A++LD  +  S+ +AT+LI  G++DYY G +YG  VGMF  PYYWW AG A+G ML+
Sbjct: 19  FTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLD 78

Query: 83  NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
            WF  EN+TY + +  A++ Q G + DYIP NQ+  EGNDDQ  WGI  M A ERNFT+P
Sbjct: 79  YWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP 138

Query: 143 DEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
              +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNTVSN  LF IAARL
Sbjct: 139 PSDEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 198

Query: 203 GRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262
            RYTGN TY+D AE+V++W+V V  +       V+DG  ID NCT +T  +WTYN G++L
Sbjct: 199 ARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 258

Query: 263 GGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFS 322
            G AY+YN T G+  W TR  + LN ++  FF D I+YE+ACQ  ++CNTDQR+FK+ F+
Sbjct: 259 AGSAYLYNFT-GSDLWHTRTKEFLNASQV-FFHDGIVYEAACQGPNSCNTDQRSFKAYFA 316

Query: 323 RMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQM 382
           R LG+T+ + P T   I   + TSA AAAKSC+GGTDGHTCGL+W   T DG YGLGEQM
Sbjct: 317 RFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQM 376

Query: 383 SALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXXXXXXXXXX 442
           +ALEV+ N    DRP+PY   NGG+S GD  AG  +  TN+  + LNITK          
Sbjct: 377 AALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKAGAGIIT 434

Query: 443 XXXLSVLIGGAVWMLF 458
                 ++  A+W++F
Sbjct: 435 AVIGISIVACALWLVF 450

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  461 bits (1187), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 298/444 (67%), Gaps = 4/444 (0%)

Query: 15  FTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAG 74
            + L F   S+A++LD  +  S+ +AT+LI  G++DYY G +YG  +GMF  PYYWW AG
Sbjct: 10  LSVLFFTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAG 69

Query: 75  EAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGA 134
            A+G ML+ WF  +N+TY + +  A++ Q+G + DYIP NQ+  EGNDDQ  WGI  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 135 VERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNAC 194
            ERNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNTVSN  
Sbjct: 130 AERNFTNPPADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGA 189

Query: 195 LFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEW 254
           LF IAARL RYTGN TY+D AE+V++W+V V  +       V+DG  I  NCT +T  +W
Sbjct: 190 LFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQW 249

Query: 255 TYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQ 314
           TYN G++L G AY+YN T G+  W TR  + LN ++  FF+D I+YE+ACQ  ++CNTDQ
Sbjct: 250 TYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLNSSQV-FFQDGIVYEAACQGPNSCNTDQ 307

Query: 315 RTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDG 374
           R+FK+ F+R LG+T+ + P T + I   + TSA AAAKSC+GGTDGHTCGL+W   T DG
Sbjct: 308 RSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDG 367

Query: 375 YYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKXX 434
            YGLGEQM+ALEV+ N    D+PAPY    GG+S GD  AG  +  TN+    LNITK  
Sbjct: 368 MYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLAP--LNITKGS 425

Query: 435 XXXXXXXXXXXLSVLIGGAVWMLF 458
                         ++  A+W++F
Sbjct: 426 KAGAGIITAVIGISIVACALWLVF 449

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  460 bits (1184), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/453 (49%), Positives = 303/453 (66%), Gaps = 7/453 (1%)

Query: 9   MIPFI---CFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQ 65
           MIP I        + +  S +++LD     S+ +ATAL+  G++DYY+GT+YGG VGMF 
Sbjct: 1   MIPRIKTFALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
           SPYYWW AG AFG +L+ W+  +N+TY + +  A++ Q G+++DYIP NQ+  EGNDDQ 
Sbjct: 61  SPYYWWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI  M A ERNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPASDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYD 180

Query: 186 YKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKN+VSN  LF +AARL RYTGN +Y+D AE+V++W+ D G++   +T  V+DGA  + N
Sbjct: 181 YKNSVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDN 240

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ 305
           C+ +TK +WTYN G++L G AY+YN +  +S W  R    L+ +   F  ++IM E+ACQ
Sbjct: 241 CSSVTKYQWTYNQGLILSGAAYLYNYSE-SSLWYNRTMTALS-SSGVFLNNSIMCEAACQ 298

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
              TC+TDQR+FK+ F+R LG+T+ + P T   I   +  SA A A+SC+GGTDGHTCGL
Sbjct: 299 PAGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGL 358

Query: 366 DWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           +W   + DGYYGLGEQMSALEV+ N    D+P PY  +NGG+S+GD  AG  ++ TN+  
Sbjct: 359 NWFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP 418

Query: 426 NNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
             LNIT                 LI   +W++F
Sbjct: 419 --LNITGGSKAAAAIITAVIGISLIACTLWIIF 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  458 bits (1178), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 294/427 (68%), Gaps = 6/427 (1%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M +   I     +F+G  ++++LD  S  S+ +ATAL+  G++DYY G +YG  VGMF  
Sbjct: 1   MVINNLILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSD 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G M++ W+  +N TY + +  ALL QTG ++DYIP NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI VM A ERNFT+P + +P WL + QAVFNTM  RWD   CGGGLRWQIFTWNSGY+Y
Sbjct: 121 WGIAVMTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDY 180

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTAN-VFDGAEIDTN 245
           KNTVSN  LF +AARL RYTGN++Y+D AE+V++W+ D  Y++ N T   V+DGA +  N
Sbjct: 181 KNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDT-YLISNGTQMFVYDGASVTDN 239

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ 305
           CT +TK +WTYN G++L G AY+YN T  +  W  R    LN A   FF ++IMYE+ACQ
Sbjct: 240 CTTVTKYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIMYEAACQ 297

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365
              TCNTDQR+FK+ FSR LG T+ + P T DT+   + TSA AAA SC+GGTDGHTCG+
Sbjct: 298 GPQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGI 357

Query: 366 DWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           +W     DGYYGLGEQMSALE++ N     +P PY   NGG+S GD  AG  ++ TN+  
Sbjct: 358 NWFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL-- 415

Query: 426 NNLNITK 432
           + LN+T 
Sbjct: 416 SPLNVTP 422

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  457 bits (1176), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/416 (53%), Positives = 289/416 (69%), Gaps = 4/416 (0%)

Query: 10  IPFIC-FTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68
           I   C FT L  +  S  + LD  +  SI +ATAL+  G+LDYY G +YG  +GMF  PY
Sbjct: 3   ISLTCVFTLLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPY 62

Query: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G +L+ W   +N+TY ++L  ALL Q+G N+DYIP NQ+  EGNDDQ  WG
Sbjct: 63  YWWEAGGAWGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWG 122

Query: 129 ITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           + VM A ERNFT+P   +P WL + QAVFNTM  RWD + CGGGLRWQIFTWNSGY+YKN
Sbjct: 123 LVVMAAAERNFTNPPPDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKN 182

Query: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TVSN  LF +AARL RYTGN TY++ AE+VFDW+  +  +   +   V+DGA++D NCT 
Sbjct: 183 TVSNGALFHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTV 242

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYS 308
           ITK+ WTYN G+++ G AY+YN T G  +W TR  + LN +   FF ++++YE ACQ  +
Sbjct: 243 ITKLIWTYNQGLLMSGSAYLYNYT-GAEKWHTRTFEFLNSSHI-FFNNSVLYERACQGVT 300

Query: 309 -TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDW 367
            +CNTDQR+FK+ FSR +GLT+ + P +   I   I+ SA  AA+SC+GG DGHTCGL+W
Sbjct: 301 VSCNTDQRSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNW 360

Query: 368 GKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
                DG +GLGEQMSALE++QNLL  DRPAPY    GG+S G+  AG  +S TN+
Sbjct: 361 FYDGWDGKWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL 416

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  455 bits (1170), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 293/450 (65%), Gaps = 4/450 (0%)

Query: 9   MIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68
           ++  +  T L     + A+++D     S+ +AT+L+  G++DYY G +YG  +GMF  PY
Sbjct: 7   LLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPY 66

Query: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G ML+ W+  +N+TY + +  ALL QTG N DY+P NQ+  EGNDDQ  WG
Sbjct: 67  YWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 126

Query: 129 ITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I VM A ERNFT+P E  P WL + QAVFNTM  RWD + CGGGLRWQIF WNSGY+YKN
Sbjct: 127 IAVMTAAERNFTNPPEDSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKN 186

Query: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TVSN  LF +AARL RYTGN +Y+D AE+V+DW+ +VG V    +  V+DG  I  NC+ 
Sbjct: 187 TVSNGALFHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCST 246

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYS 308
           IT  +WTYNHG+V+ G AY+YN T     W  R T++L  A   FF ++IMYE+ACQ  +
Sbjct: 247 ITPYQWTYNHGLVMAGAAYLYNFTE-NEVWHNR-TKMLVDASTVFFNNSIMYEAACQGPN 304

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWG 368
           +CNTDQR+FK+ FSR LG T+ + P T   I  LI  SA AA KSC+GGTDGHTCGL+W 
Sbjct: 305 SCNTDQRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWF 364

Query: 369 KQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNL 428
               DG YGLGEQM ALEV+ N     +PAPY  +NGG+S GD  AG     TN+    L
Sbjct: 365 IGDWDGMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLAP--L 422

Query: 429 NITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           +ITK                ++  A+W++F
Sbjct: 423 HITKGSRAGAGIITAVIGISILACALWLVF 452

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/419 (52%), Positives = 288/419 (68%), Gaps = 5/419 (1%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M  + ++          S A+ L+    +S+ +A +L+  G++DYY+G +YG  +GMF +
Sbjct: 1   MVWLRYLIIQISILASFSTAVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSN 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G M++ W+  +N+TY +++  ALL QTG   DYIP NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGITVM A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+Y
Sbjct: 121 WGITVMSAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSY 180

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDT 244
           KN+VSN  LF +AARL RYTGN +Y+D A +V+DW+   G ++ NDT    V+DGA I+T
Sbjct: 181 KNSVSNGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTG-LISNDTYFKFVYDGASIET 239

Query: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESAC 304
           NCTDIT+ +WTYN G++L G AY+YN T   S+W TR  Q +NG+ A FF ++I+YE+AC
Sbjct: 240 NCTDITQFQWTYNQGLILSGCAYLYNHTE-DSKWLTRTEQFVNGS-AVFFNNSIVYEAAC 297

Query: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCG 364
           Q    C+ DQR+F++ F+R LG+T+ + P T D I D I TSA AAA++C+GGTDGHTCG
Sbjct: 298 QGSKRCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCG 357

Query: 365 LDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
           L+W     DGYYGLGEQM ALE + N    D PAPY  SNGG+S G+  AG     TN+
Sbjct: 358 LNWFNIGWDGYYGLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL 416

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  451 bits (1159), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 227/458 (49%), Positives = 295/458 (64%), Gaps = 5/458 (1%)

Query: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60
           M+V  S+     +    +    +S A+ LD     S+ +AT+L+  G++DYY G +YG  
Sbjct: 1   MLVSKSISTFLLLSLASILPSQVS-ALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKT 59

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMF  PYYWW AG A+G ML+ W+   N+TY + +  ALL QTG + DY+P NQ+  EG
Sbjct: 60  VGMFSDPYYWWQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEG 119

Query: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQ  WGI VM A ERNFT+P E +P WL + QAVFNTM  RWDS+ CGGGLRWQIF W
Sbjct: 120 NDDQAFWGIAVMTAAERNFTNPPEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIW 179

Query: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGY+YKNTVSN  LF IA+RL RYTGN +Y+D AE+V+DW+ DV  +       V+DG 
Sbjct: 180 NSGYDYKNTVSNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGV 239

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300
            I  NCT +T  +WTYN G++L G AY+YN T G   W  R   +L  A   FF ++I+Y
Sbjct: 240 NIGDNCTTVTPYQWTYNQGLLLSGCAYLYNFT-GEELWHNRTKNLLTAAGV-FFNNSILY 297

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360
           E+ACQ ++TCNTDQR+FK+ FSR LG T+ + P T + I   I TSA AAA+SC+GGTDG
Sbjct: 298 EAACQGHNTCNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDG 357

Query: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCG++W     DG YGLGEQM+ALE++ N     + APY  SNGG+S GD  AG     
Sbjct: 358 HTCGINWFADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHP 417

Query: 421 TNVLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           TN+    L+ITK                ++  A+W++F
Sbjct: 418 TNLAP--LHITKGSRAGAGIITAVIGISIVTCALWLVF 453

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  449 bits (1156), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 223/449 (49%), Positives = 294/449 (65%), Gaps = 4/449 (0%)

Query: 10  IPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYY 69
           I ++ FT  SF     A+DL+  S  S+ +AT+L+  G++DYY G +YG  VGMF  PYY
Sbjct: 3   IIYLLFTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYY 62

Query: 70  WWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGI 129
           WW AG A+G ML+ W+  +N+TY +++  ALL Q G++ +YIP NQ+  EGNDDQ  WGI
Sbjct: 63  WWEAGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGI 122

Query: 130 TVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNT 189
           TVM A ERNFT+P E +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKN+
Sbjct: 123 TVMTAAERNFTNPPEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNS 182

Query: 190 VSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDI 249
           VSN  LF +AARL RYTGN +Y+D AE+V+DW+ DVG +       V+DGA    NCT +
Sbjct: 183 VSNGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVL 242

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYST 309
           T  +WTYN G++L G AY+YN T G+  W  R  Q+LN A + FF ++I+YE+ACQ   T
Sbjct: 243 TTYQWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQKSGT 300

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGK 369
           CN DQR+FK+ F R LG T+ +   T  TI   +  SA AAA+SC+GGTDGHTCGL+W  
Sbjct: 301 CNNDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFS 360

Query: 370 QTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLN 429
              DG YGLGEQMSALE + N  +   P PY  ++GG+S G++ AG     TN+    L+
Sbjct: 361 GGWDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLAP--LH 418

Query: 430 ITKXXXXXXXXXXXXXLSVLIGGAVWMLF 458
           IT                 ++   VW++ 
Sbjct: 419 ITDGSKAAAAIITSVVGISIVAAGVWLII 447

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  449 bits (1154), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/417 (52%), Positives = 282/417 (67%), Gaps = 4/417 (0%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           MR++  +    +S V +   ++LD     S+ +ATAL+  G++DYY G +YG  VGMF  
Sbjct: 1   MRLVTLLS-GLVSLVSV-FGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSD 58

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ W+  +N+TY + +  ALL QTG N DY+P NQ+  EGNDDQ  
Sbjct: 59  PYYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAF 118

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI VM A ER F +P + KP WL + QAVFNTM  RWDSE CGGGLRWQIF WNSGY+Y
Sbjct: 119 WGIAVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDY 178

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KNTVSN  LF IAARL RYTGN +Y+D AE+V+DW+ DV  +       V+DG  I+ NC
Sbjct: 179 KNTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNC 238

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQD 306
           T +TK +WTYN G++L G AY++N T G+  W  R    LN ++  FF ++I+YE+ACQ 
Sbjct: 239 TTVTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERTHAFLNASRV-FFNNSILYEAACQG 296

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLD 366
            +TCNTDQR+FK+ F+R LG T+ + P T   I   + TSA AAAKSC+GGTDGHTCGL+
Sbjct: 297 PNTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLN 356

Query: 367 WGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
           W +   DG YGLGEQM+ALEV+ N     R  PY  +NGG S GD  AG     TN+
Sbjct: 357 WFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNL 413

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  447 bits (1150), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 223/455 (49%), Positives = 296/455 (65%), Gaps = 10/455 (2%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           M  I  + F        ++A+ +D    +S+ +AT+LI  GM+DYY+G  YG  +GMF  
Sbjct: 1   MVKIHSLLFQISLLPLFTNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAK 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G +L+ W+  +N+TY +L+ +ALL QTG   DY+P NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI  + A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+Y
Sbjct: 121 WGIAAITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSY 180

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTAN----VFDGAEI 242
           KN+VSN  LF IAARL RYTGN +Y++ A++++DW+   G  +++D       V+DGA I
Sbjct: 181 KNSVSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTG--IISDEYETYKFVYDGANI 238

Query: 243 DTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYES 302
           +TNCTDIT+ +WTYN G+VL G AY+YN T    +W  R  Q LNG+   FF+D ++YE+
Sbjct: 239 ETNCTDITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGS-VVFFRDNVIYEA 296

Query: 303 ACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHT 362
           ACQ    CN DQR+FK+ F+R LG+T+ + P T DTI   I TSA AAA++C+GGTDGHT
Sbjct: 297 ACQPNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHT 356

Query: 363 CGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTN 422
           CG+DW  +  DGYYGLGEQM+ALE + N    D P PY   NGG+S G   AG     TN
Sbjct: 357 CGMDWVWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTN 416

Query: 423 VLQNNLNITKXXXXXXXXXXXXXLSVLIGGAVWML 457
           +  + L+IT                 ++ GA+W++
Sbjct: 417 L--SPLHITAGSKAGASIITCIVSISILTGAMWLV 449

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  436 bits (1121), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/404 (53%), Positives = 281/404 (69%), Gaps = 6/404 (1%)

Query: 13  ICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWH 72
           +     + V    A+D+D  +  SI +AT+LI  G++DYY G +YG  VGMF  PYYWW 
Sbjct: 15  VLLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWE 74

Query: 73  AGEAFGGMLE-NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
           AG A+G ML+ +WF+ +N+TY   +  A+L QTG + +YIP NQ+  EGNDDQ  WGI  
Sbjct: 75  AGGAWGSMLDYSWFM-DNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAA 133

Query: 132 MGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVS 191
           M A ERNFT+P E KP WL + QAVFNTM  RWD+E CGGGLRWQIF WNSGY+YKNTVS
Sbjct: 134 MTAAERNFTNPPEDKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVS 193

Query: 192 NACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTDIT 250
           N  LF +A+RL RYTGN +Y+D AE+V+DW+ DV +V+ N T   V+DG + + NC+ +T
Sbjct: 194 NGALFHMASRLARYTGNQSYVDWAEKVYDWMWDV-HVISNSTYMFVYDGVDANDNCSTVT 252

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDT-IMYESACQDYST 309
           + +WTYNHG++L G AY+YN T G   W  R  +++  A+ +F   T IMYE+ACQ   T
Sbjct: 253 QYQWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAALT 311

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGK 369
           CN DQR+FK+ FSR LGLT+ + P T   I   + TSA AA KSC+GG DGHTCGL+W K
Sbjct: 312 CNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFK 371

Query: 370 QTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDAN 413
              DG YGLGEQMSALE I N     +PAPY  +NGG+SKG+++
Sbjct: 372 DGWDGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGESS 415

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  435 bits (1118), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/425 (50%), Positives = 283/425 (66%), Gaps = 8/425 (1%)

Query: 9   MIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPY 68
           +I  +C  +       HA++LD  +  S+ +AT+L+  G++DYY+G +YG  +GMF +PY
Sbjct: 7   LISLLCTVWFR---AGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPY 63

Query: 69  YWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G M++ W+  +N+TY +++  AL  QTG N DY+P NQ+  EGNDDQ  WG
Sbjct: 64  YWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWG 123

Query: 129 ITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I VM A ERNFT+P   +P WL + QAVFNTM  RWD + C GGLRWQIF WNSGY+YKN
Sbjct: 124 IAVMSAAERNFTNPPADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKN 183

Query: 189 TVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCT 247
           +VSN  LF I ARL R+TGN +Y++ AE+V+DW+  V  +  +   A V+DG  I  NCT
Sbjct: 184 SVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDY 307
            +T ++WTYNHG++L G AY+YN T G ++W  R  + L  A   FF  T+M+E+ACQ  
Sbjct: 244 KVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAYV-FFNRTVMFEAACQGV 301

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDW 367
            TC TDQRTFK+ FSR LG+T+ + P T  TI   +  SA  AA+SC+GG DGHTCG++W
Sbjct: 302 HTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINW 361

Query: 368 GKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
                DGYYGLGEQM ALEV+ N      P PY  +NGG+S GD  AG     TN+  + 
Sbjct: 362 FYGGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SP 419

Query: 428 LNITK 432
           LNIT 
Sbjct: 420 LNITS 424

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 267/379 (70%), Gaps = 3/379 (0%)

Query: 23  ISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
           I++A+ L+    +S+ +A AL+  G++DYY+G +YG  +GMF  PYYWW AG A+G ML+
Sbjct: 17  ITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLD 76

Query: 83  NWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
            W+  +N+TY +++Y+AL  QTG + DYIP NQ+  EGNDDQ  WGI  + A ERNFT+P
Sbjct: 77  YWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNP 136

Query: 143 DEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202
              KP WL + QAVFNTM  RWDS+ C GGLRWQIF WNSGY+YKN+VSN  LF IAARL
Sbjct: 137 PPDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARL 196

Query: 203 GRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTAN-VFDGAEIDTNCTDITKIEWTYNHGIV 261
            RYTGN +Y+D +E+V+DW++  G +    T   V DG  I+TNCTDIT  +WTYN G++
Sbjct: 197 ARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLL 256

Query: 262 LGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIF 321
           L G AY+YN T    +W  R  Q LNG+   FF ++++YE+ACQ    CN DQR+FK+ F
Sbjct: 257 LAGCAYLYNFTQ-DEKWLIRTNQFLNGSGV-FFNNSVIYEAACQPNKNCNNDQRSFKAYF 314

Query: 322 SRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQ 381
           +R LG+T+ + P T DTI   I TSA AAA++C+GGTDGHTCG+DW     DGYYGLGEQ
Sbjct: 315 ARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQ 374

Query: 382 MSALEVIQNLLIHDRPAPY 400
           M+ALE + N    D P PY
Sbjct: 375 MAALEFMVNTRALDLPPPY 393

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  428 bits (1101), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 280/417 (67%), Gaps = 6/417 (1%)

Query: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66
           MR++  +  TF      ++A+ +D  +  SI +A++L+  G++DYY G +YG  +GMF  
Sbjct: 4   MRLLAALASTF----ACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSD 59

Query: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ W+  +N+TY +++  ALL Q G++ DY+P NQ+  EGNDDQ  
Sbjct: 60  PYYWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAF 119

Query: 127 WGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI  M A ERNFT+P   +P WL + QAVFNTM  RWD+  C GGLRWQIF WN+GY+Y
Sbjct: 120 WGIAAMTAAERNFTNPPSDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDY 179

Query: 187 KNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KNTVSN  LF +AARL RYTGN +Y+D A++V+DW+  VG +   ++  V+DG  I  NC
Sbjct: 180 KNTVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQD 306
            +IT  +W+YNHG++L G AY+YN T    +W  R  + LN A + F+ ++++YE ACQ 
Sbjct: 240 ANITGYQWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVACQT 297

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLD 366
            + CNTDQR+FK+ F+R LG+T+ + P   D     I  SA  AA+SC+GG DGHTCG++
Sbjct: 298 VNKCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGIN 357

Query: 367 WGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
           W     DG YGLGEQMSALE + N    +RP PY  +NGG+S GD  AG   S TN+
Sbjct: 358 WFYDGWDGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL 414

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  420 bits (1079), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/415 (49%), Positives = 280/415 (67%), Gaps = 8/415 (1%)

Query: 7   MRMIPFICFTFLSFVGIS-HAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQ 65
           MR +  I   FL+ +G    A++LD    +S+  AT+LI  G+LDYY G   G  +GMF 
Sbjct: 1   MRSVWVILGVFLNLLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
           SPYYWW AG A+G +++ WF  EN+TY +++  ALL Q G   DY+P NQ+  EGNDDQ 
Sbjct: 61  SPYYWWEAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI VM A E+ F +PD  +P WLA+ QAVFNTM  RWDS  C GGLRWQIFTWN+GY+
Sbjct: 121 FWGIAVMSAAEKGFPNPDPDQPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYD 180

Query: 186 YKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTAN---VFDGAEI 242
           YKN+VSN  LF +AARL RYTGN +Y D AE+V+DW+  V   ++N T +   V+DGA I
Sbjct: 181 YKNSVSNGALFHLAARLARYTGNQSYADWAEKVYDWMASV--QLINQTGDWTFVYDGAFI 238

Query: 243 DTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYES 302
             NC+  + ++W+YNHG++LGG AY+ + T G+  W  R  ++L  A + FF + ++ E 
Sbjct: 239 HDNCSRPSVLQWSYNHGLILGGCAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEV 296

Query: 303 ACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHT 362
           ACQ+  TCNTDQR+FK+ F R LGLT+ + P + +     I+ SA+ AA SC+GG DGHT
Sbjct: 297 ACQEAGTCNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHT 356

Query: 363 CGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMN 417
           CG+++ + ++D  YGLGEQ++ALE IQNL   ++ +P   S GGTS G+  AG N
Sbjct: 357 CGMNYSRGSYDESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGN 411

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  419 bits (1078), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 205/399 (51%), Positives = 268/399 (67%), Gaps = 4/399 (1%)

Query: 27  MDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           ++LD     SI +AT+L+  G++DYY G  YG  VG F  PYYWW AG A+G +L+ W+ 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 87  CENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPDEGK 146
            EN TY +LL D+LL Q G +  Y P N+T  EGNDDQ  WG+ VM A ER   +P   +
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYT 206
           P  LA+ QAVFNTM  RWD E C GGLRWQIF WN GY+YKN+VSN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 207 GNSTYLDVAEQVFDWLVDVGY--VVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGG 264
           GN+TYL+ AE+V+DW+  VG   +V  +   V+DG +I+ NCT++ K++WTYNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 265 LAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSRM 324
            A++YN T     W  R  + L+ A+ +   DT +YE+ CQ    CN DQR+FK+ FSR 
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLDSARIFLSNDT-LYEAGCQGGDNCNIDQRSFKAYFSRF 319

Query: 325 LGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSA 384
           LGLT+ + P + +TI   I+ SA+ AA SC+GG DGHTCGL+W     DG +GLGEQM+A
Sbjct: 320 LGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAA 379

Query: 385 LEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNV 423
           LE+IQNL   +RPAPY   NGGTS GD  AG  +   N+
Sbjct: 380 LEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENL 418

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  412 bits (1060), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 203/421 (48%), Positives = 280/421 (66%), Gaps = 5/421 (1%)

Query: 7   MRMIPFICFTFL-SFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQ 65
           M +     F FL S+   + A+D+D     ++ +A+AL+  G++DYY G +YG  +GMF 
Sbjct: 1   MLLCKLWVFGFLASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
            PYYWW AG A+  +++ WF  +N+TY + + +ALL Q+G N+DY+P NQ+ VEGNDDQ 
Sbjct: 61  WPYYWWEAGGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI V+ A ER F +P + +P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN+GY+
Sbjct: 121 FWGIAVLNAAERKFPNPPDDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYD 180

Query: 186 YKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVL--NDTANVFDGAEID 243
           YKNTVSN  LF IAARL  +TGNS+Y+D AE+V+DW+ DV  +    +D   V+DG ++ 
Sbjct: 181 YKNTVSNGALFHIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVS 240

Query: 244 TNCT-DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYES 302
            NC+  +T+I WTYNHG+VL G AY+Y  T G   W  R    L  A   F+ D+I+YE 
Sbjct: 241 NNCSGPVTRIVWTYNHGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEY 299

Query: 303 ACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHT 362
           +CQ   TCN DQR+FKS +S  L  T+ + P   + I  ++  +A AAA++C GG DGHT
Sbjct: 300 SCQQSKTCNVDQRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHT 359

Query: 363 CGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTN 422
           CG++W ++  DG YGLGEQM+ALE +      ++PAPY  +NGG S GD  AG  ++ TN
Sbjct: 360 CGINWNQKGWDGQYGLGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTN 419

Query: 423 V 423
           +
Sbjct: 420 L 420

>YKR089C Chr11 complement(605633..608365) [2733 bp, 910 aa] {ON}
           TGL4Multifunctional triacylglycerol lipase, steryl ester
           hydrolase, and Ca2+-independent phospholipase A2;
           catalyzes acyl-CoA dependent acylation of LPA to PA;
           required with Tgl3p for timely bud formation;
           phosphorylated and activated by Cdc28p
          Length = 910

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 272 TNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSRMLGLTSVM 331
           +N T E+  R  +I NGAKA + K +I+     Q+++      +    I  RM+  +S+ 
Sbjct: 587 SNPTKEFLLR--EITNGAKATWPKVSIIQNHCGQEFAL----DKAISYIKGRMIVTSSLK 640

Query: 332 APFT-SDTIDDLIKTSAEAAAKSCN 355
            PF  +D++  LIK   + + +S N
Sbjct: 641 TPFQFADSVIGLIKAPEQTSDESKN 665

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,737,100
Number of extensions: 2180589
Number of successful extensions: 5158
Number of sequences better than 10.0: 56
Number of HSP's gapped: 5186
Number of HSP's successfully gapped: 56
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)