Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.288.836ON2422426756e-89
Smik_13.218.836ON2422565081e-63
YML113W (DAT1)8.836ON2482625072e-63
Suva_13.318.836ON2512644915e-61
KAFR0A028108.836ON1961671531e-11
NCAS0B003308.836ON199901232e-07
TBLA0B032308.836ON322831073e-05
CAGL0B02277g8.836ON230391002e-04
ZYRO0G14102g8.836ON24040975e-04
KNAG0G034008.836ON22379975e-04
TPHA0C047708.836ON31436968e-04
TDEL0B006108.836ON21537958e-04
Ecym_46078.836ON19439940.001
NDAI0E003108.836ON28551940.002
Kpol_541.148.836ON29034890.007
Kwal_27.102868.836ON29534750.35
KLTH0C03960g8.836ON22234740.42
SAKL0D01562g8.836ON21834691.7
KLLA0D01837g8.836ON25647664.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.28
         (242 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W (R...   264   6e-89
Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W (R...   200   1e-63
YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA bind...   199   2e-63
Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W (R...   193   5e-61
KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON...    64   1e-11
NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836 ...    52   2e-07
TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON...    46   3e-05
CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa] {O...    43   2e-04
ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa] ...    42   5e-04
KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON}      42   5e-04
TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa] {...    42   8e-04
TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON}                41   8e-04
Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON...    41   0.001
NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON}                  41   0.002
Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON} ...    39   0.007
Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W...    33   0.35 
KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly ...    33   0.42 
SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some si...    31   1.7  
KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa] {O...    30   4.7  

>Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W
           (REAL)
          Length = 242

 Score =  264 bits (675), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 145/242 (59%), Positives = 145/242 (59%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD 60
           MAKTLAQ              TLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD 60

Query: 61  MEAVDALRELTXXXXXXXXXXXXXVTAALPPSMDYTHQSLMDXXXXXXRVDVVPPKPFIT 120
           MEAVDALRELT             VTAALPPSMDYTHQSLMD      RVDVVPPKPFIT
Sbjct: 61  MEAVDALRELTHSPSSHPAHNSAPVTAALPPSMDYTHQSLMDQQLQQQRVDVVPPKPFIT 120

Query: 121 HKILLSSTANSDGHMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           HKILLSSTANSDGHMH                                            
Sbjct: 121 HKILLSSTANSDGHMHSNPNGNHTLNHNANLNINNNINSNSNSNSNSNNNVNVNMNFTIN 180

Query: 181 XXXQDPSSSFLMGPYNYLQRPFTVKPYLDLXXXXXXXXXXXXXXXXXHITKNSESTEKNT 240
              QDPSSSFLMGPYNYLQRPFTVKPYLDL                 HITKNSESTEKNT
Sbjct: 181 GNNQDPSSSFLMGPYNYLQRPFTVKPYLDLSTSTASSNQPQPQPQATHITKNSESTEKNT 240

Query: 241 TI 242
           TI
Sbjct: 241 TI 242

>Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W
           (REAL)
          Length = 242

 Score =  200 bits (508), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 130/256 (50%), Gaps = 28/256 (10%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD 60
           MAKTLAQ              TLREGRKPGSGRRRRQDI GKD D T QDQESR ISSRD
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIAGKDTDGTQQDQESRSISSRD 60

Query: 61  MEAVDALRELTXXXXXXXXXXXXXVTAA--LPPSMDYTHQSLMD-----------XXXXX 107
           MEAVDALRELT                A  L PS+DY HQS+M+                
Sbjct: 61  MEAVDALRELTHSPSSHAGHNSTTAAGATSLLPSLDYGHQSIMEQQQQPQPQPHHHHHQQ 120

Query: 108 XRVDVVPPKPFITHKILLSSTANSDGHMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 167
            R+DVVP KPFITHKILLSST N  GH++                               
Sbjct: 121 QRMDVVPAKPFITHKILLSSTGNPSGHIN--------------SSSSVDHSFNHNSNHNL 166

Query: 168 XXXXXXXXXXXXXXXXQDPSSSFLMGPYNYLQRPFTVKPYLDLXXXXXXXXX-XXXXXXX 226
                           QDPSSSFLMGPYNYLQRPFTVKPYLDL                 
Sbjct: 167 NNSVNVDMNFTINGSNQDPSSSFLMGPYNYLQRPFTVKPYLDLSTSSAASNQPRTQPPQA 226

Query: 227 XHITKNSESTEKNTTI 242
            HITKNSESTEKN TI
Sbjct: 227 THITKNSESTEKNATI 242

>YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA binding
           protein that recognizes oligo(dA).oligo(dT) tracts; Arg
           side chain in its N-terminal pentad Gly-Arg-Lys-Pro-Gly
           repeat is required for DNA-binding; not essential for
           viability
          Length = 248

 Score =  199 bits (507), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/262 (47%), Positives = 133/262 (50%), Gaps = 34/262 (12%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD 60
           MAKTLAQ              TLREGRKPGSGRRRRQD GGK+ D + QDQESR ISSRD
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDTGGKETDGSQQDQESRLISSRD 60

Query: 61  MEAVDALRELT--------XXXXXXXXXXXXXVTAALPPSMDYTHQSLMD---------- 102
           MEAVDALRELT                      + +LPPS+DYTHQS MD          
Sbjct: 61  MEAVDALRELTHSPSSHSAHNSSAAPPPHAAAASTSLPPSLDYTHQSFMDQQQQQQQQQQ 120

Query: 103 -XXXXXXRVDVVPPKPFITHKILLSSTANSDGHMHXXXXXXXXXXXXXXXXXXXXXXXXX 161
                  RVDVVPPKPFITHKILLSST NS GH++                         
Sbjct: 121 QQLLQQQRVDVVPPKPFITHKILLSSTGNSGGHVN--------------SNYNADHSINH 166

Query: 162 XXXXXXXXXXXXXXXXXXXXXXQDPSSSFLMGPYNYLQRPFTVKPYLDLXXXXXXXXX-X 220
                                 QDPSSSFLMGPYNYLQRPF VKPYLDL           
Sbjct: 167 NSNHNLNSNVNVNMNFTINGSNQDPSSSFLMGPYNYLQRPFIVKPYLDLSTSTAASNQPR 226

Query: 221 XXXXXXXHITKNSESTEKNTTI 242
                  HITKNS+STEKN TI
Sbjct: 227 TQPSPAAHITKNSDSTEKNATI 248

>Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W
           (REAL)
          Length = 251

 Score =  193 bits (491), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 132/264 (50%), Gaps = 35/264 (13%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADITLQDQESRPISSRD 60
           MAKTLAQ              TLREGRKPGSGRRRRQDIGG+DAD++ QDQESRPISSRD
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGRDADVSQQDQESRPISSRD 60

Query: 61  MEAVDALRELTXXXXX------XXXXXXXXVTAALPPSMDYTHQSLMD------------ 102
           MEAVDALRELT                     A+LPPS+DY  QSLMD            
Sbjct: 61  MEAVDALRELTHSPSSHAAHNPAAAPPHVAAAASLPPSIDYNQQSLMDQQYQYQYQQQQQ 120

Query: 103 ----XXXXXXRVDVVPPKPFITHKILLSSTANSDGHMHXXXXXXXXXXXXXXXXXXXXXX 158
                     RVDVVPPKPFITHKILLSST +   H+                       
Sbjct: 121 QQQQQQQQQQRVDVVPPKPFITHKILLSSTGHPANHL-------------SSTSNANHNH 167

Query: 159 XXXXXXXXXXXXXXXXXXXXXXXXXQDPSSSFLMGPYNYLQRPFTVKPYLDLXXXXXXXX 218
                                    QD  SSFLMGPYNYLQRPF VKPYLDL        
Sbjct: 168 NHNMNGGNVNMNMNMNMNFNINGNNQDSLSSFLMGPYNYLQRPFIVKPYLDLSAGTAPPN 227

Query: 219 XXXXXXXXXHITKNSESTEKNTTI 242
                    HITK++E+TEKNTTI
Sbjct: 228 QAQPQPQATHITKSTETTEKNTTI 251

>KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON}
           Anc_8.836 YML113W
          Length = 196

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 72/167 (43%), Gaps = 33/167 (19%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADITL-------QDQES 53
           MAKTLAQ              TL+EGRKPGSGRR+R  +    A + +         +ES
Sbjct: 1   MAKTLAQGRKPGSGRKPGKAKTLKEGRKPGSGRRKRA-VSASIASLAIPPHTGARTREES 59

Query: 54  R----PISSRDMEAVDALRELTXXXXXXXXXX-----------XXXVTAALPPSMDY--- 95
                PI+SRD+EA+DALRELT                        +   LPP       
Sbjct: 60  NTYDHPITSRDLEAIDALRELTHSPQQMSQATKAMSQQPLNAGSSMIPTMLPPIQQQVVS 119

Query: 96  -----THQSLMDXXXXXXRVDVVPPKPFITHKILLSS--TANSDGHM 135
                T+ +         RVD++  KPF+TH  +LS+   AN+   M
Sbjct: 120 DINPETNSNGSSENGNSQRVDMLSSKPFLTHARILSAQEAANASSSM 166

>NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836
          YML113W
          Length = 199

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 44/90 (48%), Gaps = 22/90 (24%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQ-------------DIGGKDADIT 47
          MAKTLAQ              TLREGRKPGSGR+RR+              IG    + T
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLREGRKPGSGRKRREPALNNHTQLQSEAQIG---TNKT 57

Query: 48 LQDQESRP------ISSRDMEAVDALRELT 71
          L D  ++        + RDMEAVDALR LT
Sbjct: 58 LNDNLTKSPTNELNFTLRDMEAVDALRGLT 87

>TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON}
          Anc_8.836 YML113W
          Length = 322

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 13/83 (15%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQ-DIGGKDADITLQDQESRPISS- 58
          MAKTLAQ              TLREGRKPGSGR+RR  +I  ++  I   D  +  ++S 
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRKRRDGNISNENHLIHSNDTVTSTVNSS 60

Query: 59 -----------RDMEAVDALREL 70
                     +D+EA+ AL  L
Sbjct: 61 RNGSVSNAFTEQDLEALQALNSL 83

>CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa]
          {ON} some similarities with uniprot|P13483
          Saccharomyces cerevisiae YML113w DAT1
          Length = 230

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 23/39 (58%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDI 39
          MAKTLAQ              TLREGRKPGSGRRRR  I
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRDPI 39

>ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa]
          {ON} some similarities with uniprot|P13483
          Saccharomyces cerevisiae YML113W
          Length = 240

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 23/40 (57%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIG 40
          MAKTL+Q              TLR GRKPGSGRRRR D G
Sbjct: 1  MAKTLSQGRKPGSGRKPGKGKTLRNGRKPGSGRRRRDDDG 40

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%)

Query: 56  ISSRDMEAVDALREL 70
           +SSRD+EA+DALREL
Sbjct: 117 VSSRDLEAIDALREL 131

>KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON}
          
          Length = 223

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQ---DIGGKDA-----DITLQDQE 52
          MAKTLAQ              TLREGRKPGSGRR R+   D  G DA         + + 
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRSRRRAVDGAGADAKTGGGGGEGKGKN 60

Query: 53 SRPISSRDMEAVDALRELT 71
          +  +SS+DM AVDALRELT
Sbjct: 61 TASVSSQDMAAVDALRELT 79

>TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa]
          {ON} Anc_8.836 YML113W
          Length = 314

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 22/36 (61%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRR 36
          MAKTLAQ              TLREGRKPGSGRRR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRK 36

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 16/16 (100%)

Query: 56  ISSRDMEAVDALRELT 71
           ISSRD+EA+DALRELT
Sbjct: 137 ISSRDLEALDALRELT 152

>TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 22/37 (59%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQ 37
          MAKTLAQ              TLREGRKPGSGRRR+ 
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRKN 37

>Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON}
          similar to Saccharomyces cerevisiae YML113W DAT1
          Length = 194

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 23/39 (58%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDI 39
          MAKTLAQ              TL EGRKPGSGR++RQ I
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLLEGRKPGSGRKKRQAI 39

>NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIG-GKDADITLQD 50
          MAKTLAQ              TL+EGRKPGSGRRR+  +   +D D  L++
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLKEGRKPGSGRRRKTIVTEQQDGDHNLEN 51

>Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON}
          complement(38346..39218) [873 nt, 291 aa]
          Length = 290

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 20/34 (58%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRR 34
          MAKTLAQ              TLREGRKPGSGRR
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRR 34

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%)

Query: 56  ISSRDMEAVDALRELT 71
           IS+RD+EA+DALRELT
Sbjct: 158 ISTRDLEALDALRELT 173

>Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W
          (DAT1) - datin, an oligo(dA).oligo(dT)-binding protein
          [contig 37] FULL
          Length = 295

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRR 34
          MAKTLAQ              TL +GRKPGSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRK 34

>KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly
          similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA).oligo(dT) tracts
          Length = 222

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRR 34
          MAKTLAQ              TL +GRKPGSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRK 34

>SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some
          similarities with uniprot|P13483 Saccharomyces
          cerevisiae YML113W DAT1 DNA binding protein that
          recognizes oligo(dA).oligo(dT) tracts Arg side chain in
          its N-terminal pentad Gly-Arg-Lys-Pro-Gly repeat is
          required for DNA-binding
          Length = 218

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRR 34
          MAKTLAQ              TL EGRK GSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLAEGRKVGSGRK 34

>KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa]
          {ON} similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA). oligo(dT) tracts; Arg side chain in its N-
          terminal pentad Gly-Arg-Lys-Pro-Gly repeat is required
          for DNA-binding; not essential for viability
          Length = 256

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRRRRQDIGGKDADIT 47
          MAK L+               TL EGRKPGSGR++    G K+  I+
Sbjct: 1  MAKKLSDGRKPGSGRKPGRAKTLAEGRKPGSGRKK----GSKNLGIS 43

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,178,525
Number of extensions: 333631
Number of successful extensions: 469
Number of sequences better than 10.0: 20
Number of HSP's gapped: 438
Number of HSP's successfully gapped: 27
Length of query: 242
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 136
Effective length of database: 41,326,803
Effective search space: 5620445208
Effective search space used: 5620445208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)