Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.278.838ON51451423730.0
YML114C (TAF8)8.838ON51051418150.0
Smik_13.208.838ON51051418120.0
Suva_13.298.838ON50951417930.0
ZYRO0G14146g8.838ON5073774934e-55
NCAS0B003108.838ON5644734903e-54
TDEL0B005908.838ON5413604851e-53
Kpol_1068.108.838ON6173484836e-53
ABL128W8.838ON4743584143e-44
Ecym_46098.838ON5204104103e-43
Kwal_27.102728.838ON5513844104e-43
TPHA0I002308.838ON6143924126e-43
SAKL0D01518g8.838ON5744013957e-41
KLTH0C03916g8.838ON5704723922e-40
KAFR0A028208.838ON4533453255e-32
NDAI0E003008.838ON6642123281e-31
TBLA0D032508.838ON6833543085e-29
KLLA0D01617g8.838ON5623953031e-28
KNAG0G034108.838ON5263932372e-20
CAGL0B02299g8.838ON6431141609e-11
SAKL0E12342g2.96ON80871751.4
Kpol_365.45.377ON69148714.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.27
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   918   0.0  
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   703   0.0  
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   702   0.0  
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   695   0.0  
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   194   4e-55
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   193   3e-54
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   191   1e-53
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   190   6e-53
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   164   3e-44
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   162   3e-43
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   162   4e-43
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   163   6e-43
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   156   7e-41
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   155   2e-40
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   129   5e-32
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   130   1e-31
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   123   5e-29
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   121   1e-28
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    96   2e-20
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    66   9e-11
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    33   1.4  
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    32   4.3  

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/514 (89%), Positives = 461/514 (89%)

Query: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60
           MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA
Sbjct: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120
           LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120

Query: 121 KSNHSVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLP 180
           KSNHSVEYEKLV         H                   SVLLPPSNPLEKLMPSWLP
Sbjct: 121 KSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLP 180

Query: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXX 240
           NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASH      
Sbjct: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRL 240

Query: 241 XXXXXXGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300
                 GEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR
Sbjct: 241 PDDADAGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300

Query: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360
           TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE
Sbjct: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360

Query: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTXXXXXX 420
           ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFT      
Sbjct: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTIDINAN 420

Query: 421 XXXXXXXMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480
                  MNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA
Sbjct: 421 ADDEDDDMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480

Query: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514
           TATNPSFSSFQSTPNENAPTSPPILKATDHDITM
Sbjct: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/514 (70%), Positives = 399/514 (77%), Gaps = 4/514 (0%)

Query: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60
           MTS TSESG GT+ T+VQL+NLPDLTEISHL+IDAPVVEIL+KTVLFQLNSL+ICISNFA
Sbjct: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120
           LDELVNLV VQMDGMFRNLHNL LLQRRS+A+QADLKLL +EFNLD  SLYQQ Q SEFI
Sbjct: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120

Query: 121 KSNHSVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLP 180
           KS HS EYEKL+         H                   +VLLPPSNPLEK +PSWLP
Sbjct: 121 KSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLP 180

Query: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXX 240
           NFPPDHTY+FTPEFNHPITDLKTIK+EIVKES+ESEKALLNLNK L HIS AS+      
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240

Query: 241 XXXXXXGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300
                  EQQLEIWGNAL+E K T   KSFNENNIEQYAKYRVELARERV+KFEVNQLKR
Sbjct: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300

Query: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360
           TKNPFL+ISETLY  +SPHQ H+ IQ+ I+LQFRKSM LF HNLPKVQKLKKEKIRMA E
Sbjct: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360

Query: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTXXXXXX 420
           ER++SLKRRQEELI +R KREQDEGHDLELLL+NEHAR++ ++ T PNA ++ T      
Sbjct: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420

Query: 421 XXXXXXXMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480
                  +NLFGILGSS DENE  S+   N+  E EPPT T QD  NTT + HNTTNIDA
Sbjct: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDTTNTTPVAHNTTNIDA 480

Query: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514
           T ++    S  STPNENAPTSPP   ATDHDITM
Sbjct: 481 TTSH----SPHSTPNENAPTSPPADIATDHDITM 510

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/514 (69%), Positives = 399/514 (77%), Gaps = 4/514 (0%)

Query: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60
           MT   S S  GT+ T+VQL+ LPDLTEISHL+IDAPVVEIL+KTVLFQLNSL+ICISNFA
Sbjct: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120
           LDELVNLVAVQMDGMFRNLHNL LLQRRS A+QADLKLLF+EFN+D ASLYQQ Q+SEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120

Query: 121 KSNHSVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLP 180
           KSNH+VEY KLV         H                   +VLLPPSNPLEKL+PSWLP
Sbjct: 121 KSNHAVEYGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXX 240
           NFPPDHTY+FTPEFNHPITDLKTIK+EIVKES+ESEKALLNLNKRL H+S ASH      
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPV 240

Query: 241 XXXXXXGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300
                  EQQLEIWGNALQE K T  + S NE+NIEQYAKYRVELARERV+KFE+NQLKR
Sbjct: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300

Query: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360
           TKNPFL++SETLY S+ PHQ H+ IQ AIDLQFRKSM LF HNLPKVQKLKKE+IRMA E
Sbjct: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360

Query: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTXXXXXX 420
           ER++SL+RRQEELI ERKKREQDEGHDLELLL+NEHARE+T+NNT PN  ++ T      
Sbjct: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPNVANNSTIIINAN 420

Query: 421 XXXXXXXMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480
                  MNLFGILGSS DENE  S+   N+AGE EPPT  +QD  N+T   HNTTN+DA
Sbjct: 421 ANDEDDDMNLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480

Query: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514
           TA      S  ST +EN PTSPP   ATD+DITM
Sbjct: 481 TANR----STHSTLSENTPTSPPTAMATDNDITM 510

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/514 (69%), Positives = 399/514 (77%), Gaps = 5/514 (0%)

Query: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60
           MTS T ESG G  +T+VQL NLPDLTE+SHL+IDAPV+EIL+K+VLFQLNSL+ICISNFA
Sbjct: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120
           LDE+VNLVAVQMDGMFRNLHNLALLQRRS+ +QADLKLLF+EFNL+ ASL+QQLQISE I
Sbjct: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120

Query: 121 KSNHSVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLP 180
           KS HSVEYEKLV         H                   +VLLPPSNPLEKL+PSWLP
Sbjct: 121 KSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXX 240
           NFPPDHTY+FTPEFNHPITDLKTIKREIVKES ESE+ALLNLNKRL  IS ASH      
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240

Query: 241 XXXXXXGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300
                  E+ LEIWGN L E K   I+KSFNE NIEQYAKYR+ELARERVSKFEVNQLKR
Sbjct: 241 PDASDASER-LEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299

Query: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360
           TKNPFL+ISE+LYS K+PHQ H+ IQR+IDLQ RKS+ LF HNLPKVQKLKKEKI++A E
Sbjct: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359

Query: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTXXXXXX 420
           ER +SLKRRQEELI +RKK+EQDEGHDLELLL+NE AREST+NNTN NA +  T      
Sbjct: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTIDINAN 419

Query: 421 XXXXXXXMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480
                  MNLFGILGSS DENE  SIQ   VAGE EPPTA  +D  NTT +  NTTNID 
Sbjct: 420 ADGDDDDMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDTTNTTPVAQNTTNIDT 479

Query: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514
           TA   +FS   STPNENAPTSPP   ATD+DI +
Sbjct: 480 TA---NFSIL-STPNENAPTSPPTATATDNDINI 509

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  194 bits (493), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/377 (32%), Positives = 205/377 (54%), Gaps = 16/377 (4%)

Query: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMF 76
           +Q+  LP L E+ H   +  VV++L K+V  QL  ++  I+ FA D L+ LV  Q++ M 
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64

Query: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVXXXX 136
             LH ++ LQRR    + D+ +L + FN+ P+S+  Q +ISEF    +  E+  L     
Sbjct: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHL--HSL 122

Query: 137 XXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEFNH 196
                                    +VL+PP+NPL+  +P WLP+FPPDHTY+FTP+++H
Sbjct: 123 RDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSH 182

Query: 197 PITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGEQQ-LEIWG 255
           PITD  TI+R+IV+E+K+SE AL +L+++       +              EQ+ L I+G
Sbjct: 183 PITDETTIRRQIVEEAKQSELALSHLSQK----KNPTDDIVNRSQYDSELAEQETLAIYG 238

Query: 256 NALQEEK--------RTAISKSFNEN-NIEQYAKYRVELARERVSKFEVNQLKRTKNPFL 306
           + L++ K           +SK    N ++E+YA  R+E+AR++V +FE  QL+  ++PFL
Sbjct: 239 SQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFL 298

Query: 307 RISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSL 366
           ++S   ++  +     + + R   L  ++S +    ++P++++ K E    A EERS+ L
Sbjct: 299 KLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRL 358

Query: 367 KRRQEELILERKKREQD 383
           +  + +   + KK E+D
Sbjct: 359 QELRAQREEQEKKGERD 375

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  193 bits (490), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 144/473 (30%), Positives = 234/473 (49%), Gaps = 47/473 (9%)

Query: 26  TEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMFRNLHNLALL 85
           TEI     D  V ++L K++  QL  L++ +S  A +EL  LV  Q+D +   LH ++++
Sbjct: 37  TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVI 96

Query: 86  QRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVXXXXXXXXXHXXX 145
           QRR+ A + D++LL +  NL+ + L+ QLQ+S F+KS +  +Y+ L+             
Sbjct: 97  QRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTI---FDSS 153

Query: 146 XXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIK 205
                           ++L+ P+NP E  +P+WLP FPPDHTY+FTP+FN PITD   IK
Sbjct: 154 DTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIK 213

Query: 206 REIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGEQQLEIWG-NALQEEKRT 264
           +++++E K+SEK+LLNL   +   S +               E+ + I+G +A+  +KR 
Sbjct: 214 QKLIEEGKKSEKSLLNLLNDITEQS-SIENEETSNFDSELAREENIAIYGYDAMSRKKRK 272

Query: 265 ------------------AISKSFNENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFL 306
                               SK FN  N   YA +RVEL R+RV +FE+ QLK  KNPFL
Sbjct: 273 PPHLISIHDTEQNFFNHPQGSKHFNVGN---YAHFRVELTRKRVEEFELEQLKWEKNPFL 329

Query: 307 RISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSL 366
           R+S  +   K        ++  I    ++S      N PK+++ +  ++ +A ++R   +
Sbjct: 330 RLSRMINDKKVSRS---DLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKI 386

Query: 367 KRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSS-----FTXXXXXXX 421
               E+L ++ ++ ++D    L   L  E + E+T+  +N    +      F+       
Sbjct: 387 ----EKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFSTIATNIE 442

Query: 422 XXXXXXMNLFGILGSSGDENEAP------SIQNGN---VAGEPEPPTATVQDN 465
                 + LFG L SS ++N+        SI N N   V G P+  TA+V  N
Sbjct: 443 DVEDDGIGLFGDLESSDEDNDDKVNNTNTSIDNNNILPVDGTPDNETASVASN 495

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  191 bits (485), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 187/360 (51%), Gaps = 20/360 (5%)

Query: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMF 76
           +QL +LP L EI H K +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69

Query: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVXXXX 136
             LH  + +QRR    + D+ L  + +NL PA L +Q Q S++    +  E++ L     
Sbjct: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL----- 124

Query: 137 XXXXXHXXXXXXXXXXXXXXXXXXXSV--LLPPSNPLEKLMPSWLPNFPPDHTYRFTPEF 194
                H                    +  L+ P+NPL + +P W+P FPPDHTY+FTP++
Sbjct: 125 -----HSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQY 179

Query: 195 NHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGEQQLEIW 254
           N PITD   I+R IV E K+SE ALL+L K  ++    S              E+   I+
Sbjct: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKN-MNPPTPSSDADGASYDEALVREETAAIY 238

Query: 255 GNALQEEKRTAISKSFNEN-------NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLR 307
           GN  ++ K+ A S S   +       +IE+YA+ RVE+AR++V ++E  Q+K  +NPF++
Sbjct: 239 GNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIK 298

Query: 308 ISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLK 367
            S+   S+ S     R   R I    ++S+     ++P++Q  K++  R A ++R   L+
Sbjct: 299 YSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQ 358

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  190 bits (483), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 178/348 (51%), Gaps = 14/348 (4%)

Query: 11  GTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLV 68
           G     +QL  LP LTE  + + +  + +IL K V  QL S+  D  I+ FA + L++LV
Sbjct: 3   GEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLV 62

Query: 69  AVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEY 128
             Q+D M   LH L+ LQRR+   +AD+ +  + FNL P  L +Q Q S+++   +  +Y
Sbjct: 63  VGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDY 122

Query: 129 EKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTY 188
           E L                              S L+P SNPL+KL+PSWLP+FPPD+TY
Sbjct: 123 ESLTKIATTTTRTLSTYQKLDLTHKDTSTAQT-SKLVPISNPLQKLIPSWLPDFPPDYTY 181

Query: 189 RFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGE 248
           +FTP++N PITD   I+R++V+E K+SEKALLNL  R       S              E
Sbjct: 182 KFTPQYNTPITDETIIRRKVVEEGKQSEKALLNL-LRGGQEDRISRDLKFSSSEMELATE 240

Query: 249 QQLEIWGNALQEEKRTAISKSF-------NENNIEQYAKYRVELARERVSKFEVNQLKRT 301
           + L  +       K      SF       N  N+E+YA+ RVE+ R++V  +E  QL+  
Sbjct: 241 ETLATYSAITLRNKHLT---SFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQ 297

Query: 302 KNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQK 349
           +NPFL+IS  + ++             I    ++S++ F H++PK Q+
Sbjct: 298 RNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  164 bits (414), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 179/358 (50%), Gaps = 19/358 (5%)

Query: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQMDG 74
           +QLK LPDLTE++      P+ ++L + V   L ++  D+ I+    + LV  V +Q+D 
Sbjct: 19  IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75

Query: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVXX 134
           M + LH  A +QRR+  +  D++L      ++  SLY++   S++++  H+     +   
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135

Query: 135 XXXXXXX-HXXXXXXXXXXXXXXXXXXXSV----LLPPSNPLEKLMPSWLPNFPPDHTYR 189
                   H                    V    L+PP+N     +P WLP FPPDHTY+
Sbjct: 136 SASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195

Query: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGEQ 249
           FT  +N PITD + +KR++ +ESK SEKALL++   L   +                G+Q
Sbjct: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHM---LGTATKKPRADDAQLPQIISDGQQ 252

Query: 250 Q-LEIWGNALQEEKRTAISKSFNEN-NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLR 307
           + L I+G    E +R A   +     NIE YA+ RVELAR RV +FE  +L+  KNPF+R
Sbjct: 253 ENLLIYG---PERRRLAPEPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIR 309

Query: 308 ISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE-ERSR 364
            +       +     +AI+R   +   +S +   H +P++++ K  ++  A E ER+R
Sbjct: 310 AAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYERERAR 367

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  162 bits (410), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 198/410 (48%), Gaps = 36/410 (8%)

Query: 1   MTSTTSESGFGTR--RTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICI 56
           MT+    S   T   +  +QLK LP L E++      P+  +L ++V  QL ++  D  I
Sbjct: 1   MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSI 57

Query: 57  SNFALDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQI 116
           +    + ++  + +QM+ MF+ LH  A +QRR+  +  DLKL  K   ++  SLY + + 
Sbjct: 58  TELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEK 117

Query: 117 SEFIKSNHSVEY-----EKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPL 171
           S +IK  +  E+     + L                                L+PP+N  
Sbjct: 118 SRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNIN 177

Query: 172 EKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISL 231
              +P+WLP FPPDHTY+FT  +N PI+D + +KR + +E K SEKALLN+        L
Sbjct: 178 NSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKML 237

Query: 232 ASHXXXXXXXXXXXXGEQQLEIWGNALQEEKR------------------TAISKSFNEN 273
                           E+   I+G   Q  +R                  ++ SK F   
Sbjct: 238 KVEDEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGF--- 294

Query: 274 NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHR-AIQRAIDLQ 332
           NI++YA+ R+ LAR +V +FE ++L+  KNPF+R S       +  +  R A +R  ++ 
Sbjct: 295 NIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNIL 354

Query: 333 FRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLKRRQEELILERKKREQ 382
            R+S +    ++PK+++LK  ++  AI ER R +K+++ E+ LE+K  +Q
Sbjct: 355 LRRSYVGVLKSIPKLRQLKANEMAAAI-ERER-IKQKEREMELEKKHLQQ 402

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  162 bits (410), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 194/384 (50%), Gaps = 30/384 (7%)

Query: 16  LVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQMD 73
           +VQLKNLP L EI    +D P+ ++L K +  QL S+  D  IS  A + L+ LV   + 
Sbjct: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77

Query: 74  GMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVX 133
            M  +LH +A +QRR   ++ DL L+ + +NL  + L  +L+ S +++S H  + +K+  
Sbjct: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137

Query: 134 XXXXXXXXHXXXXXXXXXXXXX-----XXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTY 188
                                              L+PPS    K +P WLP+FPPDHTY
Sbjct: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197

Query: 189 RFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXX----XXXXX 244
           RFT ++N PITD + +KR++ +E+  SEKA       L+H+S+ SH              
Sbjct: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKA-------LIHLSMLSHEEASSGPIDSDTIY 250

Query: 245 XXGEQQLEIWGNALQEEKRTAIS------KSFNENN--IEQYAKYRVELARERVSKFEVN 296
              +Q+ ++    ++++K  AI+      ++  + N  +E+YA+ RVE+AR RV+++E +
Sbjct: 251 EEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERH 310

Query: 297 QLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIR 356
           QL+  K  F++ +  L          + +++ I     +S +    + P +++ +K +I 
Sbjct: 311 QLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIA 370

Query: 357 MAIEERSRSLKRRQEELILERKKR 380
           +A E R    + R E+L  ER+ R
Sbjct: 371 LAEENR----RLRDEKLRKEREAR 390

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  163 bits (412), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 116/392 (29%), Positives = 184/392 (46%), Gaps = 26/392 (6%)

Query: 13  RRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAV 70
           ++  VQL  LP LTE  +     P+  IL K +  QL  +  D  I+ FA   L +LV  
Sbjct: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDE 101

Query: 71  QMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEK 130
           Q+  M   +  LA LQRR    + D+ L  + FNL P+ L    Q SE+IK  +  E   
Sbjct: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEV-T 160

Query: 131 LVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTYRF 190
           L+                               L+P +N LE ++P WLP+FPPD+TY+F
Sbjct: 161 LLNRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKF 220

Query: 191 TPEFNHPITDLKTIKREIVKESKESEKALLNL--NKRLLHISLASHXXXXXXXXXXXXGE 248
           TP+FN  ITD   I++++  E K+SEKALL+L  ++++    L +              E
Sbjct: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLE 280

Query: 249 QQLEIWGNALQEEKRTAI-------------SKSFNENNIEQYAKYRVELARERVSKFEV 295
                 G +   +KRTA              + + N+ +IE+Y   R+ + R +V ++E 
Sbjct: 281 MDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYED 340

Query: 296 NQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKI 355
            QL+   +PFL+++  L            I   I+   ++S +   +++P + + KK+  
Sbjct: 341 KQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTR 400

Query: 356 RMAIEERSRS----LKRRQEELILERKKREQD 383
             A+ E+ R     LKRR+E+L    KK EQ+
Sbjct: 401 ERAMVEKKRRHDEWLKRREEKL----KKLEQE 428

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  156 bits (395), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 116/401 (28%), Positives = 201/401 (50%), Gaps = 29/401 (7%)

Query: 14  RTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQ 71
           R  ++LK LP L    H  ++ P+ +IL + V  +L  +  D+ +S FA + LV LV+  
Sbjct: 16  RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSEN 75

Query: 72  MDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL 131
           +  M   LH    +QRR   ++ DL LL K ++L  + L ++L+ S++I SNH  +  K+
Sbjct: 76  LSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKI 135

Query: 132 VXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSV-----LLPPSNPLEKLMPSWLPNFPPDH 186
                                                L+PP+N   + +P WLP FPPDH
Sbjct: 136 AQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDH 195

Query: 187 TYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHIS----LASHXXXXXXXX 242
           TYRFT ++N P+ D + ++R++V+E K+SE+AL+NL K   H S    L ++        
Sbjct: 196 TYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKH--HDSTNQDLGNNERVEKRSL 253

Query: 243 XXXXGEQQLEIWGNALQEEKRTAISKSFNE---------NNIEQYAKYRVELARERVSKF 293
                E+   I+G    E K++  +++ +E          ++E+YA+ RVE+AR +V ++
Sbjct: 254 YEETQEETFLIFG---PERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEY 310

Query: 294 EVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKE 353
           E  QL+  KNPF++ +      K      +AI + +    ++S +    ++PK+ ++K  
Sbjct: 311 EQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKAR 370

Query: 354 KIRMAIEERSRSLKRRQEELILERKKREQDEGHDLELLLHN 394
           +  +A E R   L++  E    ER+++ +  G D  L L+N
Sbjct: 371 ERELANERRREMLEKLNE----ERQRQAEAGGGDEVLDLNN 407

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 135/472 (28%), Positives = 223/472 (47%), Gaps = 56/472 (11%)

Query: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDG 74
           VQL++LP+L EI    +D P+ ++L K V  QL +++  + IS FA + L+ LV   +  
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNH-----SVEYE 129
           M  +LH +  +QRR   ++ DL L+   +NL  A L  +L+ S++++S++      V  E
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREE 138

Query: 130 KLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTYR 189
             V                               L+PP+    K +P WLP FPPDHTYR
Sbjct: 139 SEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198

Query: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHXXXXXXXXXXXXGEQ 249
           FT +FN PITD + +KR++ +E+  SEKAL++L+K L H    S              + 
Sbjct: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-LSHEESPSEGADSDEIFKESQQDT 257

Query: 250 QLEIWGNALQEEKRTAISKSFN--------ENNIEQYAKYRVELARERVSKFEVNQLKRT 301
           QL I+G A ++ K  AI+ + +          N+E+YA+ RVE+AR +V ++E +QL   
Sbjct: 258 QL-IFGPA-KKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQ 315

Query: 302 KNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEE 361
           K  F++ +  L S  +  +  + +++ +     +S +    + P +++ +K ++ +A E 
Sbjct: 316 KGAFIKAAH-LLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEEN 374

Query: 362 RSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTXXXXXXX 421
           R    ++ ++E     K  +  +  DL+ L            N +P              
Sbjct: 375 RRLREEQIRQEREERLKNSKDYDVLDLDNL------------NEDP-------------- 408

Query: 422 XXXXXXMNLFGILGSSG--DENEAPSIQNGNVAGEPEP-PTATVQDNANTTS 470
                    FG LGSS   DE E P  +  N +G   P  T  + D ANT S
Sbjct: 409 --------FFGGLGSSDTEDEKEPPQQEGTNKSGNTAPSATPEISDRANTMS 452

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  129 bits (325), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 107/345 (31%), Positives = 168/345 (48%), Gaps = 40/345 (11%)

Query: 40  ILRKTVLFQLNSLDI--CISNFALDELVNLVAVQMDGMFRNLHNLALLQRR-SRATQADL 96
           +L K+V  +L  +++   + N A D L+ L+ VQ++ + + L  L+LLQRR S AT++D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 97  KLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXX 156
            LL K FNL  + L  +L+IS  IK  +S E EK +         H              
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYS-EDEKKLSEDSIHYNQHTDFVGPVETSSFQ- 146

Query: 157 XXXXXSVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESE 216
                  LL P+NPL+  +PSW P+ PPDHTY+FTP++N+ I D K IK++   ESK  +
Sbjct: 147 -------LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199

Query: 217 KALLNLNKRLLHISLASHXXXXXXXXXXXXGEQQLEIWGNALQEEKRT--AISKSFN--- 271
            AL NL  +     + S+             + + +     ++E+  T   + KS N   
Sbjct: 200 TALFNLINK-----IESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254

Query: 272 ----ENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQR 327
               + +IE+Y+  RV +AR +VSKFE   L    NPF+ +       KS          
Sbjct: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQTDVKS---------- 304

Query: 328 AIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLKRRQEE 372
                  +S  L  +++P++   KK+ IR A  ER   + R +E+
Sbjct: 305 ----YLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED 345

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  130 bits (328), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 120/212 (56%), Gaps = 12/212 (5%)

Query: 27  EISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMFRNLHNLALLQ 86
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79

Query: 87  RRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSV-EY-------EKLVXXXX-- 136
           RR+   + DL+L  + FN++P+ L  Q + S++I+   S  EY       E++V      
Sbjct: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139

Query: 137 -XXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPLEKL-MPSWLPNFPPDHTYRFTPEF 194
                                     ++L+ P+NP + + + SWLP+FPPDHTY+FTP+F
Sbjct: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199

Query: 195 NHPITDLKTIKREIVKESKESEKALLNLNKRL 226
           N+PITD K IK+++V+E  +SEKALLN  K +
Sbjct: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNI 231

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 35/141 (24%)

Query: 274 NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSK----------------- 316
           ++ +Y+ +RVEL R++V  FE  +L+  KNPFL++S+ +   K                 
Sbjct: 339 DVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLEKEDYYDYDNDEDDLEERK 398

Query: 317 ------------SPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERS- 363
                       SP +    I   I    ++S     +N PK++K KK+++++AIE+R  
Sbjct: 399 NYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYPKLKKAKKQRVKLAIEKRDQ 458

Query: 364 --RSLKRRQEELILERKKREQ 382
             + L++ QEE   ERK +EQ
Sbjct: 459 RLQELRKIQEE---ERKVKEQ 476

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  123 bits (308), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 101/354 (28%), Positives = 158/354 (44%), Gaps = 60/354 (16%)

Query: 19  LKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDGMF 76
           LKNLPDL +  +    + + ++L K++  QL  ++    IS  A + L+ LV +Q++ M 
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL--VXX 134
             L  L++ QRR      DL L  + FNL+P+ L   L+ S FIKS  + +Y  L  +  
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 135 XXXXXXXHXXXXXXXXXXXXXXXXXXXSV---LLPPSNPLEKLMPSWLPNFPPDHTYRFT 191
                  H                   S    ++PPSN + + MP WLP+ PPDHTY+FT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 192 PEFNHPITDLKTIKREIVKESKESEKAL-------------------------------L 220
           P +N PITD   +K+ +V E K +E AL                               +
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINI 281

Query: 221 NLNKRLLHISLASHXXXXXXXXXXXXGEQQLE------IWGNALQEEK------------ 262
           + N     ++L S              ++ L       I+G+ALQ  K            
Sbjct: 282 DTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPK 341

Query: 263 -RTAISKSF---NENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETL 312
             T +S+ F   +  N+E+YA+ +V+  RE+V  +E  QL+  KNPF + S+ +
Sbjct: 342 AETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 107/395 (27%), Positives = 183/395 (46%), Gaps = 39/395 (9%)

Query: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDG 74
           V+L  LP+L E+ H     P+  +  + VL QL +L+  + IS  A D+L  +  +Q+D 
Sbjct: 21  VRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDD 77

Query: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL--- 131
           + ++L  +  +QRR++ ++ DL L FK   +D   L  Q++IS F+      E   L   
Sbjct: 78  LLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137

Query: 132 VXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVL--LPPSNPLEKLMPSWLPNFPPDHTYR 189
           V                              +L  LP SN   K +PSWLP  PPDHTY+
Sbjct: 138 VLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197

Query: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKR------LLHISLASHXXXXXXXXX 243
           FT  +  PITD + +K+++++E + SEKALLN+  +      L+ ++  S          
Sbjct: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS 257

Query: 244 XXXGEQQLEI---------------WGNALQEEKRTAISKSFNEN-NIEQYAKYRVELAR 287
               E QLE                WG         + + S  +N N+ +Y K R  + +
Sbjct: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVK 317

Query: 288 ERVSKFEVNQLKRTKNPFLRISETL--YSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLP 345
            R  + E     + +NPF+R +     Y   S  +  ++++  +    R+S +    ++P
Sbjct: 318 RRAERAENQVSNKRRNPFIRGAMICSPYGQGST-KSRKSVENQLKTMLRRSYLGLIDSIP 376

Query: 346 KVQKLKKEKIRMAIEERSRSLKRRQEELILERKKR 380
           +V+++ +E+ R   EER R L   QE+  +E++K+
Sbjct: 377 RVKEV-RERARKEAEERERLL---QEQRRIEKEKK 407

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 102/393 (25%), Positives = 166/393 (42%), Gaps = 48/393 (12%)

Query: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60
           M+   S+   G +  LV   + P   E+ H   DA V ++L  +V FQ+++         
Sbjct: 1   MSDWESDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSAGLARGGGGG 58

Query: 61  --------LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQ 112
                      L+ LV  Q+ GM   LH +A +QRR  AT  D+ LL + F L P  + +
Sbjct: 59  GVGMAGQAFQLLLQLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEE 118

Query: 113 QLQISEFIKSNH-SVEYEKLVXXXXXXXXXHXXXXXXXXXXXXXXXXXXXSVLLPPSNPL 171
           Q+ +S+ I  N   V  E+ V                                +    P+
Sbjct: 119 QMYLSKKIGYNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSD---MSQELPI 175

Query: 172 EKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNK---RLLH 228
            + +P+WLP  PP+HTY+FT E+N  + D K +K +I+KES E E +L NL +   R   
Sbjct: 176 AEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDAD 235

Query: 229 ISLASHXXXXXXXXXXXXGEQQLEIWG---------NALQEEKRTA--ISKSFNENNIEQ 277
             +                ++ + ++G            + ++RT   + KSF   +++ 
Sbjct: 236 TKVDERARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSF---DVQA 292

Query: 278 YAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAI---QRAIDLQFR 334
           Y+  RV+LAR  V +FE     R +NPFL               HRA+    + +     
Sbjct: 293 YSLGRVKLARNAVQRFEWETKYRPRNPFL-------------CSHRAVPENSKKVYSMLE 339

Query: 335 KSM-MLFAHNLPKVQKLKKEKIRMAIEERSRSL 366
            S+  L   +LP+++  K   I  A+E+R   L
Sbjct: 340 NSLNELVQVDLPRLESRKAAAIAHAVEQRDAKL 372

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 14  RTLVQLKNLPDLTEI-SHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAV 70
           R  VQ     D+ EI S  ++D  + E+L++ V  QL ++D  + ++  A+D+LV     
Sbjct: 10  RGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAED 69

Query: 71  QMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNH 124
           Q++ +   LH ++LLQRR     +DL++  + +NL P+ LY   + S+FI+ N+
Sbjct: 70  QLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENY 123

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%)

Query: 176 PSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHIS 230
           P WLP+FPPDHTY++TP + + +     I++++V+E + SEKAL+ L   L  IS
Sbjct: 198 PGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSIS 252

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 12/104 (11%)

Query: 274 NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQF 333
           ++E YA+ R+E+AR +V  FE  QL    NP LR+++  Y            Q+ I    
Sbjct: 399 DVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCI---- 454

Query: 334 RKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLKRRQEELILER 377
           +++M  F  N+P +    KEK +M    R  S+KR+ +ELI +R
Sbjct: 455 KRTMDRFKRNIPII----KEKRKMV---RKESIKRK-DELIAKR 490

>SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]
           {ON} some similarities with uniprot|P53894 Saccharomyces
           cerevisiae YNL161W CBK1 Protein kinase involved in cell
           wall biosynthesis required for efficient apical growth
           proper mating projection morphology bipolar bud site
           selection in diploid cells and cell separation
          Length = 808

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 28/71 (39%), Gaps = 6/71 (8%)

Query: 439 DENEAPSIQNGNVAGE--PEPPTATVQDNANTTSMTHNTTNI----DATATNPSFSSFQS 492
           D+N   +  NG+  G   P PPTA    N      +H +       +A  TN     F  
Sbjct: 27  DQNRFSTASNGSYQGNTVPRPPTAAFSSNYMRQQGSHQSLQDHLQREAAGTNALVGGFTD 86

Query: 493 TPNENAPTSPP 503
            P  N P +PP
Sbjct: 87  VPTLNYPATPP 97

>Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)
           [2076 nt, 692 aa]
          Length = 691

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 5/48 (10%)

Query: 268 KSFNENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSS 315
           KSFNE+  +   KYR+       S  E+ QL+++K P++RIS+  ++S
Sbjct: 478 KSFNESTNQSKYKYRLS-----TSLNELTQLRQSKYPWVRISDKAWAS 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,777,834
Number of extensions: 2124518
Number of successful extensions: 13495
Number of sequences better than 10.0: 183
Number of HSP's gapped: 13840
Number of HSP's successfully gapped: 218
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)